Protein Family IF07281

Metagenome Isolate
117 Members
49 Samples
108 Scaffolds
184.16 Avg Length

🧬 Representative Sequence

ID
3300042613|Ga0466710_108039|Ga0466710_108039_1079_1726
Length
204 aa
Sequence
MFRLYRLSISKLNFEILKSWMKNSPLARRKFLQKLGTAVAGGTIVAVSAGLALKTKSAEASLFWQIDPHKCNQCGRCETHCVLPVSAVKCVHAYEVCGYCDLCGGYYRTNVKELNTAAENLMCPTGAIQRKFIEEPYFEYTIDENLCNGCGKCVKGCTSFGNGSLYLQVKRELCSDXXXXKIAKACPADAISRVPYKKAYQLKG

📊 Sample Types

Isolate 7.7%
Metagenome 92.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 54.2%
Unclassified 18.8%
Kalotermitidae 10.4%
Rhinotermitidae 6.2%
Termopsidae 4.2%
Passalidae 4.2%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
2 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
7 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
10 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
13 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
27 2778260936 Unclassified Fibrobacteres Co191P3bin13 Isolate Unclassified
28 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
31 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
32 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
33 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
37 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
40 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
42 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
43 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
44 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
45 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
46 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
47 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
48 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 IMNBL1DRAFT_c0038693 3300000062 Bacteria 1636
2 JGI24695J34938_10001577 3300002450 Bacteria 19210
3 Ga0466692_118731 3300042591 Bacteria 25948
4 Ga0466699_427203 3300042597 Bacteria 1664
5 Ga0123356_10003353 3300010049 Bacteria 16817
6 Ga0123356_10004985 3300010049 Bacteria 13618
7 Ga0123356_10143860 3300010049 Bacteria 2356
8 Ga0123356_10154864 3300010049 Bacteria 2281
9 Ga0123356_10261169 3300010049 Bacteria 1816
10 Ga0123356_10406435 3300010049 Bacteria 1500
11 Ga0123353_11561036 3300010167 Bacteria 836
12 Ga0466733_016311 3300042659 Bacteria 1180
13 Ga0466733_081875 3300042659 Bacteria 6522
14 Ga0466706_100257 3300042599 Bacteria 3147
15 Ga0466717_286649 3300042604 Bacteria 1029
16 Ga0466716_021314 3300042605 Bacteria 37561
17 Ga0466722_207658 3300042609 Bacteria 14453
18 Ga0466698_338658 3300042610 Bacteria 1471
19 Ga0466731_284712 3300042622 Bacteria 1601
20 2227632951 2225789004 Bacteria 11318
21 JGI24695J34938_10001837 3300002450 Bacteria 17291
22 JGI24702J35022_10491195 3300002462 Bacteria 752
23 JGI24705J35276_12229307 3300002504 Bacteria 3362
24 Ga0123356_10019657 3300010049 Bacteria 6401
25 Ga0123356_10455989 3300010049 Bacteria 1427
26 Ga0123353_11268189 3300010167 Bacteria 960
27 Ga0466722_241729 3300042609 Bacteria 24027
28 Ga0466697_272053 3300042611 Bacteria 1093
29 Ga0466708_037744 3300042652 Bacteria 6606
30 IMNBL1DRAFT_c0001368 3300000062 Bacteria 18331
31 JGI24702J35022_10107009 3300002462 Bacteria 1536
32 JGI24705J35276_12191716 3300002504 Unclassified 1478
33 Ga0415639_092667 3300038395 Bacteria 8172
34 Ga0466696_167331 3300042596 Bacteria 3936
35 Ga0123356_10512725 3300010049 Bacteria 1357
36 Ga0123356_12365341 3300010049 Bacteria 665
