Protein Family IF07318

Metagenome Isolate
165 Members
67 Samples
142 Scaffolds
186.45 Avg Length

🧬 Representative Sequence

ID
3300042613|Ga0466710_373677|Ga0466710_373677_1012_1668
Length
185 aa
Sequence
LQSKQTIAFISPISAQVTKIFTIFASRISKSKKMDTTTIKKDAEEKMSMTLEFLEETFSRIRAGRANAKILDGVRVDYYGTMSPLSSVATVSVPDAKTIMIQPWMDSDVGITPENNGEVIRLGIPPLTEERRKQLVKQTKQEAEDAKVSIRMGKDLEAELQKIHDKYIKKVDELFALKEKEILTV

📊 Sample Types

Isolate 13.9%
Metagenome 86.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.9%
Blattidae 28.4%
Kalotermitidae 19.4%
Unclassified 10.4%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Passalidae 3.0%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
2 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
3 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
4 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
5 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
6 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
7 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
8 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
9 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
10 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
16 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
25 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
28 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
29 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
30 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
31 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
34 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
40 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
45 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
46 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
53 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
54 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
55 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
56 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
57 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
58 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
59 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
60 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
61 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
62 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
63 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
64 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
65 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
66 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
67 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_035757 3300042612 Bacteria 2706
2 Ga0466705_305717 3300042612 Bacteria 3837
3 IMNBL1DRAFT_c0082808 3300000062 Bacteria 896
4 Ga0466693_231727 3300042592 Bacteria 1231
5 Ga0466696_215072 3300042596 Bacteria 4375
6 Ga0466696_241696 3300042596 Bacteria 4672
7 Ga0466701_008972 3300042598 Bacteria 1685
8 Ga0123357_10384078 3300009784 Bacteria 1299
9 Ga0123356_10005302 3300010049 Bacteria 13145
10 Ga0466711_069341 3300042615 Bacteria 69315
11 Ga0466726_170632 3300042619 Bacteria 1284
12 Ga0466734_118126 3300042623 Bacteria 1509
13 Ga0466735_026195 3300042624 Bacteria 1129
