Protein Family IF07319
Metagenome
Metatranscriptome
Isolate
210
Members
72
Samples
196
Scaffolds
182.76
Avg Length
Representative Sequence
- ID
- 3300042613|Ga0466710_378715|Ga0466710_378715_259_861
- Length
- 200 aa
- Sequence
- MSTKQLNNYTTQQYMSRIGKLPVHLPQGIAVTIGDGNVVTVKGPLGILTQKVDPDITVAVEGGEIKVSRPTDQPRHRSMHGLYRAIINNMVTGVSTGFTIKQELVGVGYRVEAKGQVLEFNLGYSHDIHFLLPEEVKATAEVARKGANPVLTLKSHDKQLLGMVAAKIRSLRKPEPYKGKGIKFVGEQLRRKAGKSASAK
Sample Types
Isolate
6.7%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.1%
Kalotermitidae
20.3%
Unclassified
14.5%
Blattellidae
5.8%
Termopsidae
5.8%
Rhinotermitidae
4.3%
Passalidae
2.9%
Aphrophoridae
1.4%
Nyctiboridae
1.4%
Formicidae
1.4%
Hodotermitidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
201
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 4 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 15 | 2510917001 | Candidatus Sulcia muelleri PSPU | Isolate | Aphrophoridae |
| 16 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 24 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 27 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 28 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 29 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 30 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 36 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 37 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 53 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 54 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 55 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 56 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 57 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 58 | 648028014 | Candidatus Sulcia muelleri CARI | Isolate | Unclassified |
| 59 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 62 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 63 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 64 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 65 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 66 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 67 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 68 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 69 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 70 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 72 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_079037 | 3300042659 | Bacteria | 2512 |
| 2 | Ga0466714_019400 | 3300042603 | Bacteria | 4888 |
| 3 | Ga0466719_109561 | 3300042606 | Bacteria | 6891 |
| 4 | Ga0466719_150438 | 3300042606 | Bacteria | 7577 |
| 5 | Ga0466719_169533 | 3300042606 | Unclassified | 3316 |
| 6 | Ga0466722_163845 | 3300042609 | Bacteria | 26139 |
| 7 | Ga0265387_1000159 | 3300024582 | Bacteria | 12397 |
| 8 | Ga0466690_040168 | 3300042590 | Bacteria | 26767 |
| 9 | Ga0466696_395854 | 3300042596 | Bacteria | 4403 |
| 10 | Ga0466699_115841 | 3300042597 | Bacteria | 8554 |
| 11 | Ga0466705_509566 | 3300042612 | Bacteria | 3623 |
| 12 | Ga0466723_039697 | 3300042618 | Bacteria | 34610 |
| 13 | Ga0466726_097429 | 3300042619 | Bacteria | 22374 |
| 14 | Ga0466726_370771 | 3300042619 | Bacteria | 16090 |
| 15 | Ga0466728_096371 | 3300042620 | Bacteria | 11852 |
| 16 | IMNBL1DRAFT_c0008380 | 3300000062 | Bacteria | 5269 |
| 17 | JGI24702J35022_10021145 | 3300002462 | Bacteria | 3529 |
| 18 | JGI24702J35022_10058125 | 3300002462 | Bacteria | 2065 |
| 19 | Ga0466731_222053 | 3300042622 | Bacteria | 2254 |
| 20 | Ga0466735_017858 | 3300042624 | Bacteria | 100811 |
| 21 | Ga0466708_029631 | 3300042652 | Bacteria | 12490 |
| 22 | Ga0466708_107903 | 3300042652 | Bacteria | 16519 |
