Protein Family IF07326

Metagenome Metatranscriptome Isolate
127 Members
35 Samples
125 Scaffolds
62.63 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_001869|Ga0466712_001869_905_1126
Length
73 aa
Sequence
MKAYTHEMDYSDLNVDQIVKEVYAAKAEGRTRPATKQEIMRIRLAALSAIVRNMQDIVEKYHELVSACHAESV

📊 Sample Types

Isolate 1.6%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 64.7%
Kalotermitidae 26.5%
Unclassified 5.9%
Rhinotermitidae 2.9%

🌳 Taxonomy

Archaea 2
Bacteria 71
Eukaryota 0
Viruses 0
Unclassified 54

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
13 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
14 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466719_415399 3300042606 Bacteria 2247
2 JGI24698J34947_10080960 3300002449 Unclassified 1524
3 JGI24698J34947_10086636 3300002449 Unclassified 1450
4 JGI24698J34947_10144096 3300002449 Unclassified 999
5 JGI24698J34947_10159804 3300002449 Unclassified 924
6 JGI24698J34947_10297929 3300002449 Unclassified 582
7 JGI24699J35502_10347964 3300002509 Unclassified 539
8 Ga0072941_1007097 3300005201 Bacteria 2086
9 Ga0466712_033822 3300042614 Bacteria 5628
10 Ga0466712_086587 3300042614 Bacteria 6046
11 Ga0466712_162462 3300042614 Unclassified 4300
12 Ga0123353_11393287 3300010167 Unclassified 902
13 Ga0466708_064893 3300042652 Unclassified 1171
14 Ga0466719_146821 3300042606 Bacteria 1894
15 AustNasuHG_c1007439 3300000089 Bacteria 3902
16 JGI24698J34947_10041259 3300002449 Unclassified 2378
17 JGI24698J34947_10113678 3300002449 Unclassified 1189
18 JGI24698J34947_10265517 3300002449 Unclassified 634
19 JGI24702J35022_10019276 3300002462 Unclassified 3710
20 JGI24699J35502_10368566 3300002509 Unclassified 548
21 Ga0072941_1028553 3300005201 Bacteria 10817
22 Ga0466712_023524 3300042614 Bacteria 21459
23 Ga0466712_121328 3300042614 Unclassified 1682
24 Ga0466690_130808 3300042590 Bacteria 4934
25 Ga0466696_106425 3300042596 Bacteria 2020
26 Ga0123356_10119150 3300010049 Bacteria 2564
27 Ga0123356_13073600 3300010049 Archaea 582
28 Ga0123356_13316259 3300010049 Bacteria 560
29 Ga0123353_10745900 3300010167 Bacteria 1364
30 Ga0466731_110035 3300042622 Unclassified 1131
31 Ga0466709_396183 3300042648 Unclassified 1257
32 Ga0466701_023322 3300042598 Bacteria 1759
33 Ga0466717_182322 3300042604 Bacteria 5255
34 Ga0466716_131956 3300042605 Bacteria 7791
35 Ga0466721_060938 3300042608 Unclassified 2059
36 Ga0466698_030644 3300042610 Bacteria 1053
37 JGI24698J34947_10017846 3300002449 Unclassified 3842
38 JGI24698J34947_10039168 3300002449 Unclassified 2455
39 JGI24698J34947_10160082 3300002449 Unclassified 923
40 JGI24698J34947_10185037 3300002449 Unclassified 829
41 Ga0072940_1205206 3300005200 Bacteria 566
42 Ga0466712_001869 3300042614 Bacteria 11744
43 Ga0466712_130102 3300042614 Bacteria 14039
44 Ga0466718_161021 3300042617 Unclassified 1980
45 Ga0466690_125395 3300042590 Bacteria 2818
46 Ga0466699_152290 3300042597 Unclassified 1322
47 Ga0123356_10624395 3300010049 Unclassified 1243
48 Ga0123353_10737865 3300010167 Bacteria 1373
49 Ga0123353_10813823 3300010167 Unclassified 1287
50 Ga0123353_11697740 3300010167 Bacteria 791
51 Ga0123353_12803794 3300010167 Unclassified 571
52 Ga0123354_10390634 3300010882 Unclassified 1190
53 Ga0466702_001992 3300042635 Unclassified 1242
54 Ga0466705_173955 3300042612 Bacteria 20540
55 Ga0466733_162991 3300042659 Bacteria 1251