14 Ga0466735_041735 3300042624 Bacteria 2361
15 Ga0466735_089440 3300042624 Bacteria 2112
16 Ga0466735_130472 3300042624 Bacteria 2643
17 Ga0466725_459619 3300042654 Bacteria 1341
18 Ga0466727_042345 3300042655 Bacteria 13374
19 Ga0466707_234788 3300042601 Bacteria 3141
20 Ga0466713_074241 3300042602 Bacteria 3771
21 Ga0466716_302468 3300042605 Bacteria 23384
22 Ga0068305_10094748 3300005083 Unclassified 2064
23 Ga0123357_10048971 3300009784 Bacteria 5724
24 Ga0123354_10001542 3300010882 Bacteria 28227
25 Ga0466710_443272 3300042613 Bacteria 1059
26 Ga0466715_052608 3300042616 Bacteria 1711
27 Ga0466723_250630 3300042618 Bacteria 3025
28 Ga0466703_091416 3300042636 Bacteria 2061
29 Ga0466704_404355 3300042643 Bacteria 3624
30 Ga0466704_434670 3300042643 Bacteria 2827
31 Ga0466713_039709 3300042602 Bacteria 19483
32 Ga0466713_044168 3300042602 Bacteria 23186
33 Ga0466713_143596 3300042602 Bacteria 1025
34 Ga0466719_372237 3300042606 Bacteria 8104
35 Ga0466719_379862 3300042606 Bacteria 2643
36 Ga0466722_165113 3300042609 Bacteria 35000
37 Ga0466732_439102 3300042656 Bacteria 1749
38 2227507408 2225789004 Bacteria 3639
39 JGI24702J35022_10002945 3300002462 Bacteria 10301
40 Ga0466692_163838 3300042591 Bacteria 4088
41 Ga0466696_402975 3300042596 Bacteria 9226
42 Ga0466715_076359 3300042616 Bacteria 15631
43 Ga0466707_093234 3300042601 Bacteria 3556
44 Ga0466713_117834 3300042602 Bacteria 19690
45 Ga0466705_284343 3300042612 Bacteria 14433
46 IMNBL1DRAFT_c0007528 3300000062 Bacteria 5707
47 JGI24705J35276_12205976 3300002504 Bacteria 1710
48 Ga0123357_10010334 3300009784 Bacteria 11862
49 Ga0123357_10272177 3300009784 Unclassified 1767
50 Ga0123354_10392232 3300010882 Bacteria 1185
51 Ga0466715_229277 3300042616 Bacteria 9485
52 Ga0466703_069218 3300042636 Bacteria 5838
53 Ga0466704_504980 3300042643 Bacteria 9197
54 Ga0466709_218965 3300042648 Bacteria 23200
55 Ga0466727_164388 3300042655 Bacteria 3664
56 Ga0466700_102266 3300042600 Bacteria 11894
57 Ga0466707_402013 3300042601 Bacteria 1855
58 JGI24705J35276_12075112 3300002504 Bacteria 962
59 JGI24699J35502_11127536 3300002509 Bacteria 4176
60 JGI24699J35502_11134011 3300002509 Bacteria 24103
61 Ga0415639_258350 3300038395 Bacteria 1013
62 Ga0123357_10008613 3300009784 Bacteria 12765
63 Ga0123357_10030231 3300009784 Bacteria 7343
64 Ga0123353_10100763 3300010167 Bacteria 4656
65 Ga0123353_10121192 3300010167 Bacteria 4206
66 Ga0123353_10944190 3300010167 Bacteria 1167
67 Ga0123354_10039470 3300010882 Bacteria 7317
68 Ga0123354_10136403 3300010882 Unclassified 3065
69 Ga0466710_373677 3300042613 Bacteria 21386
70 Ga0466711_490041 3300042615 Bacteria 3963
71 Ga0466723_265163 3300042618 Bacteria 1408
72 Ga0466729_239996 3300042621 Bacteria 15530
73 Ga0466735_176466 3300042624 Bacteria 3485
74 Ga0466704_197215 3300042643 Bacteria 2408
75 Ga0466727_124126 3300042655 Bacteria 7801
76 Ga0466707_208886 3300042601 Bacteria 2963
77 Ga0466716_177205 3300042605 Bacteria 3277
78 Ga0466722_081713 3300042609 Bacteria 4561
79 2227273566 2225789004 Bacteria 1274
80 IMNBL1DRAFT_c0009894 3300000062 Bacteria 4640
81 JGI24705J35276_12178440 3300002504 Bacteria 1347
82 JGI24699J35502_11134045 3300002509 Bacteria 26658