| 23 | Ga0466727_316709 | 3300042655 | Bacteria | 34486 |
| 24 | Ga0466733_153346 | 3300042659 | Bacteria | 4525 |
| 25 | Ga0123353_10003138 | 3300010167 | Bacteria | 20743 |
| 26 | Ga0466706_103986 | 3300042599 | Bacteria | 16586 |
| 27 | Ga0466714_050411 | 3300042603 | Bacteria | 1191 |
| 28 | Ga0466716_046815 | 3300042605 | Bacteria | 19887 |
| 29 | Ga0466716_089342 | 3300042605 | Bacteria | 8560 |
| 30 | Ga0255809_1083861 | 3300022820 | Bacteria | 1594 |
| 31 | Ga0264413_125592 | 3300024493 | Bacteria | 15616 |
| 32 | Ga0466657_300573 | 3300042582 | Bacteria | 1324 |
| 33 | Ga0466657_301471 | 3300042582 | Bacteria | 1339 |
| 34 | Ga0466657_360416 | 3300042582 | Bacteria | 25893 |
| 35 | Ga0466690_363776 | 3300042590 | Bacteria | 13253 |
| 36 | Ga0466691_037573 | 3300042593 | Bacteria | 71526 |
| 37 | Ga0466691_127895 | 3300042593 | Bacteria | 14435 |
| 38 | Ga0466711_007105 | 3300042615 | Bacteria | 19648 |
| 39 | Ga0466715_487149 | 3300042616 | Bacteria | 11128 |
| 40 | Ga0466723_157366 | 3300042618 | Bacteria | 8014 |
| 41 | Ga0466726_380146 | 3300042619 | Bacteria | 11744 |
| 42 | Ga0466726_486744 | 3300042619 | Bacteria | 4017 |
| 43 | Ga0466705_069841 | 3300042612 | Bacteria | 12967 |
| 44 | Ga0466735_049114 | 3300042624 | Bacteria | 5314 |
| 45 | Ga0466704_092701 | 3300042643 | Bacteria | 9103 |
| 46 | Ga0466708_053272 | 3300042652 | Bacteria | 23559 |
| 47 | Ga0123354_10082829 | 3300010882 | Bacteria | 4519 |
| 48 | Ga0466706_170575 | 3300042599 | Bacteria | 3179 |
| 49 | Ga0466700_186627 | 3300042600 | Bacteria | 5186 |
| 50 | Ga0466700_373851 | 3300042600 | Bacteria | 1805 |
| 51 | Ga0466707_194386 | 3300042601 | Bacteria | 27039 |
| 52 | Ga0466714_107938 | 3300042603 | Bacteria | 5958 |
| 53 | Ga0466714_158682 | 3300042603 | Bacteria | 1763 |
| 54 | Ga0466714_159746 | 3300042603 | Bacteria | 1629 |
| 55 | Ga0466719_041964 | 3300042606 | Bacteria | 13223 |
| 56 | Ga0466694_399506 | 3300042594 | Bacteria | 2828 |
| 57 | Ga0466696_350760 | 3300042596 | Bacteria | 7322 |
| 58 | Ga0466712_277250 | 3300042614 | Bacteria | 5254 |
| 59 | Ga0466711_169486 | 3300042615 | Bacteria | 18240 |
| 60 | Ga0466715_265570 | 3300042616 | Bacteria | 8841 |
| 61 | Ga0466723_040344 | 3300042618 | Bacteria | 37666 |
| 62 | Ga0466723_063176 | 3300042618 | Bacteria | 8565 |
| 63 | Ga0466723_208308 | 3300042618 | Unclassified | 7309 |
| 64 | Ga0466723_254809 | 3300042618 | Bacteria | 13413 |
| 65 | Ga0466723_299798 | 3300042618 | Bacteria | 46375 |
| 66 | Ga0466726_143303 | 3300042619 | Bacteria | 13387 |
| 67 | Ga0123356_10007090 | 3300010049 | Bacteria | 11233 |
| 68 | Ga0123356_10243454 | 3300010049 | Bacteria | 1871 |
| 69 | Ga0123353_10052579 | 3300010167 | Bacteria | 6505 |
| 70 | Ga0123353_10127496 | 3300010167 | Bacteria | 4087 |
| 71 | Ga0123354_10211652 | 3300010882 | Bacteria | 2093 |
| 72 | Ga0466714_094603 | 3300042603 | Bacteria | 1290 |
| 73 | Ga0466719_487604 | 3300042606 | Bacteria | 1309 |
| 74 | Ga0466698_020165 | 3300042610 | Unclassified | 2331 |
| 75 | Ga0264413_134962 | 3300024493 | Unclassified | 1105 |
| 76 | Ga0466692_064596 | 3300042591 | Bacteria | 24215 |
| 77 | Ga0466692_120097 | 3300042591 | Bacteria | 76506 |
| 78 | Ga0466691_143338 | 3300042593 | Unclassified | 7605 |
| 79 | Ga0466696_236491 | 3300042596 | Bacteria | 25393 |
| 80 | Ga0466723_146229 | 3300042618 | Bacteria | 13585 |
| 81 | Ga0466728_027008 | 3300042620 | Bacteria | 23890 |
| 82 | Ga0466728_353978 | 3300042620 | Bacteria | 2400 |
| 83 | IMNBL1DRAFT_c0000082 | 3300000062 | Bacteria | 85768 |
| 84 | IMNBL1DRAFT_c0009342 | 3300000062 | Bacteria | 4850 |
| 85 | IMNBL1DRAFT_c0028222 | 3300000062 | Bacteria | 2097 |