37 Ga0466701_061027 3300042598 Bacteria 1117
38 Ga0466700_063357 3300042600 Bacteria 1322
39 Ga0466716_116781 3300042605 Bacteria 26988
40 Ga0466710_128980 3300042613 Bacteria 16866
41 Ga0466710_446558 3300042613 Bacteria 2061
42 Ga0466735_099091 3300042624 Unclassified 1587
43 Ga0466702_368857 3300042635 Bacteria 1189
44 JGI24698J34947_10050786 3300002449 Unclassified 2089
45 JGI24702J35022_10249259 3300002462 Bacteria 1032
46 Ga0123353_10008811 3300010167 Bacteria 13826
47 Ga0123353_10520595 3300010167 Bacteria 1726
48 Ga0123354_10588716 3300010882 Unclassified 820
49 Ga0466700_112181 3300042600 Bacteria 114718
50 Ga0466702_036872 3300042635 Bacteria 1295
51 Ga0466725_436849 3300042654 Bacteria 2586
52 JGI24702J35022_10002625 3300002462 Bacteria 10913
53 Ga0466695_219660 3300042595 Bacteria 2925
54 Ga0466696_344053 3300042596 Bacteria 20178
55 Ga0123355_11045345 3300009826 Bacteria 859
56 Ga0123356_10375424 3300010049 Bacteria 1553
57 Ga0123356_11589558 3300010049 Bacteria 809
58 Ga0123356_11632309 3300010049 Bacteria 799
59 Ga0123353_10207827 3300010167 Bacteria 3073
60 Ga0466733_105928 3300042659 Bacteria 4206
61 Ga0466707_110080 3300042601 Bacteria 23233
62 Ga0466717_192014 3300042604 Bacteria 2701
63 Ga0466721_236020 3300042608 Bacteria 1206
64 Ga0466710_108039 3300042613 Bacteria 2777
65 Ga0466710_226712 3300042613 Bacteria 1560
66 2227121377 2225789004 Bacteria 1699
67 IMNBL1DRAFT_c0000723 3300000062 Bacteria 26182
68 IMNBL1DRAFT_c0021794 3300000062 Bacteria 2553
69 Ga0466656_189747 3300042550 Bacteria 1768
70 Ga0466657_198123 3300042582 Bacteria 1412
71 Ga0466694_228186 3300042594 Bacteria 6976
72 Ga0466695_191111 3300042595 Bacteria 6718
73 Ga0123353_10466334 3300010167 Bacteria 1854
74 Ga0123353_10531681 3300010167 Bacteria 1702
75 Ga0123353_11013676 3300010167 Bacteria 1114
76 Ga0123353_12711211 3300010167 Bacteria 583
77 Ga0123354_10292068 3300010882 Bacteria 1560
78 Ga0466732_137902 3300042656 Bacteria 1339
79 Ga0466717_151962 3300042604 Bacteria 1559
80 IMNBL1DRAFT_c0002313 3300000062 Bacteria 13371
81 IMNBL1DRAFT_c0008942 3300000062 Bacteria 5035
82 JGI24702J35022_10000797 3300002462 Bacteria 19502
83 JGI24702J35022_10018026 3300002462 Bacteria 3853
84 JGI24702J35022_10023256 3300002462 Bacteria 3351
85 Ga0123356_10090336 3300010049 Bacteria 2916
86 Ga0123356_10233439 3300010049 Bacteria 1905
87 Ga0123353_10256439 3300010167 Bacteria 2705
88 Ga0123354_10093338 3300010882 Bacteria 4137
89 Ga0123354_10207447 3300010882 Bacteria 2130
90 Ga0466717_138615 3300042604 Bacteria 1689
91 Ga0466698_353434 3300042610 Bacteria 1266
92 Ga0466697_015359 3300042611 Bacteria 2203
93 Ga0466697_087784 3300042611 Bacteria 15141
94 Ga0466711_290492 3300042615 Bacteria 20165
95 Ga0466726_271228 3300042619 Bacteria 11527
96 Ga0466729_065898 3300042621 Bacteria 2412
97 Ga0466735_229675 3300042624 Bacteria 1052
98 JGI24702J35022_10007198 3300002462 Bacteria 6397
99 Ga0072941_1249997 3300005201 Bacteria 2066
100 Ga0123356_10253528 3300010049 Bacteria 1839
101 Ga0123353_10442274 3300010167 Bacteria 1917
102 Ga0123353_11138317 3300010167 Bacteria 1031
103 Ga0123354_10315928 3300010882 Unclassified 1450
104 Ga0123354_10391839 3300010882 Bacteria 1186
105 Ga0466707_420521 3300042601 Bacteria 2417
106 Ga0466721_197577 3300042608 Bacteria 3435
107 Ga0466726_330845 3300042619 Bacteria 8724
108 Ga0466703_113592 3300042636 Bacteria 17517

