Protein Family IF07346
Metagenome
Metatranscriptome
Isolate
120
Members
47
Samples
118
Scaffolds
74.94
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_048668|Ga0466712_048668_515_778
- Length
- 87 aa
- Sequence
- MRNSFKNLTFAELKAKRDELSRKYMDFRFQMIIGHVDNPLQKRLFRRQIARLNTLIHGHEMAQQEQAKTSAANAPATPTSLATASKA
Sample Types
Isolate
1.7%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
1.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.7%
Kalotermitidae
31.1%
Unclassified
8.9%
Termopsidae
6.7%
Rhinotermitidae
4.4%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 13 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 19 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 34 | 3300021232 | Termite gut microbial communities from nest from French Guiana - FG16_14_4 mRNA SA | Metatranscriptome | |
| 35 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 46 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466735_214009 | 3300042624 | Bacteria | 1722 |
| 2 | Ga0466703_104430 | 3300042636 | Bacteria | 21196 |
| 3 | Ga0223676_1012190 | 3300021232 | Bacteria | 733 |
| 4 | Ga0466732_071870 | 3300042656 | Bacteria | 1967 |
| 5 | Ga0466713_128250 | 3300042602 | Bacteria | 3709 |
| 6 | Ga0466716_437922 | 3300042605 | Bacteria | 19281 |
| 7 | Ga0466719_351165 | 3300042606 | Bacteria | 12805 |
| 8 | Ga0466715_222811 | 3300042616 | Bacteria | 24815 |
| 9 | Ga0466715_369095 | 3300042616 | Bacteria | 13389 |
| 10 | Ga0466726_314555 | 3300042619 | Bacteria | 1806 |
| 11 | Ga0466709_309524 | 3300042648 | Bacteria | 19652 |
| 12 | Ga0466708_011474 | 3300042652 | Bacteria | 16565 |
| 13 | Ga0466692_199021 | 3300042591 | Bacteria | 2878 |
| 14 | Ga0466696_272484 | 3300042596 | Bacteria | 24883 |
| 15 | Ga0123356_13879837 | 3300010049 | Bacteria | 516 |
| 16 | Ga0123353_10534450 | 3300010167 | Bacteria | 1696 |
| 17 | Ga0123353_12295474 | 3300010167 | Bacteria | 649 |
| 18 | Ga0123353_12761740 | 3300010167 | Bacteria | 576 |
| 19 | Ga0466706_042072 | 3300042599 | Bacteria | 1525 |
| 20 | Ga0072940_1027100 | 3300005200 | Bacteria | 1750 |
| 21 | Ga0123357_10001013 | 3300009784 | Bacteria | 28794 |
| 22 | Ga0466712_007206 | 3300042614 | Bacteria | 3040 |
| 23 | Ga0466715_362118 | 3300042616 | Bacteria | 1131 |
| 24 | Ga0466728_295245 | 3300042620 | Bacteria | 6010 |
| 25 | Ga0466703_422882 | 3300042636 | Bacteria | 4885 |
| 26 | Ga0466704_258052 | 3300042643 | Bacteria | 7209 |
| 27 | Ga0466690_424141 | 3300042590 | Bacteria | 11663 |
| 28 | Ga0466692_086049 | 3300042591 | Bacteria | 21718 |
| 29 | Ga0466696_182607 | 3300042596 | Bacteria | 2597 |
| 30 | Ga0466699_002667 | 3300042597 | Bacteria | 1040 |
| 31 | Ga0466732_076026 | 3300042656 | Bacteria | 3499 |
| 32 | Ga0123353_10568456 | 3300010167 | Bacteria | 1630 |
| 33 | Ga0123353_10959353 | 3300010167 | Bacteria | 1155 |
| 34 | Ga0466701_078389 | 3300042598 | Bacteria | 1098 |
| 35 | Ga0466735_062655 | 3300042624 | Bacteria | 4422 |
| 36 | Ga0466699_058674 | 3300042597 | Bacteria | 3421 |