| 86 | JGI24705J35276_12230458 | 3300002504 | Bacteria | 3635 |
| 87 | JGI24696J40584_12946003 | 3300002834 | Bacteria | 1877 |
| 88 | Ga0072941_1080669 | 3300005201 | Bacteria | 5010 |
| 89 | Ga0072941_1226486 | 3300005201 | Unclassified | 1781 |
| 90 | Ga0466730_095681 | 3300042625 | Bacteria | 1471 |
| 91 | Ga0466730_101459 | 3300042625 | Bacteria | 2359 |
| 92 | Ga0466708_135787 | 3300042652 | Bacteria | 29737 |
| 93 | Ga0466733_010991 | 3300042659 | Bacteria | 23768 |
| 94 | Ga0466733_031543 | 3300042659 | Bacteria | 31583 |
| 95 | Ga0466733_127261 | 3300042659 | Bacteria | 9314 |
| 96 | Ga0466733_150100 | 3300042659 | Bacteria | 4758 |
| 97 | Ga0562377_0116 | 3300056842 | Bacteria | 251456 |
| 98 | Ga0123356_11209994 | 3300010049 | Bacteria | 921 |
| 99 | Ga0466714_000293 | 3300042603 | Bacteria | 1228 |
| 100 | Ga0466714_022514 | 3300042603 | Bacteria | 4689 |
| 101 | Ga0466714_071105 | 3300042603 | Bacteria | 1802 |
| 102 | Ga0466716_483438 | 3300042605 | Bacteria | 16673 |
| 103 | Ga0466721_160541 | 3300042608 | Bacteria | 27628 |
| 104 | Ga0466722_111573 | 3300042609 | Bacteria | 76934 |
| 105 | Ga0466722_261327 | 3300042609 | Bacteria | 19029 |
| 106 | Ga0466690_011065 | 3300042590 | Bacteria | 9665 |
| 107 | Ga0466690_112132 | 3300042590 | Bacteria | 8748 |
| 108 | Ga0466710_378715 | 3300042613 | Bacteria | 1018 |
| 109 | Ga0466711_214140 | 3300042615 | Bacteria | 14422 |
| 110 | Ga0466726_281544 | 3300042619 | Bacteria | 1114 |
| 111 | 2227507944 | 2225789004 | Bacteria | 72999 |
| 112 | IMNBL1DRAFT_c0002479 | 3300000062 | Bacteria | 12828 |
| 113 | JGI24698J34947_10101986 | 3300002449 | Bacteria | 1288 |
| 114 | Ga0068302_10062981 | 3300005071 | Bacteria | 3190 |
| 115 | Ga0072940_1123869 | 3300005200 | Bacteria | 2683 |
| 116 | Ga0103267_1000036 | 3300007190 | Bacteria | 58694 |
| 117 | Ga0466697_180821 | 3300042611 | Bacteria | 5765 |
| 118 | Ga0466697_191671 | 3300042611 | Bacteria | 7258 |
| 119 | Ga0466705_038128 | 3300042612 | Bacteria | 49408 |
| 120 | Ga0466735_114961 | 3300042624 | Bacteria | 12299 |
| 121 | Ga0466704_023769 | 3300042643 | Unclassified | 2221 |
| 122 | Ga0466732_106734 | 3300042656 | Bacteria | 2077 |
| 123 | Ga0466732_257409 | 3300042656 | Bacteria | 6667 |
| 124 | Ga0123353_10000019 | 3300010167 | Bacteria | 185006 |
| 125 | Ga0123353_10037860 | 3300010167 | Bacteria | 7572 |
| 126 | Ga0466706_013322 | 3300042599 | Bacteria | 22899 |
| 127 | Ga0466714_002390 | 3300042603 | Bacteria | 1251 |
| 128 | Ga0466716_484273 | 3300042605 | Bacteria | 1596 |
| 129 | Ga0466690_067989 | 3300042590 | Bacteria | 8676 |
| 130 | Ga0466696_292634 | 3300042596 | Bacteria | 17358 |
| 131 | Ga0466711_141717 | 3300042615 | Bacteria | 15726 |
| 132 | Ga0466715_233748 | 3300042616 | Bacteria | 12000 |
| 133 | Ga0466715_552404 | 3300042616 | Bacteria | 8959 |
| 134 | Ga0466723_356606 | 3300042618 | Bacteria | 2592 |
| 135 | Ga0466728_013154 | 3300042620 | Bacteria | 8447 |
| 136 | Ga0466729_129841 | 3300042621 | Bacteria | 4218 |
| 137 | IMNBL1DRAFT_c0005235 | 3300000062 | Bacteria | 7488 |
| 138 | IMNBL1DRAFT_c0007574 | 3300000062 | Bacteria | 5682 |
| 139 | JGI24705J35276_12238295 | 3300002504 | Bacteria | 18753 |
| 140 | Ga0466703_096430 | 3300042636 | Bacteria | 9512 |
| 141 | Ga0466704_256111 | 3300042643 | Bacteria | 159283 |
| 142 | Ga0466704_601523 | 3300042643 | Bacteria | 55044 |
| 143 | Ga0466709_060190 | 3300042648 | Bacteria | 23292 |
| 144 | Ga0466709_207118 | 3300042648 | Bacteria | 10221 |
| 145 | Ga0466727_069506 | 3300042655 | Bacteria | 9138 |
| 146 | Ga0466727_126885 | 3300042655 | Bacteria | 7151 |
| 147 | Ga0123356_10154027 | 3300010049 | Bacteria | 2286 |