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010882 Ga0123354_10093338 Ga0123354_100933381 167
2 3300010167 Ga0123353_10466334 Ga0123353_104663341 168
3 3300042621 Ga0466729_065898 Ga0466729_065898_1521_2087 169
4 3300042656 Ga0466732_137902 Ga0466732_137902_521_1090 169
5 3300010049 Ga0123356_10455989 Ga0123356_104559892 170
6 3300042615 Ga0466711_290492 Ga0466711_290492_8245_8814 170
7 3300010049 Ga0123356_10003353 Ga0123356_100033534 171
8 3300010167 Ga0123353_11138317 Ga0123353_111383171 172
9 3300010049 Ga0123356_10406435 Ga0123356_104064352 173
10 3300010882 Ga0123354_10588716 Ga0123354_105887161 173
11 3300002504 JGI24705J35276_12191716 JGI24705J35276_121917162 175
12 3300010167 Ga0123353_10256439 Ga0123353_102564394 176
13 3300042601 Ga0466707_110080 Ga0466707_110080_18071_18637 176
14 3300042601 Ga0466707_420521 Ga0466707_420521_468_1037 176
15 3300002449 JGI24698J34947_10050786 JGI24698J34947_100507862 177
16 3300002462 JGI24702J35022_10018026 JGI24702J35022_100180262 177
17 3300010167 Ga0123353_11013676 Ga0123353_110136762 177
18 3300010882 Ga0123354_10292068 Ga0123354_102920682 177
19 3300042599 Ga0466706_100257 Ga0466706_100257_1635_2204 177
20 3300042608 Ga0466721_197577 Ga0466721_197577_1931_2500 177
21 3300042609 Ga0466722_207658 Ga0466722_207658_2687_3259 177
22 3300042619 Ga0466726_330845 Ga0466726_330845_7047_7601 177
23 3300042636 Ga0466703_113592 Ga0466703_113592_10404_10973 177
24 3300042659 Ga0466733_081875 Ga0466733_081875_3550_4113 177
25 3300002462 JGI24702J35022_10491195 JGI24702J35022_104911951 178
26 3300010167 Ga0123353_11268189 Ga0123353_112681892 178
27 3300042608 Ga0466721_236020 Ga0466721_236020_133_705 178
28 3300000062 IMNBL1DRAFT_c0001368 IMNBL1DRAFT_000136810 179
29 3300002462 JGI24702J35022_10249259 JGI24702J35022_102492592 179
30 3300010049 Ga0123356_10512725 Ga0123356_105127252 179
31 3300010167 Ga0123353_10442274 Ga0123353_104422742 179
32 3300042598 Ga0466701_061027 Ga0466701_061027_332_910 179
33 3300042611 Ga0466697_087784 Ga0466697_087784_2413_2982 179
34 3300042624 Ga0466735_229675 Ga0466735_229675_18_581 179
35 3300002462 JGI24702J35022_10000797 JGI24702J35022_1000079715 180
36 3300042600 Ga0466700_063357 Ga0466700_063357_207_788 180
37 3300042613 Ga0466710_446558 Ga0466710_446558_1100_1678 180
38 3300042659 Ga0466733_105928 Ga0466733_105928_1156_1728 180
39 3300009826 Ga0123355_11045345 Ga0123355_110453452 181
40 3300010167 Ga0123353_11561036 Ga0123353_115610362 181
41 3300010882 Ga0123354_10315928 Ga0123354_103159283 181
42 3300042596 Ga0466696_167331 Ga0466696_167331_3055_3624 181
43 3300042611 Ga0466697_272053 Ga0466697_272053_253_828 181
44 3300042654 Ga0466725_436849 Ga0466725_436849_237_806 181
45 3300002450 JGI24695J34938_10001577 JGI24695J34938_100015779 182
46 3300010167 Ga0123353_12711211 Ga0123353_127112111 182
47 3300042595 Ga0466695_191111 Ga0466695_191111_320_868 182
48 2225789004 2227121377 2227514491 183
49 3300042597 Ga0466699_427203 Ga0466699_427203_600_1175 183
50 3300042604 Ga0466717_286649 Ga0466717_286649_288_839 183
51 3300042610 Ga0466698_338658 Ga0466698_338658_677_1228 183
52 3300042610 Ga0466698_353434 Ga0466698_353434_400_951 183
53 3300042611 Ga0466697_015359 Ga0466697_015359_1511_2062 183
54 3300000062 IMNBL1DRAFT_c0000723 IMNBL1DRAFT_00007236 184
55 3300010049 Ga0123356_10154864 Ga0123356_101548643 184
56 3300010049 Ga0123356_10261169 Ga0123356_102611691 184
57 3300010167 Ga0123353_10207827 Ga0123353_102078274 184
