Protein Family IF07255
Metagenome
Metatranscriptome
Isolate
170
Members
119
Samples
112
Scaffolds
390.6
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_505461|Ga0466705_505461_4153_5532
- Length
- 459 aa
- Sequence
- MSRYTARPAAPLFPFQEKAFFAAVLYRSKSAGMGIAFYTIGGSVPVISEKTAGALFRHFTKSCRFEGGIRGMCMSHRDAVIVAYGRSAIAKASKKGFLRDNSPVEYGSEVLRGVLARIPQCKPESIGDIVIGCAKPEGVQGMNIGRIIAQRAQLPDSVPGKTVNRFCASGLEAIAIGANEIMSGQAEVLAAGGVESMTAIPMGGGAEYRNLWLESNTHVYMSMGLTAENVAEIYGVTREDMERMAVESNRKAGRAQDDGLFEKEIIPVTGTNEAGEPFSFRLDQGVRRTTTMETLAGLKPSFKEDGRVTAATASQVSDGAAFVVMMSADKAAELNVRPIARFVAYAVAGVPADQMGLGPIRAIPQVMARSGLTIADMDVIELNEAFAAQAIPCIQALGLDPEKVNPRGGALALGHPLGATGGILTCKALSYLQDTGGKYALIAMCIGGGMGAAGIIQAI
Sample Types
Isolate
34.1%
Metagenome
64.7%
MAG
0.0%
Metatranscriptome
1.2%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
16.2%
Unclassified
13.5%
Kalotermitidae
9.0%
Culicidae
6.3%
Tenebrionidae
6.3%
Elmidae
5.4%
Pyralidae
5.4%
Armadillidiidae
5.4%
Ixodidae
4.5%
Drosophilidae
3.6%
Scarabaeidae
3.6%
Rhinotermitidae
2.7%
Bombycidae
1.8%
Argasidae
1.8%
Formicidae
1.8%
Passalidae
1.8%
Coreidae
0.9%
Calliphoridae
0.9%
Euphausiidae
0.9%
Termopsidae
0.9%
Portunidae
0.9%
Crambidae
0.9%
Alydidae
0.9%
Curculionidae
0.9%
Noctuidae
0.9%
Eresidae
0.9%
Ocypodidae
0.9%
Nephropidae
0.9%
Taxonomy
Archaea
0
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 2 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 3 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 4 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 5 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 6 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 10 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 11 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 15 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 16 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 17 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 18 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 19 | 2791354885 | Francisella endosymbiont of Ornithodoros moubata FLE-Om | Isolate | Argasidae |
| 20 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 21 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 26 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 27 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 30 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 31 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 32 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 33 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 37 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 38 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 39 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 40 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 41 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 42 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 43 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 44 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 45 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 50 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 51 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 52 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 53 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 54 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 55 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 58 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 59 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 60 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 61 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 62 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 63 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 64 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 65 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 66 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 67 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 68 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 69 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 72 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 73 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 74 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 75 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 76 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 77 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 78 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 79 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 80 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 81 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 82 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 83 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 84 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 85 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 86 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 87 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 88 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 89 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 90 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 91 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 92 | 2791354884 | Francisella endosymbiont of Amblyomma maculatum FLE-Am | Isolate | Ixodidae |