| 37 | Ga0466699_397710 | 3300042597 | Bacteria | 1021 |
| 38 | Ga0123356_11251934 | 3300010049 | Bacteria | 907 |
| 39 | Ga0123356_12225061 | 3300010049 | Bacteria | 685 |
| 40 | Ga0123353_10003570 | 3300010167 | Bacteria | 19691 |
| 41 | Ga0123353_10044741 | 3300010167 | Bacteria | 7020 |
| 42 | Ga0123353_10297530 | 3300010167 | Unclassified | 2466 |
| 43 | Ga0123354_10543091 | 3300010882 | Bacteria | 881 |
| 44 | JGI24698J34947_10010104 | 3300002449 | Bacteria | 5175 |
| 45 | JGI24698J34947_10316972 | 3300002449 | Bacteria | 556 |
| 46 | Ga0466715_338738 | 3300042616 | Bacteria | 2269 |
| 47 | Ga0466723_195578 | 3300042618 | Bacteria | 19421 |
| 48 | Ga0466723_212610 | 3300042618 | Bacteria | 31402 |
| 49 | Ga0466731_100517 | 3300042622 | Bacteria | 1004 |
| 50 | Ga0466703_143105 | 3300042636 | Bacteria | 17971 |
| 51 | Ga0466704_074659 | 3300042643 | Bacteria | 15694 |
| 52 | Ga0466708_056187 | 3300042652 | Bacteria | 2552 |
| 53 | Ga0466690_157401 | 3300042590 | Bacteria | 11752 |
| 54 | Ga0466693_275075 | 3300042592 | Bacteria | 1100 |
| 55 | Ga0466694_223134 | 3300042594 | Bacteria | 1338 |
| 56 | Ga0466696_334108 | 3300042596 | Bacteria | 35042 |
| 57 | Ga0123353_11661429 | 3300010167 | Bacteria | 802 |
| 58 | Ga0466701_073103 | 3300042598 | Bacteria | 1285 |
| 59 | Ga0466717_261217 | 3300042604 | Bacteria | 1701 |
| 60 | Ga0466716_393053 | 3300042605 | Bacteria | 12262 |
| 61 | JGI24698J34947_10277776 | 3300002449 | Bacteria | 613 |
| 62 | Ga0068302_10348751 | 3300005071 | Bacteria | 591 |
| 63 | Ga0466715_517604 | 3300042616 | Bacteria | 2751 |
| 64 | Ga0466726_285056 | 3300042619 | Bacteria | 1358 |
| 65 | Ga0466703_044908 | 3300042636 | Bacteria | 22014 |
| 66 | Ga0466704_304489 | 3300042643 | Bacteria | 9247 |
| 67 | Ga0264413_112829 | 3300024493 | Bacteria | 1711 |
| 68 | Ga0466691_109493 | 3300042593 | Bacteria | 23172 |
| 69 | Ga0466694_163660 | 3300042594 | Bacteria | 2917 |
| 70 | Ga0466696_283737 | 3300042596 | Bacteria | 2598 |
| 71 | Ga0466699_152809 | 3300042597 | Bacteria | 1391 |
| 72 | Ga0123356_10694955 | 3300010049 | Bacteria | 1186 |
| 73 | Ga0123356_11805498 | 3300010049 | Bacteria | 760 |
| 74 | Ga0123353_10347133 | 3300010167 | Bacteria | 2238 |
| 75 | Ga0123353_10367682 | 3300010167 | Bacteria | 2158 |
| 76 | Ga0123353_11014754 | 3300010167 | Bacteria | 1113 |
| 77 | Ga0123353_12835985 | 3300010167 | Bacteria | 567 |
| 78 | Ga0123354_10305866 | 3300010882 | Bacteria | 1495 |
| 79 | Ga0466719_176803 | 3300042606 | Bacteria | 1151 |
| 80 | Ga0466719_223627 | 3300042606 | Bacteria | 5153 |
| 81 | Ga0466720_144831 | 3300042607 | Bacteria | 1174 |
| 82 | JGI24698J34947_10008346 | 3300002449 | Bacteria | 5683 |
| 83 | JGI24698J34947_10062454 | 3300002449 | Bacteria | 1829 |
| 84 | JGI24698J34947_10152552 | 3300002449 | Bacteria | 957 |
| 85 | Ga0466712_048668 | 3300042614 | Bacteria | 1539 |
| 86 | Ga0466712_138499 | 3300042614 | Bacteria | 1260 |
| 87 | Ga0466711_353540 | 3300042615 | Bacteria | 1973 |
| 88 | Ga0466715_086384 | 3300042616 | Bacteria | 11934 |
