Protein Family IF07281
Metagenome
Isolate
117
Members
49
Samples
108
Scaffolds
184.16
Avg Length
Representative Sequence
- ID
- 3300042613|Ga0466710_108039|Ga0466710_108039_1079_1726
- Length
- 204 aa
- Sequence
- MFRLYRLSISKLNFEILKSWMKNSPLARRKFLQKLGTAVAGGTIVAVSAGLALKTKSAEASLFWQIDPHKCNQCGRCETHCVLPVSAVKCVHAYEVCGYCDLCGGYYRTNVKELNTAAENLMCPTGAIQRKFIEEPYFEYTIDENLCNGCGKCVKGCTSFGNGSLYLQVKRELCSDXXXXKIAKACPADAISRVPYKKAYQLKG
Sample Types
Isolate
7.7%
Metagenome
92.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.2%
Unclassified
18.8%
Kalotermitidae
10.4%
Rhinotermitidae
6.2%
Termopsidae
4.2%
Passalidae
4.2%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 2 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 28 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 31 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 37 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 42 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 43 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | IMNBL1DRAFT_c0038693 | 3300000062 | Bacteria | 1636 |
| 2 | JGI24695J34938_10001577 | 3300002450 | Bacteria | 19210 |
| 3 | Ga0466692_118731 | 3300042591 | Bacteria | 25948 |
| 4 | Ga0466699_427203 | 3300042597 | Bacteria | 1664 |
| 5 | Ga0123356_10003353 | 3300010049 | Bacteria | 16817 |
| 6 | Ga0123356_10004985 | 3300010049 | Bacteria | 13618 |
| 7 | Ga0123356_10143860 | 3300010049 | Bacteria | 2356 |
| 8 | Ga0123356_10154864 | 3300010049 | Bacteria | 2281 |
| 9 | Ga0123356_10261169 | 3300010049 | Bacteria | 1816 |
| 10 | Ga0123356_10406435 | 3300010049 | Bacteria | 1500 |
| 11 | Ga0123353_11561036 | 3300010167 | Bacteria | 836 |
| 12 | Ga0466733_016311 | 3300042659 | Bacteria | 1180 |
| 13 | Ga0466733_081875 | 3300042659 | Bacteria | 6522 |
| 14 | Ga0466706_100257 | 3300042599 | Bacteria | 3147 |
| 15 | Ga0466717_286649 | 3300042604 | Bacteria | 1029 |
| 16 | Ga0466716_021314 | 3300042605 | Bacteria | 37561 |
| 17 | Ga0466722_207658 | 3300042609 | Bacteria | 14453 |
| 18 | Ga0466698_338658 | 3300042610 | Bacteria | 1471 |
| 19 | Ga0466731_284712 | 3300042622 | Bacteria | 1601 |
| 20 | 2227632951 | 2225789004 | Bacteria | 11318 |
| 21 | JGI24695J34938_10001837 | 3300002450 | Bacteria | 17291 |
| 22 | JGI24702J35022_10491195 | 3300002462 | Bacteria | 752 |
| 23 | JGI24705J35276_12229307 | 3300002504 | Bacteria | 3362 |
| 24 | Ga0123356_10019657 | 3300010049 | Bacteria | 6401 |
| 25 | Ga0123356_10455989 | 3300010049 | Bacteria | 1427 |
| 26 | Ga0123353_11268189 | 3300010167 | Bacteria | 960 |
| 27 | Ga0466722_241729 | 3300042609 | Bacteria | 24027 |
| 28 | Ga0466697_272053 | 3300042611 | Bacteria | 1093 |
| 29 | Ga0466708_037744 | 3300042652 | Bacteria | 6606 |
| 30 | IMNBL1DRAFT_c0001368 | 3300000062 | Bacteria | 18331 |
| 31 | JGI24702J35022_10107009 | 3300002462 | Bacteria | 1536 |
| 32 | JGI24705J35276_12191716 | 3300002504 | Unclassified | 1478 |