83 Ga0466690_404209 3300042590 Bacteria 3172
84 Ga0466692_181143 3300042591 Bacteria 18569
85 Ga0466691_195452 3300042593 Bacteria 11459
86 Ga0466694_398916 3300042594 Bacteria 1655
87 Ga0123357_10428153 3300009784 Bacteria 1172
88 Ga0123354_10017098 3300010882 Bacteria 11360
89 Ga0466712_045488 3300042614 Bacteria 2181
90 Ga0466715_222839 3300042616 Bacteria 6079
91 Ga0466715_289675 3300042616 Bacteria 35409
92 Ga0466735_072645 3300042624 Bacteria 6232
93 Ga0466704_557681 3300042643 Bacteria 20638
94 Ga0466700_036651 3300042600 Bacteria 2758
95 Ga0466707_111695 3300042601 Bacteria 37145
96 Ga0466707_305705 3300042601 Bacteria 37461
97 Ga0466713_027887 3300042602 Bacteria 2533
98 Ga0466722_126170 3300042609 Bacteria 47921
99 Ga0466722_136436 3300042609 Bacteria 9717
100 Ga0466705_164363 3300042612 Bacteria 7729
101 2227474915 2225789004 Bacteria 4701
102 2227572419 2225789004 Bacteria 2600
103 JGI24695J34938_10086437 3300002450 Bacteria 1291
104 Ga0068305_10321584 3300005083 Bacteria 7639
105 Ga0466692_067548 3300042591 Bacteria 10110
106 Ga0466692_106596 3300042591 Bacteria 5339
107 Ga0123356_10104713 3300010049 Bacteria 2720
108 Ga0123353_10438278 3300010167 Bacteria 1929
109 Ga0123354_10005342 3300010882 Bacteria 18635
110 Ga0123354_10019502 3300010882 Bacteria 10651
111 Ga0123354_10082299 3300010882 Bacteria 4539
112 Ga0123354_10182274 3300010882 Unclassified 2391
113 Ga0466705_391529 3300042612 Bacteria 3302
114 Ga0466702_418845 3300042635 Bacteria 1312
115 Ga0466703_058449 3300042636 Bacteria 2569
116 Ga0466727_311789 3300042655 Bacteria 6585
117 Ga0466700_372371 3300042600 Bacteria 3166
118 Ga0466707_263999 3300042601 Bacteria 16080
119 Ga0466713_056151 3300042602 Bacteria 40882
120 Ga0466716_467442 3300042605 Bacteria 25909
121 2227414120 2225789004 Bacteria 26663
122 IMNBL1DRAFT_c0000967 3300000062 Bacteria 22204
123 JGI24702J35022_10004410 3300002462 Bacteria 8359
124 JGI24702J35022_10452510 3300002462 Bacteria 782
125 Ga0123357_10001231 3300009784 Bacteria 26869
126 Ga0466657_159134 3300042582 Bacteria 10484
127 Ga0466690_145185 3300042590 Bacteria 12761
128 Ga0466690_218433 3300042590 Bacteria 3017
129 Ga0466690_340718 3300042590 Bacteria 6390
130 Ga0466694_235763 3300042594 Bacteria 1459
131 Ga0466696_214177 3300042596 Bacteria 1759
132 Ga0466696_345175 3300042596 Bacteria 10393
133 Ga0466715_231121 3300042616 Bacteria 27941
134 Ga0466726_266114 3300042619 Bacteria 14251
135 Ga0466726_323051 3300042619 Bacteria 2652
136 Ga0466728_021948 3300042620 Bacteria 3982
137 Ga0466735_098167 3300042624 Bacteria 1805
138 Ga0466735_114191 3300042624 Bacteria 1585
139 Ga0466735_136106 3300042624 Bacteria 20578
140 Ga0466704_073513 3300042643 Bacteria 6622
141 Ga0466707_177566 3300042601 Bacteria 11010
142 Ga0466722_150021 3300042609 Bacteria 11279

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000062 IMNBL1DRAFT_c0009894 IMNBL1DRAFT_00098943 184
2 3300042582 Ga0466657_159134 Ga0466657_159134_5254_5811 185
3 3300042590 Ga0466690_340718 Ga0466690_340718_1342_1899 185
4 3300042591 Ga0466692_163838 Ga0466692_163838_1422_1979 185
5 3300042593 Ga0466691_195452 Ga0466691_195452_6419_6976 185