| 89 | Ga0466718_150982 | 3300042617 | Bacteria | 1236 |
| 90 | Ga0466723_029844 | 3300042618 | Bacteria | 15406 |
| 91 | Ga0466705_023623 | 3300042612 | Bacteria | 5713 |
| 92 | Ga0466704_214222 | 3300042643 | Bacteria | 11711 |
| 93 | Ga0466708_115426 | 3300042652 | Bacteria | 1369 |
| 94 | Ga0466691_015001 | 3300042593 | Bacteria | 24199 |
| 95 | Ga0466699_319799 | 3300042597 | Bacteria | 3167 |
| 96 | Ga0466732_172207 | 3300042656 | Bacteria | 1764 |
| 97 | Ga0466701_062392 | 3300042598 | Bacteria | 1054 |
| 98 | Ga0466719_411304 | 3300042606 | Bacteria | 2664 |
| 99 | Ga0466711_005006 | 3300042615 | Bacteria | 1053 |
| 100 | Ga0466715_108335 | 3300042616 | Bacteria | 1122 |
| 101 | Ga0466715_150441 | 3300042616 | Bacteria | 29649 |
| 102 | Ga0466723_240188 | 3300042618 | Bacteria | 3393 |
| 103 | Ga0255786_1004416 | 3300022815 | Bacteria | 734 |
| 104 | Ga0456237_0001275 | 3300041968 | Bacteria | 3988 |
| 105 | Ga0123356_10794247 | 3300010049 | Bacteria | 1117 |
| 106 | Ga0123353_10146935 | 3300010167 | Bacteria | 3768 |
| 107 | Ga0123353_10282626 | 3300010167 | Bacteria | 2547 |
| 108 | Ga0123353_12347606 | 3300010167 | Bacteria | 640 |
| 109 | Ga0466707_215128 | 3300042601 | Bacteria | 2272 |
| 110 | Ga0466717_233059 | 3300042604 | Bacteria | 1647 |
| 111 | Ga0466719_019759 | 3300042606 | Bacteria | 2771 |
| 112 | Ga0466698_052560 | 3300042610 | Bacteria | 1802 |
| 113 | JGI24698J34947_10009359 | 3300002449 | Bacteria | 5379 |
| 114 | JGI24702J35022_10045795 | 3300002462 | Bacteria | 2330 |
| 115 | JGI24705J35276_11942982 | 3300002504 | Bacteria | 787 |
| 116 | JGI24696J40584_12909912 | 3300002834 | Bacteria | 1247 |
| 117 | Ga0466712_035190 | 3300042614 | Bacteria | 2966 |
| 118 | Ga0466723_074053 | 3300042618 | Bacteria | 35080 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002449 | JGI24698J34947_10316972 | JGI24698J34947_103169721 | 70 |
| 2 | 3300005071 | Ga0068302_10348751 | Ga0068302_103487512 | 70 |
| 3 | 3300010167 | Ga0123353_10534450 | Ga0123353_105344503 | 70 |
| 4 | 3300010167 | Ga0123353_11014754 | Ga0123353_110147543 | 70 |
| 5 | 3300041968 | Ga0456237_0001275 | Ga0456237_0001275_673_885 | 70 |
| 6 | 3300042591 | Ga0466692_199021 | Ga0466692_199021_154_366 | 70 |
| 7 | 3300042597 | Ga0466699_002667 | Ga0466699_002667_58_270 | 70 |
| 8 | 3300042656 | Ga0466732_076026 | Ga0466732_076026_2183_2395 | 70 |
| 9 | 3300042591 | Ga0466692_086049 | Ga0466692_086049_7441_7656 | 71 |
| 10 | 3300042592 | Ga0466693_275075 | Ga0466693_275075_112_327 | 71 |
| 11 | 3300042593 | Ga0466691_109493 | Ga0466691_109493_10557_10772 | 71 |
| 12 | 3300042596 | Ga0466696_272484 | Ga0466696_272484_7434_7649 | 71 |
| 13 | 3300042596 | Ga0466696_334108 | Ga0466696_334108_22724_22939 | 71 |
| 14 | 3300042597 | Ga0466699_058674 | Ga0466699_058674_938_1153 | 71 |
| 15 | 3300042597 | Ga0466699_152809 | Ga0466699_152809_677_892 | 71 |
| 16 | 3300042597 | Ga0466699_319799 | Ga0466699_319799_1232_1447 | 71 |
| 17 | 3300042601 | Ga0466707_215128 | Ga0466707_215128_403_618 | 71 |