| 33 | Ga0415639_092667 | 3300038395 | Bacteria | 8172 |
| 34 | Ga0466696_167331 | 3300042596 | Bacteria | 3936 |
| 35 | Ga0123356_10512725 | 3300010049 | Bacteria | 1357 |
| 36 | Ga0123356_12365341 | 3300010049 | Bacteria | 665 |
| 37 | Ga0466701_061027 | 3300042598 | Bacteria | 1117 |
| 38 | Ga0466700_063357 | 3300042600 | Bacteria | 1322 |
| 39 | Ga0466716_116781 | 3300042605 | Bacteria | 26988 |
| 40 | Ga0466710_128980 | 3300042613 | Bacteria | 16866 |
| 41 | Ga0466710_446558 | 3300042613 | Bacteria | 2061 |
| 42 | Ga0466735_099091 | 3300042624 | Unclassified | 1587 |
| 43 | Ga0466702_368857 | 3300042635 | Bacteria | 1189 |
| 44 | JGI24698J34947_10050786 | 3300002449 | Unclassified | 2089 |
| 45 | JGI24702J35022_10249259 | 3300002462 | Bacteria | 1032 |
| 46 | Ga0123353_10008811 | 3300010167 | Bacteria | 13826 |
| 47 | Ga0123353_10520595 | 3300010167 | Bacteria | 1726 |
| 48 | Ga0123354_10588716 | 3300010882 | Unclassified | 820 |
| 49 | Ga0466700_112181 | 3300042600 | Bacteria | 114718 |
| 50 | Ga0466702_036872 | 3300042635 | Bacteria | 1295 |
| 51 | Ga0466725_436849 | 3300042654 | Bacteria | 2586 |
| 52 | JGI24702J35022_10002625 | 3300002462 | Bacteria | 10913 |
| 53 | Ga0466695_219660 | 3300042595 | Bacteria | 2925 |
| 54 | Ga0466696_344053 | 3300042596 | Bacteria | 20178 |
| 55 | Ga0123355_11045345 | 3300009826 | Bacteria | 859 |
| 56 | Ga0123356_10375424 | 3300010049 | Bacteria | 1553 |
| 57 | Ga0123356_11589558 | 3300010049 | Bacteria | 809 |
| 58 | Ga0123356_11632309 | 3300010049 | Bacteria | 799 |
| 59 | Ga0123353_10207827 | 3300010167 | Bacteria | 3073 |
| 60 | Ga0466733_105928 | 3300042659 | Bacteria | 4206 |
| 61 | Ga0466707_110080 | 3300042601 | Bacteria | 23233 |
| 62 | Ga0466717_192014 | 3300042604 | Bacteria | 2701 |
| 63 | Ga0466721_236020 | 3300042608 | Bacteria | 1206 |
| 64 | Ga0466710_108039 | 3300042613 | Bacteria | 2777 |
| 65 | Ga0466710_226712 | 3300042613 | Bacteria | 1560 |
| 66 | 2227121377 | 2225789004 | Bacteria | 1699 |
| 67 | IMNBL1DRAFT_c0000723 | 3300000062 | Bacteria | 26182 |
| 68 | IMNBL1DRAFT_c0021794 | 3300000062 | Bacteria | 2553 |
| 69 | Ga0466656_189747 | 3300042550 | Bacteria | 1768 |
| 70 | Ga0466657_198123 | 3300042582 | Bacteria | 1412 |
| 71 | Ga0466694_228186 | 3300042594 | Bacteria | 6976 |
| 72 | Ga0466695_191111 | 3300042595 | Bacteria | 6718 |
| 73 | Ga0123353_10466334 | 3300010167 | Bacteria | 1854 |
| 74 | Ga0123353_10531681 | 3300010167 | Bacteria | 1702 |
| 75 | Ga0123353_11013676 | 3300010167 | Bacteria | 1114 |
| 76 | Ga0123353_12711211 | 3300010167 | Bacteria | 583 |
| 77 | Ga0123354_10292068 | 3300010882 | Bacteria | 1560 |
| 78 | Ga0466732_137902 | 3300042656 | Bacteria | 1339 |
| 79 | Ga0466717_151962 | 3300042604 | Bacteria | 1559 |
| 80 | IMNBL1DRAFT_c0002313 | 3300000062 | Bacteria | 13371 |
| 81 | IMNBL1DRAFT_c0008942 | 3300000062 | Bacteria | 5035 |