58 3300010167 Ga0123353_10531681 Ga0123353_105316812 184
59 3300010882 Ga0123354_10207447 Ga0123354_102074472 184
60 3300010882 Ga0123354_10391839 Ga0123354_103918391 184
61 3300042582 Ga0466657_198123 Ga0466657_198123_653_1207 184
62 3300042604 Ga0466717_192014 Ga0466717_192014_1562_2155 184
63 3300042613 Ga0466710_128980 Ga0466710_128980_12989_13570 184
64 3300042635 Ga0466702_036872 Ga0466702_036872_131_712 184
65 3300000062 IMNBL1DRAFT_c0008942 IMNBL1DRAFT_00089425 185
66 3300000062 IMNBL1DRAFT_c0021794 IMNBL1DRAFT_00217942 185
67 3300002462 JGI24702J35022_10002625 JGI24702J35022_100026258 185
68 3300002504 JGI24705J35276_12229307 JGI24705J35276_122293073 185
69 3300010049 Ga0123356_10375424 Ga0123356_103754242 185
70 3300010049 Ga0123356_11632309 Ga0123356_116323092 185
71 3300010049 Ga0123356_12365341 Ga0123356_123653411 185
72 3300042550 Ga0466656_189747 Ga0466656_189747_222_779 185
73 3300010167 Ga0123353_10520595 Ga0123353_105205952 186
74 3300042591 Ga0466692_118731 Ga0466692_118731_17827_18402 186
75 3300042659 Ga0466733_016311 Ga0466733_016311_302_862 186
76 3300042619 Ga0466726_271228 Ga0466726_271228_6498_7079 187
77 iso_pr_bacteria 2967483437 2967484516 187
78 iso_pr_bacteria 2967483437 2967484728 187
79 3300002462 JGI24702J35022_10107009 JGI24702J35022_101070092 188
80 3300005201 Ga0072941_1249997 Ga0072941_12499972 188
81 3300010049 Ga0123356_11589558 Ga0123356_115895582 188
82 3300042600 Ga0466700_112181 Ga0466700_112181_69692_70288 188
83 3300042605 Ga0466716_021314 Ga0466716_021314_8058_8624 188
84 iso_pr_bacteria 2820792843 2820794506 188
85 iso_pr_bacteria 2820795054 2820795520 188
86 3300002462 JGI24702J35022_10023256 JGI24702J35022_100232564 189
87 3300010049 Ga0123356_10233439 Ga0123356_102334392 189
88 3300038395 Ga0415639_092667 Ga0415639_092667_3259_3855 189
89 3300042595 Ga0466695_219660 Ga0466695_219660_2002_2571 189
90 3300042613 Ga0466710_226712 Ga0466710_226712_855_1424 189
91 3300042635 Ga0466702_368857 Ga0466702_368857_263_856 189
92 2225789004 2227632951 2228218116 190
93 3300000062 IMNBL1DRAFT_c0002313 IMNBL1DRAFT_00023133 190
94 3300000062 IMNBL1DRAFT_c0038693 IMNBL1DRAFT_00386932 190
95 3300042594 Ga0466694_228186 Ga0466694_228186_460_1068 190
96 3300042622 Ga0466731_284712 Ga0466731_284712_172_744 190
97 3300042624 Ga0466735_099091 Ga0466735_099091_481_1053 190
98 3300042652 Ga0466708_037744 Ga0466708_037744_5438_6010 190
99 3300002462 JGI24702J35022_10007198 JGI24702J35022_100071985 191
100 3300042596 Ga0466696_344053 Ga0466696_344053_3697_4272 191
101 3300042604 Ga0466717_151962 Ga0466717_151962_12_623 191
102 3300042605 Ga0466716_116781 Ga0466716_116781_14863_15438 191
103 3300042609 Ga0466722_241729 Ga0466722_241729_13849_14424 191
104 3300010049 Ga0123356_10019657 Ga0123356_100196574 192
105 3300010049 Ga0123356_10004985 Ga0123356_1000498512 193
106 3300042604 Ga0466717_138615 Ga0466717_138615_219_818 193
107 3300010049 Ga0123356_10090336 Ga0123356_100903362 194
108 3300010049 Ga0123356_10253528 Ga0123356_102535282 196
109 iso_pr_bacteria 2778260935 2778344777 196
110 iso_pr_bacteria 2778260938 2778351207 196
111 3300002450 JGI24695J34938_10001837 JGI24695J34938_100018378 197
112 3300010049 Ga0123356_10143860 Ga0123356_101438602 197
113 iso_pr_bacteria 2820719201 2820720965 199
114 3300010167 Ga0123353_10008811 Ga0123353_100088113 200
115 3300042613 Ga0466710_108039 Ga0466710_108039_1079_1726 204
116 iso_pr_bacteria 2773857778 2774476501 210
117 iso_pr_bacteria 2778260936 2778346522 210