| 18 | 3300042605 | Ga0466716_393053 | Ga0466716_393053_6178_6393 | 71 |
| 19 | 3300042606 | Ga0466719_019759 | Ga0466719_019759_737_952 | 71 |
| 20 | 3300042606 | Ga0466719_176803 | Ga0466719_176803_789_1004 | 71 |
| 21 | 3300042606 | Ga0466719_223627 | Ga0466719_223627_4847_5062 | 71 |
| 22 | 3300042606 | Ga0466719_411304 | Ga0466719_411304_42_257 | 71 |
| 23 | 3300042612 | Ga0466705_023623 | Ga0466705_023623_4442_4657 | 71 |
| 24 | 3300042614 | Ga0466712_138499 | Ga0466712_138499_265_480 | 71 |
| 25 | 3300042615 | Ga0466711_005006 | Ga0466711_005006_564_779 | 71 |
| 26 | 3300042616 | Ga0466715_108335 | Ga0466715_108335_121_336 | 71 |
| 27 | 3300042616 | Ga0466715_338738 | Ga0466715_338738_63_278 | 71 |
| 28 | 3300042616 | Ga0466715_362118 | Ga0466715_362118_488_703 | 71 |
| 29 | 3300042616 | Ga0466715_369095 | Ga0466715_369095_3998_4213 | 71 |
| 30 | 3300042618 | Ga0466723_195578 | Ga0466723_195578_14392_14607 | 71 |
| 31 | 3300042622 | Ga0466731_100517 | Ga0466731_100517_691_906 | 71 |
| 32 | 3300042624 | Ga0466735_062655 | Ga0466735_062655_776_991 | 71 |
| 33 | 3300042643 | Ga0466704_214222 | Ga0466704_214222_9668_9883 | 71 |
| 34 | 3300042648 | Ga0466709_309524 | Ga0466709_309524_2775_2990 | 71 |
| 35 | 3300042652 | Ga0466708_115426 | Ga0466708_115426_1018_1233 | 71 |
| 36 | 3300010167 | Ga0123353_12835985 | Ga0123353_128359852 | 72 |
| 37 | 3300042598 | Ga0466701_078389 | Ga0466701_078389_716_934 | 72 |
| 38 | 3300042606 | Ga0466719_351165 | Ga0466719_351165_10615_10833 | 72 |
| 39 | 3300042616 | Ga0466715_086384 | Ga0466715_086384_2042_2260 | 72 |
| 40 | 3300042616 | Ga0466715_222811 | Ga0466715_222811_12443_12661 | 72 |
| 41 | 3300042618 | Ga0466723_240188 | Ga0466723_240188_1963_2181 | 72 |
| 42 | 3300042619 | Ga0466726_314555 | Ga0466726_314555_983_1201 | 72 |
| 43 | 3300042643 | Ga0466704_304489 | Ga0466704_304489_1500_1718 | 72 |
| 44 | 3300042656 | Ga0466732_071870 | Ga0466732_071870_162_380 | 72 |
| 45 | 3300042656 | Ga0466732_172207 | Ga0466732_172207_440_658 | 72 |
| 46 | 3300010167 | Ga0123353_10367682 | Ga0123353_103676825 | 73 |
| 47 | 3300010882 | Ga0123354_10305866 | Ga0123354_103058665 | 73 |
| 48 | 3300021232 | Ga0223676_1012190 | Ga0223676_10121902 | 73 |
| 49 | 3300022815 | Ga0255786_1004416 | Ga0255786_10044162 | 73 |
| 50 | 3300042599 | Ga0466706_042072 | Ga0466706_042072_299_520 | 73 |
| 51 | 3300042602 | Ga0466713_128250 | Ga0466713_128250_540_761 | 73 |
| 52 | 3300002834 | JGI24696J40584_12909912 | JGI24696J40584_129099123 | 74 |
| 53 | 3300005200 | Ga0072940_1027100 | Ga0072940_10271005 | 74 |
| 54 | 3300010049 | Ga0123356_10794247 | Ga0123356_107942473 | 74 |
| 55 | 3300010049 | Ga0123356_11251934 | Ga0123356_112519342 | 74 |
| 56 | 3300042598 | Ga0466701_062392 | Ga0466701_062392_801_1025 | 74 |
| 57 | 3300042624 | Ga0466735_214009 | Ga0466735_214009_1055_1279 | 74 |
| 58 | 3300010167 | Ga0123353_10044741 | Ga0123353_100447415 | 75 |
| 59 | 3300010167 | Ga0123353_10959353 | Ga0123353_109593533 | 75 |