| 148 | Ga0123353_10273588 | 3300010167 | Bacteria | 2600 |
| 149 | Ga0123353_10526129 | 3300010167 | Bacteria | 1714 |
| 150 | Ga0466713_052692 | 3300042602 | Bacteria | 2330 |
| 151 | Ga0466714_001106 | 3300042603 | Bacteria | 7202 |
| 152 | Ga0466719_218070 | 3300042606 | Bacteria | 19356 |
| 153 | Ga0466722_218874 | 3300042609 | Bacteria | 3722 |
| 154 | Ga0255786_1022022 | 3300022815 | Unclassified | 1046 |
| 155 | Ga0415639_065160 | 3300038395 | Bacteria | 2418 |
| 156 | Ga0415639_256415 | 3300038395 | Bacteria | 1482 |
| 157 | Ga0466690_170288 | 3300042590 | Bacteria | 25098 |
| 158 | Ga0466691_104846 | 3300042593 | Bacteria | 12759 |
| 159 | Ga0466691_212932 | 3300042593 | Unclassified | 9639 |
| 160 | Ga0466696_396970 | 3300042596 | Bacteria | 18436 |
| 161 | Ga0466699_027650 | 3300042597 | Bacteria | 2311 |
| 162 | Ga0466705_476907 | 3300042612 | Bacteria | 6382 |
| 163 | Ga0466715_275548 | 3300042616 | Bacteria | 29682 |
| 164 | Ga0466726_360735 | 3300042619 | Bacteria | 24168 |
| 165 | JGI24699J35502_10791827 | 3300002509 | Bacteria | 868 |
| 166 | Ga0466697_154536 | 3300042611 | Bacteria | 6155 |
| 167 | Ga0466705_336554 | 3300042612 | Bacteria | 16075 |
| 168 | Ga0466729_298575 | 3300042621 | Bacteria | 3611 |
| 169 | Ga0466703_039404 | 3300042636 | Bacteria | 7439 |
| 170 | Ga0466704_200902 | 3300042643 | Bacteria | 34955 |
| 171 | Ga0466709_358705 | 3300042648 | Bacteria | 4194 |
| 172 | Ga0466733_003819 | 3300042659 | Bacteria | 23682 |
| 173 | Ga0123356_10070298 | 3300010049 | Bacteria | 3283 |
| 174 | Ga0123356_10102750 | 3300010049 | Bacteria | 2744 |
| 175 | Ga0123353_10347939 | 3300010167 | Bacteria | 2235 |
| 176 | Ga0123353_10426749 | 3300010167 | Bacteria | 1962 |
| 177 | Ga0466714_021817 | 3300042603 | Bacteria | 7986 |
| 178 | Ga0466714_072376 | 3300042603 | Bacteria | 3377 |
| 179 | Ga0466714_120657 | 3300042603 | Bacteria | 2055 |
| 180 | Ga0466714_131305 | 3300042603 | Bacteria | 5157 |
| 181 | Ga0466722_033585 | 3300042609 | Bacteria | 11227 |
| 182 | Ga0466656_094469 | 3300042550 | Bacteria | 1625 |
| 183 | Ga0466690_084322 | 3300042590 | Bacteria | 6679 |
| 184 | Ga0466690_386221 | 3300042590 | Bacteria | 3339 |
| 185 | Ga0466711_248472 | 3300042615 | Bacteria | 12038 |
| 186 | Ga0466726_332711 | 3300042619 | Bacteria | 2659 |
| 187 | Ga0466729_037781 | 3300042621 | Bacteria | 19751 |
| 188 | 2227591268 | 2225789004 | Bacteria | 50477 |
| 189 | JGI24698J34947_10003141 | 3300002449 | Bacteria | 8946 |
| 190 | JGI24702J35022_10000164 | 3300002462 | Bacteria | 34496 |
| 191 | Ga0072940_1338740 | 3300005200 | Bacteria | 2322 |
| 192 | Ga0466703_008003 | 3300042636 | Bacteria | 11175 |
| 193 | Ga0466703_325817 | 3300042636 | Bacteria | 5487 |
| 194 | Ga0466708_013019 | 3300042652 | Bacteria | 32676 |
| 195 | Ga0466708_295458 | 3300042652 | Bacteria | 8896 |
| 196 | Ga0466727_212656 | 3300042655 | Bacteria | 11289 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042609 | Ga0466722_218874 | Ga0466722_218874_3226_3708 | 160 |
| 2 | 3300042601 | Ga0466707_194386 | Ga0466707_194386_11235_11813 | 162 |
| 3 | 3300022815 | Ga0255786_1022022 | Ga0255786_10220222 | 163 |
| 4 | 3300042606 | Ga0466719_218070 | Ga0466719_218070_11218_11775 | 164 |
| 5 | 3300042615 | Ga0466711_007105 | Ga0466711_007105_7677_8234 | 165 |
| 6 | 3300042616 | Ga0466715_275548 | Ga0466715_275548_12555_13112 | 165 |
| 7 | 3300042620 | Ga0466728_353978 | Ga0466728_353978_1665_2222 | 165 |
| 8 | 3300042656 | Ga0466732_257409 | Ga0466732_257409_4909_5466 | 165 |
| 9 | 3300042590 | Ga0466690_170288 | Ga0466690_170288_2633_3190 | 166 |
| 10 | 3300042619 | Ga0466726_097429 | Ga0466726_097429_10750_11307 | 166 |