6 3300042594 Ga0466694_398916 Ga0466694_398916_144_701 185
7 3300042596 Ga0466696_215072 Ga0466696_215072_2396_2953 185
8 3300042596 Ga0466696_241696 Ga0466696_241696_854_1411 185
9 3300042596 Ga0466696_402975 Ga0466696_402975_4031_4588 185
10 3300042606 Ga0466719_372237 Ga0466719_372237_6460_7017 185
11 3300042609 Ga0466722_081713 Ga0466722_081713_1864_2421 185
12 3300042609 Ga0466722_150021 Ga0466722_150021_6541_7098 185
13 3300042609 Ga0466722_165113 Ga0466722_165113_14089_14646 185
14 3300042613 Ga0466710_373677 Ga0466710_373677_1012_1668 185
15 3300042613 Ga0466710_443272 Ga0466710_443272_182_739 185
16 3300042616 Ga0466715_076359 Ga0466715_076359_6187_6744 185
17 3300042616 Ga0466715_222839 Ga0466715_222839_4964_5521 185
18 3300042636 Ga0466703_069218 Ga0466703_069218_1807_2364 185
19 3300042654 Ga0466725_459619 Ga0466725_459619_768_1325 185
20 2225789004 2227273566 2227723364 186
21 2225789004 2227414120 2227855683 186
22 2225789004 2227474915 2227925846 186
23 2225789004 2227507408 2227996381 186
24 2225789004 2227572419 2228118557 186
25 3300002462 JGI24702J35022_10004410 JGI24702J35022_100044104 186
26 3300038395 Ga0415639_258350 Ga0415639_258350_73_633 186
27 3300042590 Ga0466690_145185 Ga0466690_145185_4393_4953 186
28 3300042590 Ga0466690_218433 Ga0466690_218433_316_876 186
29 3300042590 Ga0466690_404209 Ga0466690_404209_873_1433 186
30 3300042591 Ga0466692_067548 Ga0466692_067548_3506_4066 186
31 3300042591 Ga0466692_106596 Ga0466692_106596_3385_3945 186
32 3300042591 Ga0466692_181143 Ga0466692_181143_14169_14729 186
33 3300042592 Ga0466693_231727 Ga0466693_231727_171_731 186
34 3300042594 Ga0466694_235763 Ga0466694_235763_744_1304 186
35 3300042596 Ga0466696_214177 Ga0466696_214177_698_1258 186
36 3300042596 Ga0466696_345175 Ga0466696_345175_8678_9238 186
37 3300042598 Ga0466701_008972 Ga0466701_008972_581_1141 186
38 3300042600 Ga0466700_036651 Ga0466700_036651_954_1514 186
39 3300042600 Ga0466700_102266 Ga0466700_102266_4233_4793 186
40 3300042600 Ga0466700_372371 Ga0466700_372371_1489_2049 186
41 3300042601 Ga0466707_093234 Ga0466707_093234_609_1169 186
42 3300042601 Ga0466707_111695 Ga0466707_111695_4111_4671 186
43 3300042601 Ga0466707_177566 Ga0466707_177566_6721_7281 186
44 3300042601 Ga0466707_208886 Ga0466707_208886_961_1521 186
45 3300042601 Ga0466707_234788 Ga0466707_234788_146_706 186
46 3300042601 Ga0466707_263999 Ga0466707_263999_6234_6794 186
47 3300042601 Ga0466707_305705 Ga0466707_305705_34205_34765 186
48 3300042601 Ga0466707_402013 Ga0466707_402013_1067_1627 186
49 3300042602 Ga0466713_027887 Ga0466713_027887_1582_2142 186
50 3300042602 Ga0466713_039709 Ga0466713_039709_1711_2271 186
51 3300042602 Ga0466713_044168 Ga0466713_044168_5520_6080 186
52 3300042602 Ga0466713_056151 Ga0466713_056151_17613_18173 186
53 3300042602 Ga0466713_074241 Ga0466713_074241_1908_2468 186
54 3300042602 Ga0466713_117834 Ga0466713_117834_11594_12154 186
55 3300042602 Ga0466713_143596 Ga0466713_143596_220_780 186
56 3300042605 Ga0466716_177205 Ga0466716_177205_2453_3013 186
57 3300042605 Ga0466716_302468 Ga0466716_302468_10314_10874 186
58 3300042605 Ga0466716_467442 Ga0466716_467442_17830_18390 186
59 3300042606 Ga0466719_379862 Ga0466719_379862_71_631 186