| 82 | JGI24702J35022_10000797 | 3300002462 | Bacteria | 19502 |
| 83 | JGI24702J35022_10018026 | 3300002462 | Bacteria | 3853 |
| 84 | JGI24702J35022_10023256 | 3300002462 | Bacteria | 3351 |
| 85 | Ga0123356_10090336 | 3300010049 | Bacteria | 2916 |
| 86 | Ga0123356_10233439 | 3300010049 | Bacteria | 1905 |
| 87 | Ga0123353_10256439 | 3300010167 | Bacteria | 2705 |
| 88 | Ga0123354_10093338 | 3300010882 | Bacteria | 4137 |
| 89 | Ga0123354_10207447 | 3300010882 | Bacteria | 2130 |
| 90 | Ga0466717_138615 | 3300042604 | Bacteria | 1689 |
| 91 | Ga0466698_353434 | 3300042610 | Bacteria | 1266 |
| 92 | Ga0466697_015359 | 3300042611 | Bacteria | 2203 |
| 93 | Ga0466697_087784 | 3300042611 | Bacteria | 15141 |
| 94 | Ga0466711_290492 | 3300042615 | Bacteria | 20165 |
| 95 | Ga0466726_271228 | 3300042619 | Bacteria | 11527 |
| 96 | Ga0466729_065898 | 3300042621 | Bacteria | 2412 |
| 97 | Ga0466735_229675 | 3300042624 | Bacteria | 1052 |
| 98 | JGI24702J35022_10007198 | 3300002462 | Bacteria | 6397 |
| 99 | Ga0072941_1249997 | 3300005201 | Bacteria | 2066 |
| 100 | Ga0123356_10253528 | 3300010049 | Bacteria | 1839 |
| 101 | Ga0123353_10442274 | 3300010167 | Bacteria | 1917 |
| 102 | Ga0123353_11138317 | 3300010167 | Bacteria | 1031 |
| 103 | Ga0123354_10315928 | 3300010882 | Unclassified | 1450 |
| 104 | Ga0123354_10391839 | 3300010882 | Bacteria | 1186 |
| 105 | Ga0466707_420521 | 3300042601 | Bacteria | 2417 |
| 106 | Ga0466721_197577 | 3300042608 | Bacteria | 3435 |
| 107 | Ga0466726_330845 | 3300042619 | Bacteria | 8724 |
| 108 | Ga0466703_113592 | 3300042636 | Bacteria | 17517 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010882 | Ga0123354_10093338 | Ga0123354_100933381 | 167 |
| 2 | 3300010167 | Ga0123353_10466334 | Ga0123353_104663341 | 168 |
| 3 | 3300042621 | Ga0466729_065898 | Ga0466729_065898_1521_2087 | 169 |
| 4 | 3300042656 | Ga0466732_137902 | Ga0466732_137902_521_1090 | 169 |
| 5 | 3300010049 | Ga0123356_10455989 | Ga0123356_104559892 | 170 |
| 6 | 3300042615 | Ga0466711_290492 | Ga0466711_290492_8245_8814 | 170 |
| 7 | 3300010049 | Ga0123356_10003353 | Ga0123356_100033534 | 171 |
| 8 | 3300010167 | Ga0123353_11138317 | Ga0123353_111383171 | 172 |
| 9 | 3300010049 | Ga0123356_10406435 | Ga0123356_104064352 | 173 |
| 10 | 3300010882 | Ga0123354_10588716 | Ga0123354_105887161 | 173 |
| 11 | 3300002504 | JGI24705J35276_12191716 | JGI24705J35276_121917162 | 175 |
| 12 | 3300010167 | Ga0123353_10256439 | Ga0123353_102564394 | 176 |
| 13 | 3300042601 | Ga0466707_110080 | Ga0466707_110080_18071_18637 | 176 |
| 14 | 3300042601 | Ga0466707_420521 | Ga0466707_420521_468_1037 | 176 |
| 15 | 3300002449 | JGI24698J34947_10050786 | JGI24698J34947_100507862 | 177 |
| 16 | 3300002462 | JGI24702J35022_10018026 | JGI24702J35022_100180262 | 177 |
| 17 | 3300010167 | Ga0123353_11013676 | Ga0123353_110136762 | 177 |