| 11 | 3300042643 | Ga0466704_256111 | Ga0466704_256111_133020_133580 | 166 |
| 12 | 3300042655 | Ga0466727_212656 | Ga0466727_212656_9425_9982 | 166 |
| 13 | 3300024493 | Ga0264413_134962 | Ga0264413_1349622 | 167 |
| 14 | 3300042596 | Ga0466696_236491 | Ga0466696_236491_9294_9851 | 167 |
| 15 | 3300042618 | Ga0466723_040344 | Ga0466723_040344_1948_2505 | 167 |
| 16 | 3300042624 | Ga0466735_017858 | Ga0466735_017858_7424_7969 | 167 |
| 17 | 3300042636 | Ga0466703_325817 | Ga0466703_325817_3596_4153 | 167 |
| 18 | 3300002509 | JGI24699J35502_10791827 | JGI24699J35502_107918271 | 168 |
| 19 | 3300042600 | Ga0466700_186627 | Ga0466700_186627_1471_1977 | 168 |
| 20 | 3300042625 | Ga0466730_101459 | Ga0466730_101459_1827_2333 | 168 |
| 21 | 3300042599 | Ga0466706_013322 | Ga0466706_013322_13644_14201 | 169 |
| 22 | 3300022820 | Ga0255809_1083861 | Ga0255809_10838613 | 170 |
| 23 | 3300042659 | Ga0466733_010991 | Ga0466733_010991_12725_13285 | 170 |
| 24 | 3300042603 | Ga0466714_001106 | Ga0466714_001106_4860_5420 | 171 |
| 25 | 3300042624 | Ga0466735_049114 | Ga0466735_049114_1010_1537 | 175 |
| 26 | 3300010167 | Ga0123353_10347939 | Ga0123353_103479392 | 177 |
| 27 | 3300042593 | Ga0466691_143338 | Ga0466691_143338_969_1529 | 177 |
| 28 | 3300042606 | Ga0466719_169533 | Ga0466719_169533_305_865 | 177 |
| 29 | 3300042612 | Ga0466705_476907 | Ga0466705_476907_2989_3549 | 177 |
| 30 | 3300042616 | Ga0466715_233748 | Ga0466715_233748_10978_11538 | 177 |
| 31 | 3300042618 | Ga0466723_146229 | Ga0466723_146229_3491_4051 | 177 |
| 32 | 3300042643 | Ga0466704_023769 | Ga0466704_023769_661_1221 | 177 |
| 33 | 3300042648 | Ga0466709_358705 | Ga0466709_358705_3156_3716 | 177 |
| 34 | 3300056842 | Ga0562377_0116 | Ga0562377_0116_123606_124139 | 177 |
| 35 | iso_pr_bacteria | 646311952 | 646431025 | 177 |
| 36 | 3300024582 | Ga0265387_1000159 | Ga0265387_100015910 | 179 |
| 37 | 3300042605 | Ga0466716_483438 | Ga0466716_483438_8762_9319 | 179 |
| 38 | 3300042648 | Ga0466709_060190 | Ga0466709_060190_15119_15676 | 179 |
| 39 | 3300042652 | Ga0466708_135787 | Ga0466708_135787_17383_17940 | 179 |
| 40 | 3300042659 | Ga0466733_127261 | Ga0466733_127261_2027_2566 | 179 |
| 41 | 3300042590 | Ga0466690_386221 | Ga0466690_386221_2149_2709 | 180 |
| 42 | 3300042611 | Ga0466697_154536 | Ga0466697_154536_1097_1639 | 180 |
| 43 | 3300042616 | Ga0466715_487149 | Ga0466715_487149_7192_7752 | 180 |
| 44 | 3300024493 | Ga0264413_125592 | Ga0264413_12559213 | 181 |
| 45 | 3300042619 | Ga0466726_143303 | Ga0466726_143303_5449_5994 | 181 |
| 46 | iso_pr_bacteria | 3001995318 | 3001995710 | 181 |
| 47 | iso_pr_bacteria | 3002002726 | 3002003124 | 181 |
| 48 | iso_pr_bacteria | 3002033046 | 3002033433 | 181 |
| 49 | iso_pr_bacteria | 650716011 | 650720020 | 181 |
| 50 | 3300005200 | Ga0072940_1123869 | Ga0072940_11238696 | 182 |
| 51 | iso_pr_bacteria | 2510917001 | 2510921637 | 182 |
| 52 | iso_pr_bacteria | 648028014 | 648180295 | 182 |
| 53 | iso_pr_bacteria | 3002007740 | 3002008123 | 183 |
| 54 | 3300038395 | Ga0415639_256415 | Ga0415639_256415_564_1118 | 184 |
| 55 | 3300042550 | Ga0466656_094469 | Ga0466656_094469_955_1509 | 184 |
| 56 | 3300042582 | Ga0466657_300573 | Ga0466657_300573_580_1134 | 184 |
| 57 | 3300042582 | Ga0466657_301471 | Ga0466657_301471_68_622 | 184 |
| 58 | 3300042599 | Ga0466706_103986 | Ga0466706_103986_6881_7435 | 184 |
| 59 | 3300042599 | Ga0466706_170575 | Ga0466706_170575_1600_2154 | 184 |
| 60 | 3300042603 | Ga0466714_002390 | Ga0466714_002390_125_679 | 184 |
| 61 | 3300042603 | Ga0466714_019400 | Ga0466714_019400_3837_4391 | 184 |
| 62 | 3300042603 | Ga0466714_021817 | Ga0466714_021817_5222_5776 | 184 |