56 Ga0466716_308397 3300042605 Bacteria 2277
57 Ga0466698_256205 3300042610 Unclassified 1073
58 AustNasuHG_c1002105 3300000089 Bacteria 7190
59 AustNasuHG_c1027289 3300000089 Bacteria 1749
60 AustNasuHG_c1036702 3300000089 Bacteria 1266
61 JGI24698J34947_10005994 3300002449 Bacteria 6672
62 JGI24698J34947_10162835 3300002449 Unclassified 912
63 JGI24698J34947_10235146 3300002449 Unclassified 694
64 JGI24699J35502_11128875 3300002509 Unclassified 4531
65 Ga0466712_073211 3300042614 Bacteria 1431
66 Ga0466712_126023 3300042614 Bacteria 10075
67 Ga0466712_177193 3300042614 Unclassified 1409
68 Ga0466690_203995 3300042590 Unclassified 1386
69 Ga0466691_173109 3300042593 Bacteria 2797
70 Ga0466694_409510 3300042594 Bacteria 2286
71 Ga0123353_10796948 3300010167 Bacteria 1305
72 Ga0466731_100425 3300042622 Bacteria 8116
73 Ga0466702_352970 3300042635 Bacteria 2574
74 Ga0466708_035146 3300042652 Bacteria 2971
75 Ga0466708_201523 3300042652 Unclassified 2008
76 Ga0466716_038086 3300042605 Bacteria 8613
77 Ga0466719_136467 3300042606 Bacteria 7757
78 JGI24698J34947_10063448 3300002449 Bacteria 1810
79 JGI24702J35022_10716913 3300002462 Unclassified 622
80 Ga0466712_046964 3300042614 Bacteria 7721
81 Ga0466712_135370 3300042614 Bacteria 1257
82 Ga0466699_099773 3300042597 Bacteria 3510
83 Ga0466699_124245 3300042597 Bacteria 3898
84 Ga0123356_12669929 3300010049 Bacteria 625
85 Ga0466731_015429 3300042622 Bacteria 1907
86 Ga0466722_069451 3300042609 Bacteria 1256
87 Ga0466698_201423 3300042610 Unclassified 1154
88 AustNasuHG_c1062875 3300000089 Unclassified 708
89 AustNasuHG_c1064538 3300000089 Bacteria 690
90 JGI24698J34947_10002227 3300002449 Bacteria 10387
91 JGI24698J34947_10135609 3300002449 Bacteria 1045
92 Ga0466712_025660 3300042614 Bacteria 1463
93 Ga0466712_135379 3300042614 Bacteria 4033
94 Ga0466712_233131 3300042614 Unclassified 1072
95 Ga0466712_237775 3300042614 Unclassified 2113
96 Ga0466715_077900 3300042616 Unclassified 2387
97 Ga0466690_079719 3300042590 Unclassified 2312
98 Ga0123353_10441238 3300010167 Bacteria 1920
99 Ga0466717_057893 3300042604 Unclassified 1128
100 Ga0466716_012336 3300042605 Archaea 1683
101 JGI24698J34947_10031384 3300002449 Unclassified 2797
102 JGI24698J34947_10055226 3300002449 Unclassified 1980
103 JGI24698J34947_10079396 3300002449 Unclassified 1545
104 JGI24698J34947_10143415 3300002449 Bacteria 1003
105 JGI24698J34947_10146947 3300002449 Unclassified 984
106 JGI24702J35022_10013009 3300002462 Bacteria 4614
107 Ga0466712_012216 3300042614 Bacteria 3207
108 Ga0123356_13692006 3300010049 Unclassified 529
109 Ga0123353_11815452 3300010167 Bacteria 757
110 Ga0466716_167997 3300042605 Unclassified 3177
111 JGI24698J34947_10101282 3300002449 Bacteria 1294
112 JGI24698J34947_10355225 3300002449 Unclassified 512
113 JGI24697J35500_11179817 3300002507 Unclassified 1509
114 Ga0072941_1005418 3300005201 Bacteria 38572
115 Ga0466712_068583 3300042614 Bacteria 1343
116 Ga0466712_158877 3300042614 Bacteria 28725
117 Ga0466715_328614 3300042616 Bacteria 6640
118 Ga0233288_1170119 3300022232 Bacteria 726
119 Ga0466696_092175 3300042596 Bacteria 1421
120 Ga0466696_444023 3300042596 Unclassified 1989
121 Ga0466696_460741 3300042596 Bacteria 15140
122 Ga0466699_254809 3300042597 Bacteria 1643
123 Ga0123353_10275937 3300010167 Bacteria 2586
124 Ga0466734_058674 3300042623 Unclassified 1414
125 Ga0466708_185228 3300042652 Bacteria 10032