| 18 | 3300010882 | Ga0123354_10292068 | Ga0123354_102920682 | 177 |
| 19 | 3300042599 | Ga0466706_100257 | Ga0466706_100257_1635_2204 | 177 |
| 20 | 3300042608 | Ga0466721_197577 | Ga0466721_197577_1931_2500 | 177 |
| 21 | 3300042609 | Ga0466722_207658 | Ga0466722_207658_2687_3259 | 177 |
| 22 | 3300042619 | Ga0466726_330845 | Ga0466726_330845_7047_7601 | 177 |
| 23 | 3300042636 | Ga0466703_113592 | Ga0466703_113592_10404_10973 | 177 |
| 24 | 3300042659 | Ga0466733_081875 | Ga0466733_081875_3550_4113 | 177 |
| 25 | 3300002462 | JGI24702J35022_10491195 | JGI24702J35022_104911951 | 178 |
| 26 | 3300010167 | Ga0123353_11268189 | Ga0123353_112681892 | 178 |
| 27 | 3300042608 | Ga0466721_236020 | Ga0466721_236020_133_705 | 178 |
| 28 | 3300000062 | IMNBL1DRAFT_c0001368 | IMNBL1DRAFT_000136810 | 179 |
| 29 | 3300002462 | JGI24702J35022_10249259 | JGI24702J35022_102492592 | 179 |
| 30 | 3300010049 | Ga0123356_10512725 | Ga0123356_105127252 | 179 |
| 31 | 3300010167 | Ga0123353_10442274 | Ga0123353_104422742 | 179 |
| 32 | 3300042598 | Ga0466701_061027 | Ga0466701_061027_332_910 | 179 |
| 33 | 3300042611 | Ga0466697_087784 | Ga0466697_087784_2413_2982 | 179 |
| 34 | 3300042624 | Ga0466735_229675 | Ga0466735_229675_18_581 | 179 |
| 35 | 3300002462 | JGI24702J35022_10000797 | JGI24702J35022_1000079715 | 180 |
| 36 | 3300042600 | Ga0466700_063357 | Ga0466700_063357_207_788 | 180 |
| 37 | 3300042613 | Ga0466710_446558 | Ga0466710_446558_1100_1678 | 180 |
| 38 | 3300042659 | Ga0466733_105928 | Ga0466733_105928_1156_1728 | 180 |
| 39 | 3300009826 | Ga0123355_11045345 | Ga0123355_110453452 | 181 |
| 40 | 3300010167 | Ga0123353_11561036 | Ga0123353_115610362 | 181 |
| 41 | 3300010882 | Ga0123354_10315928 | Ga0123354_103159283 | 181 |
| 42 | 3300042596 | Ga0466696_167331 | Ga0466696_167331_3055_3624 | 181 |
| 43 | 3300042611 | Ga0466697_272053 | Ga0466697_272053_253_828 | 181 |
| 44 | 3300042654 | Ga0466725_436849 | Ga0466725_436849_237_806 | 181 |
| 45 | 3300002450 | JGI24695J34938_10001577 | JGI24695J34938_100015779 | 182 |
| 46 | 3300010167 | Ga0123353_12711211 | Ga0123353_127112111 | 182 |
| 47 | 3300042595 | Ga0466695_191111 | Ga0466695_191111_320_868 | 182 |
| 48 | 2225789004 | 2227121377 | 2227514491 | 183 |
| 49 | 3300042597 | Ga0466699_427203 | Ga0466699_427203_600_1175 | 183 |
| 50 | 3300042604 | Ga0466717_286649 | Ga0466717_286649_288_839 | 183 |
| 51 | 3300042610 | Ga0466698_338658 | Ga0466698_338658_677_1228 | 183 |
| 52 | 3300042610 | Ga0466698_353434 | Ga0466698_353434_400_951 | 183 |
| 53 | 3300042611 | Ga0466697_015359 | Ga0466697_015359_1511_2062 | 183 |
| 54 | 3300000062 | IMNBL1DRAFT_c0000723 | IMNBL1DRAFT_00007236 | 184 |
| 55 | 3300010049 | Ga0123356_10154864 | Ga0123356_101548643 | 184 |
| 56 | 3300010049 | Ga0123356_10261169 | Ga0123356_102611691 | 184 |
| 57 | 3300010167 | Ga0123353_10207827 | Ga0123353_102078274 | 184 |