| 63 | 3300042603 | Ga0466714_022514 | Ga0466714_022514_2873_3427 | 184 |
| 64 | 3300042603 | Ga0466714_050411 | Ga0466714_050411_402_956 | 184 |
| 65 | 3300042603 | Ga0466714_071105 | Ga0466714_071105_645_1199 | 184 |
| 66 | 3300042603 | Ga0466714_120657 | Ga0466714_120657_1055_1609 | 184 |
| 67 | 3300042603 | Ga0466714_159746 | Ga0466714_159746_757_1311 | 184 |
| 68 | 3300042611 | Ga0466697_180821 | Ga0466697_180821_64_618 | 184 |
| 69 | 3300042622 | Ga0466731_222053 | Ga0466731_222053_384_938 | 184 |
| 70 | 3300042659 | Ga0466733_003819 | Ga0466733_003819_12022_12576 | 184 |
| 71 | 3300042659 | Ga0466733_031543 | Ga0466733_031543_16843_17397 | 184 |
| 72 | 3300042659 | Ga0466733_079037 | Ga0466733_079037_669_1223 | 184 |
| 73 | 3300002504 | JGI24705J35276_12230458 | JGI24705J35276_122304587 | 185 |
| 74 | 3300002834 | JGI24696J40584_12946003 | JGI24696J40584_129460033 | 185 |
| 75 | 3300010049 | Ga0123356_10070298 | Ga0123356_100702986 | 185 |
| 76 | 3300010049 | Ga0123356_10243454 | Ga0123356_102434543 | 185 |
| 77 | 3300010167 | Ga0123353_10426749 | Ga0123353_104267493 | 185 |
| 78 | 3300042582 | Ga0466657_360416 | Ga0466657_360416_24598_25155 | 185 |
| 79 | 3300042591 | Ga0466692_120097 | Ga0466692_120097_10711_11268 | 185 |
| 80 | 3300042593 | Ga0466691_037573 | Ga0466691_037573_29222_29779 | 185 |
| 81 | 3300042603 | Ga0466714_000293 | Ga0466714_000293_37_594 | 185 |
| 82 | 3300042603 | Ga0466714_072376 | Ga0466714_072376_809_1366 | 185 |
| 83 | 3300042603 | Ga0466714_094603 | Ga0466714_094603_426_983 | 185 |
| 84 | 3300042603 | Ga0466714_107938 | Ga0466714_107938_2013_2570 | 185 |
| 85 | 3300042603 | Ga0466714_158682 | Ga0466714_158682_457_1014 | 185 |
| 86 | 3300042612 | Ga0466705_038128 | Ga0466705_038128_22743_23300 | 185 |
| 87 | 3300042621 | Ga0466729_298575 | Ga0466729_298575_1924_2481 | 185 |
| 88 | 3300042643 | Ga0466704_601523 | Ga0466704_601523_23813_24370 | 185 |
| 89 | 3300042659 | Ga0466733_150100 | Ga0466733_150100_3305_3862 | 185 |
| 90 | 3300042659 | Ga0466733_153346 | Ga0466733_153346_176_733 | 185 |
| 91 | iso_pr_bacteria | 2820768849 | 2820769696 | 185 |
| 92 | iso_pr_bacteria | 2820774381 | 2820774675 | 185 |
| 93 | 2225789004 | 2227507944 | 2227997716 | 186 |
| 94 | 2225789004 | 2227591268 | 2228149934 | 186 |
| 95 | 3300000062 | IMNBL1DRAFT_c0002479 | IMNBL1DRAFT_000247915 | 186 |
| 96 | 3300000062 | IMNBL1DRAFT_c0028222 | IMNBL1DRAFT_00282222 | 186 |
| 97 | 3300005200 | Ga0072940_1338740 | Ga0072940_13387402 | 186 |
| 98 | 3300007190 | Ga0103267_1000036 | Ga0103267_100003639 | 186 |
| 99 | 3300010167 | Ga0123353_10000019 | Ga0123353_1000001979 | 186 |
| 100 | 3300010167 | Ga0123353_10003138 | Ga0123353_1000313816 | 186 |
| 101 | 3300010167 | Ga0123353_10273588 | Ga0123353_102735883 | 186 |
| 102 | 3300010882 | Ga0123354_10082829 | Ga0123354_1008282910 | 186 |
| 103 | 3300010882 | Ga0123354_10211652 | Ga0123354_102116523 | 186 |
| 104 | 3300038395 | Ga0415639_065160 | Ga0415639_065160_1215_1775 | 186 |
| 105 | 3300042590 | Ga0466690_011065 | Ga0466690_011065_5316_5876 | 186 |
| 106 | 3300042590 | Ga0466690_040168 | Ga0466690_040168_23289_23849 | 186 |
| 107 | 3300042590 | Ga0466690_067989 | Ga0466690_067989_3780_4340 | 186 |
| 108 | 3300042590 | Ga0466690_084322 | Ga0466690_084322_2683_3243 | 186 |
| 109 | 3300042590 | Ga0466690_112132 | Ga0466690_112132_4388_4948 | 186 |
| 110 | 3300042590 | Ga0466690_363776 | Ga0466690_363776_7900_8460 | 186 |
| 111 | 3300042591 | Ga0466692_064596 | Ga0466692_064596_10285_10845 | 186 |
| 112 | 3300042593 | Ga0466691_104846 | Ga0466691_104846_8255_8815 | 186 |
| 113 | 3300042593 | Ga0466691_127895 | Ga0466691_127895_9136_9696 | 186 |