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002462 JGI24702J35022_10716913 JGI24702J35022_107169132 55
2 3300010049 Ga0123356_12669929 Ga0123356_126699291 59
3 3300042590 Ga0466690_079719 Ga0466690_079719_2114_2296 60
4 3300042590 Ga0466690_125395 Ga0466690_125395_1448_1630 60
5 3300042590 Ga0466690_130808 Ga0466690_130808_4275_4457 60
6 3300042590 Ga0466690_203995 Ga0466690_203995_505_687 60
7 3300042593 Ga0466691_173109 Ga0466691_173109_658_840 60
8 3300042594 Ga0466694_409510 Ga0466694_409510_1793_1975 60
9 3300042596 Ga0466696_092175 Ga0466696_092175_794_976 60
10 3300042596 Ga0466696_106425 Ga0466696_106425_614_796 60
11 3300042596 Ga0466696_444023 Ga0466696_444023_1705_1887 60
12 3300042596 Ga0466696_460741 Ga0466696_460741_7861_8043 60
13 3300042597 Ga0466699_099773 Ga0466699_099773_1434_1616 60
14 3300042597 Ga0466699_152290 Ga0466699_152290_695_877 60
15 3300042604 Ga0466717_057893 Ga0466717_057893_254_436 60
16 3300042604 Ga0466717_182322 Ga0466717_182322_4949_5131 60
17 3300042605 Ga0466716_012336 Ga0466716_012336_603_785 60
18 3300042605 Ga0466716_038086 Ga0466716_038086_3327_3509 60
19 3300042605 Ga0466716_131956 Ga0466716_131956_6165_6347 60
20 3300042605 Ga0466716_167997 Ga0466716_167997_1242_1424 60
21 3300042605 Ga0466716_308397 Ga0466716_308397_580_762 60
22 3300042606 Ga0466719_136467 Ga0466719_136467_5123_5305 60
23 3300042606 Ga0466719_146821 Ga0466719_146821_88_270 60
24 3300042606 Ga0466719_415399 Ga0466719_415399_1594_1776 60
25 3300042608 Ga0466721_060938 Ga0466721_060938_1644_1826 60
26 3300042609 Ga0466722_069451 Ga0466722_069451_543_725 60
27 3300042610 Ga0466698_030644 Ga0466698_030644_829_1011 60
28 3300042610 Ga0466698_201423 Ga0466698_201423_833_1015 60
29 3300042610 Ga0466698_256205 Ga0466698_256205_643_825 60
30 3300042612 Ga0466705_173955 Ga0466705_173955_387_569 60
31 3300042614 Ga0466712_135370 Ga0466712_135370_910_1092 60
32 3300042616 Ga0466715_077900 Ga0466715_077900_489_671 60
33 3300042616 Ga0466715_328614 Ga0466715_328614_304_486 60
34 3300042617 Ga0466718_161021 Ga0466718_161021_1548_1730 60
35 3300042622 Ga0466731_015429 Ga0466731_015429_1329_1511 60
36 3300042622 Ga0466731_110035 Ga0466731_110035_425_607 60
37 3300042623 Ga0466734_058674 Ga0466734_058674_959_1141 60
38 3300042648 Ga0466709_396183 Ga0466709_396183_590_772 60
39 3300042652 Ga0466708_035146 Ga0466708_035146_1720_1902 60
40 3300042652 Ga0466708_064893 Ga0466708_064893_488_670 60
41 3300042652 Ga0466708_185228 Ga0466708_185228_8687_8869 60
42 3300042652 Ga0466708_201523 Ga0466708_201523_930_1112 60
43 3300042659 Ga0466733_162991 Ga0466733_162991_778_960 60
44 iso_pr_bacteria 2781125695 2781439339 60
45 3300000089 AustNasuHG_c1027289 AustNasuHG_10272893 61
46 3300000089 AustNasuHG_c1064538 AustNasuHG_10645382 61
47 3300002449 JGI24698J34947_10031384 JGI24698J34947_100313841 61