| 58 | 3300010167 | Ga0123353_10531681 | Ga0123353_105316812 | 184 |
| 59 | 3300010882 | Ga0123354_10207447 | Ga0123354_102074472 | 184 |
| 60 | 3300010882 | Ga0123354_10391839 | Ga0123354_103918391 | 184 |
| 61 | 3300042582 | Ga0466657_198123 | Ga0466657_198123_653_1207 | 184 |
| 62 | 3300042604 | Ga0466717_192014 | Ga0466717_192014_1562_2155 | 184 |
| 63 | 3300042613 | Ga0466710_128980 | Ga0466710_128980_12989_13570 | 184 |
| 64 | 3300042635 | Ga0466702_036872 | Ga0466702_036872_131_712 | 184 |
| 65 | 3300000062 | IMNBL1DRAFT_c0008942 | IMNBL1DRAFT_00089425 | 185 |
| 66 | 3300000062 | IMNBL1DRAFT_c0021794 | IMNBL1DRAFT_00217942 | 185 |
| 67 | 3300002462 | JGI24702J35022_10002625 | JGI24702J35022_100026258 | 185 |
| 68 | 3300002504 | JGI24705J35276_12229307 | JGI24705J35276_122293073 | 185 |
| 69 | 3300010049 | Ga0123356_10375424 | Ga0123356_103754242 | 185 |
| 70 | 3300010049 | Ga0123356_11632309 | Ga0123356_116323092 | 185 |
| 71 | 3300010049 | Ga0123356_12365341 | Ga0123356_123653411 | 185 |
| 72 | 3300042550 | Ga0466656_189747 | Ga0466656_189747_222_779 | 185 |
| 73 | 3300010167 | Ga0123353_10520595 | Ga0123353_105205952 | 186 |
| 74 | 3300042591 | Ga0466692_118731 | Ga0466692_118731_17827_18402 | 186 |
| 75 | 3300042659 | Ga0466733_016311 | Ga0466733_016311_302_862 | 186 |
| 76 | 3300042619 | Ga0466726_271228 | Ga0466726_271228_6498_7079 | 187 |
| 77 | iso_pr_bacteria | 2967483437 | 2967484516 | 187 |
| 78 | iso_pr_bacteria | 2967483437 | 2967484728 | 187 |
| 79 | 3300002462 | JGI24702J35022_10107009 | JGI24702J35022_101070092 | 188 |
| 80 | 3300005201 | Ga0072941_1249997 | Ga0072941_12499972 | 188 |
| 81 | 3300010049 | Ga0123356_11589558 | Ga0123356_115895582 | 188 |
| 82 | 3300042600 | Ga0466700_112181 | Ga0466700_112181_69692_70288 | 188 |
| 83 | 3300042605 | Ga0466716_021314 | Ga0466716_021314_8058_8624 | 188 |
| 84 | iso_pr_bacteria | 2820792843 | 2820794506 | 188 |
| 85 | iso_pr_bacteria | 2820795054 | 2820795520 | 188 |
| 86 | 3300002462 | JGI24702J35022_10023256 | JGI24702J35022_100232564 | 189 |
| 87 | 3300010049 | Ga0123356_10233439 | Ga0123356_102334392 | 189 |
| 88 | 3300038395 | Ga0415639_092667 | Ga0415639_092667_3259_3855 | 189 |
| 89 | 3300042595 | Ga0466695_219660 | Ga0466695_219660_2002_2571 | 189 |
| 90 | 3300042613 | Ga0466710_226712 | Ga0466710_226712_855_1424 | 189 |
| 91 | 3300042635 | Ga0466702_368857 | Ga0466702_368857_263_856 | 189 |
| 92 | 2225789004 | 2227632951 | 2228218116 | 190 |
| 93 | 3300000062 | IMNBL1DRAFT_c0002313 | IMNBL1DRAFT_00023133 | 190 |
| 94 | 3300000062 | IMNBL1DRAFT_c0038693 | IMNBL1DRAFT_00386932 | 190 |
| 95 | 3300042594 | Ga0466694_228186 | Ga0466694_228186_460_1068 | 190 |
| 96 | 3300042622 | Ga0466731_284712 | Ga0466731_284712_172_744 | 190 |
| 97 | 3300042624 | Ga0466735_099091 | Ga0466735_099091_481_1053 | 190 |