| 114 | 3300042593 | Ga0466691_212932 | Ga0466691_212932_3883_4443 | 186 |
| 115 | 3300042594 | Ga0466694_399506 | Ga0466694_399506_1213_1773 | 186 |
| 116 | 3300042596 | Ga0466696_292634 | Ga0466696_292634_7873_8433 | 186 |
| 117 | 3300042596 | Ga0466696_350760 | Ga0466696_350760_1934_2494 | 186 |
| 118 | 3300042596 | Ga0466696_395854 | Ga0466696_395854_3286_3846 | 186 |
| 119 | 3300042596 | Ga0466696_396970 | Ga0466696_396970_6841_7401 | 186 |
| 120 | 3300042597 | Ga0466699_027650 | Ga0466699_027650_1174_1734 | 186 |
| 121 | 3300042597 | Ga0466699_115841 | Ga0466699_115841_717_1277 | 186 |
| 122 | 3300042600 | Ga0466700_373851 | Ga0466700_373851_803_1363 | 186 |
| 123 | 3300042602 | Ga0466713_052692 | Ga0466713_052692_1147_1707 | 186 |
| 124 | 3300042605 | Ga0466716_046815 | Ga0466716_046815_10141_10701 | 186 |
| 125 | 3300042605 | Ga0466716_089342 | Ga0466716_089342_4181_4741 | 186 |
| 126 | 3300042605 | Ga0466716_484273 | Ga0466716_484273_748_1308 | 186 |
| 127 | 3300042606 | Ga0466719_041964 | Ga0466719_041964_9197_9757 | 186 |
| 128 | 3300042606 | Ga0466719_109561 | Ga0466719_109561_138_698 | 186 |
| 129 | 3300042606 | Ga0466719_150438 | Ga0466719_150438_3561_4121 | 186 |
| 130 | 3300042606 | Ga0466719_487604 | Ga0466719_487604_41_601 | 186 |
| 131 | 3300042608 | Ga0466721_160541 | Ga0466721_160541_4656_5216 | 186 |
| 132 | 3300042609 | Ga0466722_033585 | Ga0466722_033585_3648_4208 | 186 |
| 133 | 3300042609 | Ga0466722_111573 | Ga0466722_111573_39145_39705 | 186 |
| 134 | 3300042609 | Ga0466722_163845 | Ga0466722_163845_12575_13135 | 186 |
| 135 | 3300042609 | Ga0466722_261327 | Ga0466722_261327_12032_12592 | 186 |
| 136 | 3300042610 | Ga0466698_020165 | Ga0466698_020165_1746_2306 | 186 |
| 137 | 3300042611 | Ga0466697_191671 | Ga0466697_191671_2204_2764 | 186 |
| 138 | 3300042612 | Ga0466705_069841 | Ga0466705_069841_7668_8228 | 186 |
| 139 | 3300042612 | Ga0466705_336554 | Ga0466705_336554_7291_7851 | 186 |
| 140 | 3300042612 | Ga0466705_509566 | Ga0466705_509566_1477_2037 | 186 |
| 141 | 3300042614 | Ga0466712_277250 | Ga0466712_277250_3014_3574 | 186 |
| 142 | 3300042615 | Ga0466711_141717 | Ga0466711_141717_4828_5388 | 186 |
| 143 | 3300042615 | Ga0466711_169486 | Ga0466711_169486_7343_7903 | 186 |
| 144 | 3300042615 | Ga0466711_214140 | Ga0466711_214140_1118_1678 | 186 |
| 145 | 3300042615 | Ga0466711_248472 | Ga0466711_248472_7332_7892 | 186 |
| 146 | 3300042616 | Ga0466715_265570 | Ga0466715_265570_4766_5326 | 186 |
| 147 | 3300042616 | Ga0466715_552404 | Ga0466715_552404_1404_1964 | 186 |
| 148 | 3300042618 | Ga0466723_039697 | Ga0466723_039697_18460_19020 | 186 |
| 149 | 3300042618 | Ga0466723_063176 | Ga0466723_063176_7677_8237 | 186 |
| 150 | 3300042618 | Ga0466723_157366 | Ga0466723_157366_4225_4785 | 186 |
| 151 | 3300042618 | Ga0466723_208308 | Ga0466723_208308_72_632 | 186 |
| 152 | 3300042618 | Ga0466723_254809 | Ga0466723_254809_2288_2848 | 186 |
| 153 | 3300042618 | Ga0466723_299798 | Ga0466723_299798_14765_15325 | 186 |
| 154 | 3300042618 | Ga0466723_356606 | Ga0466723_356606_784_1344 | 186 |
| 155 | 3300042619 | Ga0466726_281544 | Ga0466726_281544_419_979 | 186 |
| 156 | 3300042619 | Ga0466726_332711 | Ga0466726_332711_1119_1679 | 186 |
| 157 | 3300042619 | Ga0466726_360735 | Ga0466726_360735_16116_16676 | 186 |
| 158 | 3300042619 | Ga0466726_370771 | Ga0466726_370771_9870_10430 | 186 |
| 159 | 3300042619 | Ga0466726_380146 | Ga0466726_380146_10028_10588 | 186 |
| 160 | 3300042619 | Ga0466726_486744 | Ga0466726_486744_857_1417 | 186 |
| 161 | 3300042620 | Ga0466728_013154 | Ga0466728_013154_2240_2800 | 186 |
| 162 | 3300042620 | Ga0466728_027008 | Ga0466728_027008_16201_16761 | 186 |