60 3300042609 Ga0466722_136436 Ga0466722_136436_9122_9682 186
61 3300042612 Ga0466705_035757 Ga0466705_035757_151_711 186
62 3300042612 Ga0466705_284343 Ga0466705_284343_4193_4753 186
63 3300042612 Ga0466705_305717 Ga0466705_305717_166_726 186
64 3300042612 Ga0466705_391529 Ga0466705_391529_560_1120 186
65 3300042615 Ga0466711_069341 Ga0466711_069341_37707_38267 186
66 3300042615 Ga0466711_490041 Ga0466711_490041_1239_1799 186
67 3300042616 Ga0466715_052608 Ga0466715_052608_361_921 186
68 3300042616 Ga0466715_229277 Ga0466715_229277_6963_7523 186
69 3300042616 Ga0466715_231121 Ga0466715_231121_7413_7973 186
70 3300042616 Ga0466715_289675 Ga0466715_289675_13083_13643 186
71 3300042618 Ga0466723_250630 Ga0466723_250630_161_721 186
72 3300042618 Ga0466723_265163 Ga0466723_265163_702_1262 186
73 3300042619 Ga0466726_170632 Ga0466726_170632_245_805 186
74 3300042619 Ga0466726_266114 Ga0466726_266114_10016_10576 186
75 3300042619 Ga0466726_323051 Ga0466726_323051_294_854 186
76 3300042620 Ga0466728_021948 Ga0466728_021948_3215_3775 186
77 3300042621 Ga0466729_239996 Ga0466729_239996_982_1542 186
78 3300042623 Ga0466734_118126 Ga0466734_118126_403_963 186
79 3300042624 Ga0466735_026195 Ga0466735_026195_299_859 186
80 3300042624 Ga0466735_041735 Ga0466735_041735_927_1487 186
81 3300042624 Ga0466735_072645 Ga0466735_072645_1786_2346 186
82 3300042624 Ga0466735_089440 Ga0466735_089440_746_1306 186
83 3300042624 Ga0466735_098167 Ga0466735_098167_1206_1766 186
84 3300042624 Ga0466735_114191 Ga0466735_114191_885_1445 186
85 3300042624 Ga0466735_130472 Ga0466735_130472_1361_1921 186
86 3300042624 Ga0466735_136106 Ga0466735_136106_11468_12028 186
87 3300042624 Ga0466735_176466 Ga0466735_176466_717_1277 186
88 3300042635 Ga0466702_418845 Ga0466702_418845_94_654 186
89 3300042636 Ga0466703_058449 Ga0466703_058449_1400_1960 186
90 3300042636 Ga0466703_091416 Ga0466703_091416_989_1549 186
91 3300042643 Ga0466704_073513 Ga0466704_073513_5595_6155 186
92 3300042643 Ga0466704_404355 Ga0466704_404355_485_1045 186
93 3300042643 Ga0466704_434670 Ga0466704_434670_38_598 186
94 3300042643 Ga0466704_504980 Ga0466704_504980_2603_3163 186
95 3300042643 Ga0466704_557681 Ga0466704_557681_3308_3868 186
96 3300042648 Ga0466709_218965 Ga0466709_218965_3065_3625 186
97 3300042655 Ga0466727_042345 Ga0466727_042345_2740_3300 186
98 3300042655 Ga0466727_124126 Ga0466727_124126_4675_5235 186
99 3300042655 Ga0466727_164388 Ga0466727_164388_1329_1889 186
100 3300042655 Ga0466727_311789 Ga0466727_311789_837_1397 186
101 3300042656 Ga0466732_439102 Ga0466732_439102_1019_1579 186
102 iso_pr_bacteria 2820759988 2820761584 186
103 iso_pr_bacteria 2820778767 2820780620 186
104 iso_pr_bacteria 2940195863 2940196320 186
105 iso_pr_bacteria 2940199050 2940199325 186
106 iso_pr_bacteria 2940202316 2940203007 186
107 iso_pr_bacteria 2940205530 2940209151 186
108 iso_pr_bacteria 2940209341 2940210314 186
109 iso_pr_bacteria 2940212447 2940216067 186
110 iso_pr_bacteria 2940216256 2940217537 186
111 iso_pr_bacteria 2940298504 2940302121 186
112 iso_pr_bacteria 2940302308 2940305921 186
113 iso_pr_bacteria 2940306115 2940309771 186
114 iso_pr_bacteria 2940309933 2940313556 186