48 3300002449 JGI24698J34947_10162835 JGI24698J34947_101628352 61
49 3300002462 JGI24702J35022_10019276 JGI24702J35022_100192766 61
50 3300005200 Ga0072940_1205206 Ga0072940_12052061 61
51 3300010049 Ga0123356_10119150 Ga0123356_101191504 61
52 3300010049 Ga0123356_10624395 Ga0123356_106243953 61
53 3300010049 Ga0123356_13073600 Ga0123356_130736002 61
54 3300010049 Ga0123356_13316259 Ga0123356_133162592 61
55 3300010049 Ga0123356_13692006 Ga0123356_136920061 61
56 3300010167 Ga0123353_10275937 Ga0123353_102759373 61
57 3300010167 Ga0123353_10441238 Ga0123353_104412383 61
58 3300010167 Ga0123353_10737865 Ga0123353_107378652 61
59 3300010167 Ga0123353_10745900 Ga0123353_107459003 61
60 3300010167 Ga0123353_10796948 Ga0123353_107969484 61
61 3300010167 Ga0123353_10813823 Ga0123353_108138232 61
62 3300010167 Ga0123353_11393287 Ga0123353_113932872 61
63 3300010167 Ga0123353_11697740 Ga0123353_116977401 61
64 3300010167 Ga0123353_11815452 Ga0123353_118154522 61
65 3300010167 Ga0123353_12803794 Ga0123353_128037942 61
66 3300010882 Ga0123354_10390634 Ga0123354_103906342 61
67 3300022232 Ga0233288_1170119 Ga0233288_11701192 61
68 3300042614 Ga0466712_073211 Ga0466712_073211_613_801 62
69 3300042614 Ga0466712_135379 Ga0466712_135379_924_1112 62
70 3300042614 Ga0466712_158877 Ga0466712_158877_239_427 62
71 3300042635 Ga0466702_352970 Ga0466702_352970_1089_1277 62
72 iso_pr_bacteria 2781125689 2781426239 62
73 3300000089 AustNasuHG_c1002105 AustNasuHG_10021058 63
74 3300000089 AustNasuHG_c1036702 AustNasuHG_10367021 63
75 3300002449 JGI24698J34947_10039168 JGI24698J34947_100391681 63
76 3300002449 JGI24698J34947_10063448 JGI24698J34947_100634485 63
77 3300002462 JGI24702J35022_10013009 JGI24702J35022_100130093 63
78 3300002507 JGI24697J35500_11179817 JGI24697J35500_111798172 63
79 3300002509 JGI24699J35502_10368566 JGI24699J35502_103685661 63
80 3300005201 Ga0072941_1005418 Ga0072941_100541812 63
81 3300042614 Ga0466712_046964 Ga0466712_046964_255_446 63
82 3300042614 Ga0466712_130102 Ga0466712_130102_10831_11022 63
83 3300002449 JGI24698J34947_10265517 JGI24698J34947_102655171 64
84 3300042597 Ga0466699_124245 Ga0466699_124245_554_748 64
85 3300042598 Ga0466701_023322 Ga0466701_023322_1188_1382 64
86 3300042614 Ga0466712_012216 Ga0466712_012216_345_539 64
87 3300042614 Ga0466712_023524 Ga0466712_023524_20764_20958 64
88 3300042614 Ga0466712_068583 Ga0466712_068583_984_1178 64
89 3300042614 Ga0466712_162462 Ga0466712_162462_3158_3352 64
90 3300042614 Ga0466712_237775 Ga0466712_237775_352_546 64
91 3300000089 AustNasuHG_c1007439 AustNasuHG_10074393 65
92 3300002449 JGI24698J34947_10017846 JGI24698J34947_100178467 65
93 3300002449 JGI24698J34947_10079396 JGI24698J34947_100793961 65
94 3300002449 JGI24698J34947_10080960 JGI24698J34947_100809603 65
95 3300002449 JGI24698J34947_10086636 JGI24698J34947_100866363 65