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12837 Fer4_6 4Fe-4S binding domain 141 157 0.93
PF12838 Fer4_7 4Fe-4S dicluster domain 122 158 0.87

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
6m32-assembly1.cif.gz_B Cryo-EM structure of FMO-RC complex from green sulfur bacteria 0.623 63 197
3l09-assembly2.cif.gz_C Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution 0.57 117 146
7z6q-assembly1.cif.gz_B Cryo-EM structure of the whole photosynthetic complex from the green sulfur bacteria 0.563 57 204
6qil-assembly2.cif.gz_C The complex structure of hsRosR-S1 (VNG0258H/RosR-S1) 0.532 113 145
2b0l-assembly1.cif.gz_B-2 C-terminal DNA binding domain of transcriptional pleiotropic repressor CodY. 0.528 126 153
IDDescriptionScoreStartEndSuperfamily
af_A0A0R0E5N2_164_226_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5911 62 194 3.30.70.20
af_Q6YTK0_650_726_1.10.10.580 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Structural maintenance of chromosome 1. Chain E 0.5613 121 146 1.10.10.580
2xv4S01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5462 117 143 1.10.10.10
af_F1QAI9_142_263_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5441 113 144 2.60.40.10
af_K7MPY9_17_285_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.534 125 148 1.10.10.10
IDDescriptionScoreStartEndGO Terms
AF-A0A7X5W0A7-F1-model_v4 Uncharacterized/unreviewed 0.9142 64 204

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.64 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.