115 iso_pr_bacteria 2940313741 2940317420 186
116 iso_pr_bacteria 2940317558 2940321235 186
117 iso_pr_bacteria 2940321370 2940325048 186
118 iso_pr_bacteria 2940325180 2940328791 186
119 iso_pr_bacteria 2940328985 2940332602 186
120 iso_pr_bacteria 2940332795 2940336471 186
121 iso_pr_bacteria 2940346213 2940346387 186
122 iso_pr_bacteria 2940371297 2940372315 186
123 iso_pr_bacteria 2967483437 2967483596 186
124 3300000062 IMNBL1DRAFT_c0000967 IMNBL1DRAFT_000096719 187
125 3300000062 IMNBL1DRAFT_c0007528 IMNBL1DRAFT_00075283 187
126 3300000062 IMNBL1DRAFT_c0082808 IMNBL1DRAFT_00828082 187
127 3300002450 JGI24695J34938_10086437 JGI24695J34938_100864372 187
128 3300002462 JGI24702J35022_10002945 JGI24702J35022_1000294510 187
129 3300002462 JGI24702J35022_10452510 JGI24702J35022_104525101 187
130 3300002504 JGI24705J35276_12178440 JGI24705J35276_121784402 187
131 3300002504 JGI24705J35276_12205976 JGI24705J35276_122059762 187
132 3300002509 JGI24699J35502_11127536 JGI24699J35502_111275362 187
133 3300002509 JGI24699J35502_11134011 JGI24699J35502_111340119 187
134 3300002509 JGI24699J35502_11134045 JGI24699J35502_111340458 187
135 3300005083 Ga0068305_10094748 Ga0068305_100947482 187
136 3300005083 Ga0068305_10321584 Ga0068305_103215843 187
137 3300009784 Ga0123357_10001231 Ga0123357_1000123113 187
138 3300009784 Ga0123357_10008613 Ga0123357_100086136 187
139 3300009784 Ga0123357_10010334 Ga0123357_100103342 187
140 3300009784 Ga0123357_10030231 Ga0123357_100302315 187
141 3300009784 Ga0123357_10048971 Ga0123357_100489713 187
142 3300009784 Ga0123357_10272177 Ga0123357_102721773 187
143 3300009784 Ga0123357_10384078 Ga0123357_103840781 187
144 3300010049 Ga0123356_10005302 Ga0123356_100053028 187
145 3300010049 Ga0123356_10104713 Ga0123356_101047132 187
146 3300010167 Ga0123353_10100763 Ga0123353_101007632 187
147 3300010167 Ga0123353_10438278 Ga0123353_104382782 187
148 3300010167 Ga0123353_10944190 Ga0123353_109441902 187
149 3300010882 Ga0123354_10001542 Ga0123354_1000154214 187
150 3300010882 Ga0123354_10005342 Ga0123354_1000534213 187
151 3300010882 Ga0123354_10017098 Ga0123354_100170988 187
152 3300010882 Ga0123354_10019502 Ga0123354_100195023 187
153 3300010882 Ga0123354_10039470 Ga0123354_100394702 187
154 3300010882 Ga0123354_10082299 Ga0123354_100822993 187
155 3300010882 Ga0123354_10136403 Ga0123354_101364031 187
156 3300010882 Ga0123354_10182274 Ga0123354_101822742 187
157 3300010882 Ga0123354_10392232 Ga0123354_103922322 187
158 3300042609 Ga0466722_126170 Ga0466722_126170_212_775 187
159 3300042612 Ga0466705_164363 Ga0466705_164363_5815_6378 187
160 3300042614 Ga0466712_045488 Ga0466712_045488_62_625 187
161 3300042643 Ga0466704_197215 Ga0466704_197215_696_1259 187
162 iso_pr_bacteria 2820762746 2820763894 187
163 3300002504 JGI24705J35276_12075112 JGI24705J35276_120751121 188
164 3300009784 Ga0123357_10428153 Ga0123357_104281532 198
165 3300010167 Ga0123353_10121192 Ga0123353_101211924 228

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01765 RRF Ribosome recycling factor 54 151 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.43 0.61 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.