| 163 | 3300042620 | Ga0466728_096371 | Ga0466728_096371_2253_2813 | 186 |
| 164 | 3300042621 | Ga0466729_037781 | Ga0466729_037781_1413_1973 | 186 |
| 165 | 3300042621 | Ga0466729_129841 | Ga0466729_129841_458_1018 | 186 |
| 166 | 3300042624 | Ga0466735_114961 | Ga0466735_114961_7041_7601 | 186 |
| 167 | 3300042625 | Ga0466730_095681 | Ga0466730_095681_358_918 | 186 |
| 168 | 3300042636 | Ga0466703_008003 | Ga0466703_008003_2103_2663 | 186 |
| 169 | 3300042636 | Ga0466703_039404 | Ga0466703_039404_1775_2335 | 186 |
| 170 | 3300042636 | Ga0466703_096430 | Ga0466703_096430_6259_6819 | 186 |
| 171 | 3300042643 | Ga0466704_092701 | Ga0466704_092701_1243_1803 | 186 |
| 172 | 3300042643 | Ga0466704_200902 | Ga0466704_200902_7788_8348 | 186 |
| 173 | 3300042648 | Ga0466709_207118 | Ga0466709_207118_605_1165 | 186 |
| 174 | 3300042652 | Ga0466708_013019 | Ga0466708_013019_22625_23185 | 186 |
| 175 | 3300042652 | Ga0466708_029631 | Ga0466708_029631_8082_8642 | 186 |
| 176 | 3300042652 | Ga0466708_053272 | Ga0466708_053272_18766_19326 | 186 |
| 177 | 3300042652 | Ga0466708_107903 | Ga0466708_107903_9332_9892 | 186 |
| 178 | 3300042652 | Ga0466708_295458 | Ga0466708_295458_8120_8680 | 186 |
| 179 | 3300042655 | Ga0466727_069506 | Ga0466727_069506_276_836 | 186 |
| 180 | 3300042655 | Ga0466727_126885 | Ga0466727_126885_6118_6678 | 186 |
| 181 | 3300042655 | Ga0466727_316709 | Ga0466727_316709_12613_13173 | 186 |
| 182 | 3300042656 | Ga0466732_106734 | Ga0466732_106734_964_1524 | 186 |
| 183 | iso_pr_bacteria | 2820740053 | 2820741230 | 186 |
| 184 | iso_pr_bacteria | 2820748953 | 2820750184 | 186 |
| 185 | iso_pr_bacteria | 2820767225 | 2820767611 | 186 |
| 186 | iso_pr_bacteria | 2820772500 | 2820772797 | 186 |
| 187 | 3300000062 | IMNBL1DRAFT_c0000082 | IMNBL1DRAFT_000008238 | 187 |
| 188 | 3300000062 | IMNBL1DRAFT_c0005235 | IMNBL1DRAFT_000523512 | 187 |
| 189 | 3300000062 | IMNBL1DRAFT_c0007574 | IMNBL1DRAFT_00075747 | 187 |
| 190 | 3300000062 | IMNBL1DRAFT_c0008380 | IMNBL1DRAFT_00083805 | 187 |
| 191 | 3300000062 | IMNBL1DRAFT_c0009342 | IMNBL1DRAFT_00093425 | 187 |
| 192 | 3300002449 | JGI24698J34947_10003141 | JGI24698J34947_100031419 | 187 |
| 193 | 3300002449 | JGI24698J34947_10101986 | JGI24698J34947_101019862 | 187 |
| 194 | 3300002462 | JGI24702J35022_10000164 | JGI24702J35022_1000016422 | 187 |
| 195 | 3300002462 | JGI24702J35022_10021145 | JGI24702J35022_100211457 | 187 |
| 196 | 3300002462 | JGI24702J35022_10058125 | JGI24702J35022_100581252 | 187 |
| 197 | 3300002504 | JGI24705J35276_12238295 | JGI24705J35276_1223829520 | 187 |
| 198 | 3300005071 | Ga0068302_10062981 | Ga0068302_100629813 | 187 |
| 199 | 3300005201 | Ga0072941_1080669 | Ga0072941_10806697 | 187 |
| 200 | 3300005201 | Ga0072941_1226486 | Ga0072941_12264862 | 187 |
| 201 | 3300010049 | Ga0123356_10007090 | Ga0123356_1000709011 | 187 |
| 202 | 3300010049 | Ga0123356_10102750 | Ga0123356_101027505 | 187 |
| 203 | 3300010049 | Ga0123356_10154027 | Ga0123356_101540272 | 187 |
| 204 | 3300010049 | Ga0123356_11209994 | Ga0123356_112099942 | 187 |
| 205 | 3300010167 | Ga0123353_10037860 | Ga0123353_1003786010 | 187 |
| 206 | 3300010167 | Ga0123353_10052579 | Ga0123353_100525795 | 187 |
| 207 | 3300010167 | Ga0123353_10127496 | Ga0123353_101274966 | 187 |
| 208 | 3300010167 | Ga0123353_10526129 | Ga0123353_105261293 | 187 |
| 209 | 3300042603 | Ga0466714_131305 | Ga0466714_131305_2390_2986 | 198 |
| 210 | 3300042613 | Ga0466710_378715 | Ga0466710_378715_259_861 | 200 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00347 | Ribosomal_L6 | Ribosomal protein L6 | 26 | 97 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.