96 3300002449 JGI24698J34947_10113678 JGI24698J34947_101136782 65
97 3300002449 JGI24698J34947_10135609 JGI24698J34947_101356093 65
98 3300002449 JGI24698J34947_10143415 JGI24698J34947_101434152 65
99 3300002449 JGI24698J34947_10146947 JGI24698J34947_101469471 65
100 3300002449 JGI24698J34947_10160082 JGI24698J34947_101600822 65
101 3300002509 JGI24699J35502_10347964 JGI24699J35502_103479641 65
102 3300002509 JGI24699J35502_11128875 JGI24699J35502_111288754 65
103 3300042597 Ga0466699_254809 Ga0466699_254809_1175_1372 65
104 3300042614 Ga0466712_025660 Ga0466712_025660_40_237 65
105 3300000089 AustNasuHG_c1062875 AustNasuHG_10628752 66
106 3300002449 JGI24698J34947_10144096 JGI24698J34947_101440962 66
107 3300002449 JGI24698J34947_10235146 JGI24698J34947_102351462 66
108 3300002449 JGI24698J34947_10297929 JGI24698J34947_102979292 66
109 3300042614 Ga0466712_177193 Ga0466712_177193_662_862 66
110 3300042622 Ga0466731_100425 Ga0466731_100425_4703_4903 66
111 3300002449 JGI24698J34947_10002227 JGI24698J34947_100022279 67
112 3300002449 JGI24698J34947_10101282 JGI24698J34947_101012822 67
113 3300002449 JGI24698J34947_10185037 JGI24698J34947_101850372 67
114 3300002449 JGI24698J34947_10355225 JGI24698J34947_103552251 67
115 3300042614 Ga0466712_033822 Ga0466712_033822_256_459 67
116 3300042614 Ga0466712_086587 Ga0466712_086587_5301_5504 67
117 3300042614 Ga0466712_126023 Ga0466712_126023_9806_10009 67
118 3300042635 Ga0466702_001992 Ga0466702_001992_440_643 67
119 3300002449 JGI24698J34947_10055226 JGI24698J34947_100552261 68
120 3300042614 Ga0466712_233131 Ga0466712_233131_669_875 68
121 3300002449 JGI24698J34947_10005994 JGI24698J34947_100059945 69
122 3300002449 JGI24698J34947_10041259 JGI24698J34947_100412594 69
123 3300002449 JGI24698J34947_10159804 JGI24698J34947_101598042 69
124 3300005201 Ga0072941_1007097 Ga0072941_10070974 69
125 3300005201 Ga0072941_1028553 Ga0072941_10285532 69
126 3300042614 Ga0466712_121328 Ga0466712_121328_1082_1291 69
127 3300042614 Ga0466712_001869 Ga0466712_001869_905_1126 73

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEndSuperfamily
af_O13693_52_564_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6632 16 40 1.25.40.10
af_A4HVX1_21_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.645 2 35 3.40.50.720
4hr1B00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.5529 16 59 1.20.1270.410
3wb1D01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.541 15 46 1.10.287.470
3wb1A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.5245 15 47 1.10.287.470
IDDescriptionScoreStartEndGO Terms
AF-A0A841MRA9-F1-model_v4 Prevent-host-death protein 0.5876 4 42
AF-A0A812R491-F1-model_v4 Uncharacterized/unreviewed 0.5311 1 39
AF-A0A182H909-F1-model_v4 Uncharacterized/unreviewed 0.4387 1 56

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.48 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.