| 60 | 3300010167 | Ga0123353_11661429 | Ga0123353_116614292 | 75 |
| 61 | 3300010167 | Ga0123353_12347606 | Ga0123353_123476062 | 75 |
| 62 | 3300042590 | Ga0466690_157401 | Ga0466690_157401_10241_10468 | 75 |
| 63 | 3300042593 | Ga0466691_015001 | Ga0466691_015001_8487_8714 | 75 |
| 64 | 3300042596 | Ga0466696_182607 | Ga0466696_182607_665_892 | 75 |
| 65 | 3300042596 | Ga0466696_283737 | Ga0466696_283737_665_892 | 75 |
| 66 | 3300042598 | Ga0466701_073103 | Ga0466701_073103_1027_1254 | 75 |
| 67 | 3300042605 | Ga0466716_437922 | Ga0466716_437922_10078_10305 | 75 |
| 68 | 3300042618 | Ga0466723_074053 | Ga0466723_074053_24799_25026 | 75 |
| 69 | 3300042618 | Ga0466723_212610 | Ga0466723_212610_10340_10567 | 75 |
| 70 | 3300042636 | Ga0466703_143105 | Ga0466703_143105_13136_13363 | 75 |
| 71 | 3300042643 | Ga0466704_074659 | Ga0466704_074659_7437_7664 | 75 |
| 72 | 3300042652 | Ga0466708_011474 | Ga0466708_011474_11032_11259 | 75 |
| 73 | iso_pr_bacteria | 2781125666 | 2781344686 | 75 |
| 74 | 3300002462 | JGI24702J35022_10045795 | JGI24702J35022_100457955 | 76 |
| 75 | 3300009784 | Ga0123357_10001013 | Ga0123357_1000101334 | 76 |
| 76 | 3300010049 | Ga0123356_11805498 | Ga0123356_118054982 | 76 |
| 77 | 3300010049 | Ga0123356_13879837 | Ga0123356_138798372 | 76 |
| 78 | 3300010167 | Ga0123353_10282626 | Ga0123353_102826266 | 76 |
| 79 | 3300042594 | Ga0466694_223134 | Ga0466694_223134_543_773 | 76 |
| 80 | 3300042615 | Ga0466711_353540 | Ga0466711_353540_277_507 | 76 |
| 81 | 3300042616 | Ga0466715_517604 | Ga0466715_517604_959_1189 | 76 |
| 82 | 3300042620 | Ga0466728_295245 | Ga0466728_295245_1509_1739 | 76 |
| 83 | 3300010049 | Ga0123356_12225061 | Ga0123356_122250612 | 77 |
| 84 | 3300042590 | Ga0466690_424141 | Ga0466690_424141_2411_2644 | 77 |
| 85 | 3300042607 | Ga0466720_144831 | Ga0466720_144831_441_674 | 77 |
| 86 | 3300042616 | Ga0466715_150441 | Ga0466715_150441_15108_15341 | 77 |
| 87 | 3300042618 | Ga0466723_029844 | Ga0466723_029844_1283_1516 | 77 |
| 88 | 3300042619 | Ga0466726_285056 | Ga0466726_285056_950_1183 | 77 |
| 89 | 3300002449 | JGI24698J34947_10010104 | JGI24698J34947_100101049 | 78 |
| 90 | 3300010167 | Ga0123353_12295474 | Ga0123353_122954742 | 78 |
| 91 | 3300042594 | Ga0466694_163660 | Ga0466694_163660_1284_1520 | 78 |
| 92 | 3300042610 | Ga0466698_052560 | Ga0466698_052560_871_1107 | 78 |
| 93 | 3300042614 | Ga0466712_035190 | Ga0466712_035190_1131_1367 | 78 |
| 94 | 3300042636 | Ga0466703_044908 | Ga0466703_044908_7878_8114 | 78 |
| 95 | 3300042636 | Ga0466703_104430 | Ga0466703_104430_9260_9496 | 78 |
| 96 | 3300042636 | Ga0466703_422882 | Ga0466703_422882_3098_3334 | 78 |
| 97 | 3300042643 | Ga0466704_258052 | Ga0466704_258052_5096_5332 | 78 |
| 98 | iso_pr_bacteria | 2781125630 | 2781266901 | 78 |
| 99 | 3300002449 | JGI24698J34947_10062454 | JGI24698J34947_100624542 | 79 |
| 100 | 3300002504 | JGI24705J35276_11942982 | JGI24705J35276_119429822 | 79 |
| 101 | 3300010167 | Ga0123353_10568456 | Ga0123353_105684563 | 79 |