| 98 | 3300042652 | Ga0466708_037744 | Ga0466708_037744_5438_6010 | 190 |
| 99 | 3300002462 | JGI24702J35022_10007198 | JGI24702J35022_100071985 | 191 |
| 100 | 3300042596 | Ga0466696_344053 | Ga0466696_344053_3697_4272 | 191 |
| 101 | 3300042604 | Ga0466717_151962 | Ga0466717_151962_12_623 | 191 |
| 102 | 3300042605 | Ga0466716_116781 | Ga0466716_116781_14863_15438 | 191 |
| 103 | 3300042609 | Ga0466722_241729 | Ga0466722_241729_13849_14424 | 191 |
| 104 | 3300010049 | Ga0123356_10019657 | Ga0123356_100196574 | 192 |
| 105 | 3300010049 | Ga0123356_10004985 | Ga0123356_1000498512 | 193 |
| 106 | 3300042604 | Ga0466717_138615 | Ga0466717_138615_219_818 | 193 |
| 107 | 3300010049 | Ga0123356_10090336 | Ga0123356_100903362 | 194 |
| 108 | 3300010049 | Ga0123356_10253528 | Ga0123356_102535282 | 196 |
| 109 | iso_pr_bacteria | 2778260935 | 2778344777 | 196 |
| 110 | iso_pr_bacteria | 2778260938 | 2778351207 | 196 |
| 111 | 3300002450 | JGI24695J34938_10001837 | JGI24695J34938_100018378 | 197 |
| 112 | 3300010049 | Ga0123356_10143860 | Ga0123356_101438602 | 197 |
| 113 | iso_pr_bacteria | 2820719201 | 2820720965 | 199 |
| 114 | 3300010167 | Ga0123353_10008811 | Ga0123353_100088113 | 200 |
| 115 | 3300042613 | Ga0466710_108039 | Ga0466710_108039_1079_1726 | 204 |
| 116 | iso_pr_bacteria | 2773857778 | 2774476501 | 210 |
| 117 | iso_pr_bacteria | 2778260936 | 2778346522 | 210 |
Functional Annotation
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m32-assembly1.cif.gz_B | Cryo-EM structure of FMO-RC complex from green sulfur bacteria | 0.623 | 63 | 197 |
| 3l09-assembly2.cif.gz_C | Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution | 0.57 | 117 | 146 |
| 7z6q-assembly1.cif.gz_B | Cryo-EM structure of the whole photosynthetic complex from the green sulfur bacteria | 0.563 | 57 | 204 |
| 6qil-assembly2.cif.gz_C | The complex structure of hsRosR-S1 (VNG0258H/RosR-S1) | 0.532 | 113 | 145 |
| 2b0l-assembly1.cif.gz_B-2 | C-terminal DNA binding domain of transcriptional pleiotropic repressor CodY. | 0.528 | 126 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0E5N2_164_226_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.5911 | 62 | 194 | 3.30.70.20 |
| af_Q6YTK0_650_726_1.10.10.580 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Structural maintenance of chromosome 1. Chain E | 0.5613 | 121 | 146 | 1.10.10.580 |
| 2xv4S01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.5462 | 117 | 143 | 1.10.10.10 |
| af_F1QAI9_142_263_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.5441 | 113 | 144 | 2.60.40.10 |
| af_K7MPY9_17_285_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.534 | 125 | 148 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5W0A7-F1-model_v4 | Uncharacterized/unreviewed | 0.9142 | 64 | 204 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.64 | 0.75 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.