| 102 | 3300010167 | Ga0123353_12761740 | Ga0123353_127617401 | 79 |
| 103 | 3300024493 | Ga0264413_112829 | Ga0264413_1128292 | 79 |
| 104 | 3300042597 | Ga0466699_397710 | Ga0466699_397710_53_292 | 79 |
| 105 | 3300042604 | Ga0466717_233059 | Ga0466717_233059_494_733 | 79 |
| 106 | 3300042617 | Ga0466718_150982 | Ga0466718_150982_98_337 | 79 |
| 107 | 3300002449 | JGI24698J34947_10152552 | JGI24698J34947_101525523 | 80 |
| 108 | 3300010167 | Ga0123353_10003570 | Ga0123353_1000357023 | 80 |
| 109 | 3300010167 | Ga0123353_10146935 | Ga0123353_101469359 | 80 |
| 110 | 3300010167 | Ga0123353_10297530 | Ga0123353_102975305 | 81 |
| 111 | 3300010882 | Ga0123354_10543091 | Ga0123354_105430912 | 81 |
| 112 | 3300002449 | JGI24698J34947_10008346 | JGI24698J34947_100083465 | 83 |
| 113 | 3300002449 | JGI24698J34947_10277776 | JGI24698J34947_102777762 | 83 |
| 114 | 3300042604 | Ga0466717_261217 | Ga0466717_261217_486_737 | 83 |
| 115 | 3300042614 | Ga0466712_007206 | Ga0466712_007206_1856_2107 | 83 |
| 116 | 3300042652 | Ga0466708_056187 | Ga0466708_056187_200_451 | 83 |
| 117 | 3300002449 | JGI24698J34947_10009359 | JGI24698J34947_1000935911 | 84 |
| 118 | 3300010049 | Ga0123356_10694955 | Ga0123356_106949553 | 84 |
| 119 | 3300010167 | Ga0123353_10347133 | Ga0123353_103471332 | 84 |
| 120 | 3300042614 | Ga0466712_048668 | Ga0466712_048668_515_778 | 87 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00831 | Ribosomal_L29 | Ribosomal L29 protein | 5 | 57 | 0.96 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7n2u-assembly1.cif.gz_Lc | Elongating 70S ribosome complex in a hybrid-H1 pre-translocation (PRE-H1) conformation | 0.992 | 8 | 60 |
| 6vwn-assembly1.cif.gz_W | 70S ribosome bound to HIV frameshifting stem-loop (FSS) and P-site tRNA (non-rotated conformation, Structure II) | 0.99 | 8 | 59 |
| 8cgk-assembly1.cif.gz_x | Lincomycin and Avilamycin bound to the 50S subunit | 0.99 | 8 | 59 |
| 8b0x-assembly1.cif.gz_x | Translating 70S ribosome in the unrotated state (P and E, tRNAs) | 0.988 | 7 | 60 |
| 7n1p-assembly1.cif.gz_Lc | Elongating 70S ribosome complex in a classical pre-translocation (PRE-C) conformation | 0.988 | 8 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wfaV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9571 | 6 | 63 | 1.10.287.310 |
| 4wf9V00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9466 | 4 | 64 | 1.10.287.310 |
| 1k73W00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9401 | 7 | 60 | 1.10.287.310 |
| 1kd1W00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.94 | 7 | 60 | 1.10.287.310 |
| 1q7yW00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9378 | 7 | 60 | 1.10.287.310 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V2V8L5-F1-model_v4 | Uncharacterized/unreviewed | 0.996 | 7 | 64 | |
| AF-A0A1F8XH94-F1-model_v4 | Uncharacterized/unreviewed | 0.9952 | 7 | 64 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.68 | 0.8 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.