| 93 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 94 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 95 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 96 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 97 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 98 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 99 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 100 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 101 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 102 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 103 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 104 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 105 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 106 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 107 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 108 | 2788500057 | Francisella-like endosymbiont F-Om | Isolate | Argasidae |
| 109 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 110 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 111 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 112 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 113 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 114 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 115 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 116 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 117 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 118 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 119 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_195957 | 3300042612 | Bacteria | 3263 |
| 2 | Ga0562379_0047 | 3300056790 | Bacteria | 538703 |
| 3 | Ga0160445_100194 | 3300012847 | Bacteria | 46960 |
| 4 | Ga0160457_1001820 | 3300012858 | Unclassified | 5242 |
| 5 | Ga0223674_1015973 | 3300021235 | Bacteria | 1472 |
| 6 | Ga0466657_150388 | 3300042582 | Bacteria | 3463 |
| 7 | Ga0466696_301346 | 3300042596 | Bacteria | 1514 |
| 8 | Ga0123353_10075994 | 3300010167 | Bacteria | 5397 |
| 9 | Ga0063521_1000134 | 3300003973 | Unclassified | 55239 |
| 10 | Ga0104019_1190027 | 3300007150 | Bacteria | 2950 |
| 11 | Ga0103267_1000029 | 3300007190 | Bacteria | 51888 |
| 12 | Ga0466704_044932 | 3300042643 | Bacteria | 41096 |
| 13 | Ga0466710_081347 | 3300042613 | Bacteria | 8616 |
| 14 | Ga0466711_513774 | 3300042615 | Bacteria | 4046 |
| 15 | Ga0562379_0722 | 3300056790 | Bacteria | 55658 |
| 16 | Ga0562378_0086 | 3300056814 | Bacteria | 259059 |
| 17 | Ga0160469_100015 | 3300012824 | Bacteria | 373407 |
| 18 | Ga0160435_1003187 | 3300012857 | Unclassified | 3911 |
| 19 | Ga0466691_110958 | 3300042593 | Bacteria | 1917 |
| 20 | Ga0466696_310832 | 3300042596 | Bacteria | 8722 |
| 21 | Ga0123355_10002033 | 3300009826 | Bacteria | 28590 |
| 22 | Ga0160454_100948 | 3300012798 | Bacteria | 5239 |
| 23 | 2212037346 | 2209111004 | Bacteria | 27738 |
| 24 | Ga0466734_005160 | 3300042623 | Bacteria | 17019 |
| 25 | Ga0466708_216513 | 3300042652 | Bacteria | 29706 |
| 26 | Ga0466725_394629 | 3300042654 | Bacteria | 1498 |
| 27 | Ga0466714_074721 | 3300042603 | Bacteria | 12135 |
| 28 | Ga0466719_349244 | 3300042606 | Bacteria | 9906 |
| 29 | Ga0466722_146381 | 3300042609 | Bacteria | 11216 |
| 30 | Ga0466715_368943 | 3300042616 | Bacteria | 2781 |
| 31 | Ga0466705_021697 | 3300042612 | Bacteria | 9820 |
| 32 | Ga0466705_096757 | 3300042612 | Bacteria | 1710 |
| 33 | Ga0562379_0045 | 3300056790 | Bacteria | 579951 |
| 34 | Ga0562377_0319 | 3300056842 | Unclassified | 96869 |
| 35 | Ga0562377_0358 | 3300056842 | Unclassified | 87064 |
| 36 | Ga0160443_101861 | 3300012848 | Bacteria | 5806 |
| 37 | Ga0160443_101947 | 3300012848 | Bacteria | 5491 |
| 38 | Ga0160457_1001949 | 3300012858 | Bacteria | 4900 |
| 39 | Ga0466693_047554 | 3300042592 | Bacteria | 4831 |
| 40 | Ga0123353_10084770 | 3300010167 | Bacteria | 5101 |
| 41 | Ga0123353_10371265 | 3300010167 | Bacteria | 2145 |
| 42 | Ga0160454_100323 | 3300012798 | Bacteria | 35852 |
| 43 | Ga0160465_100021 | 3300012803 | Bacteria | 245261 |
| 44 | Ga0104050_1199780 | 3300007153 | Bacteria | 3788 |
| 45 | Ga0466707_288518 | 3300042601 | Bacteria | 153363 |
| 46 | Ga0466722_085318 | 3300042609 | Bacteria | 5553 |
| 47 | Ga0466710_081059 | 3300042613 | Bacteria | 6615 |
| 48 | Ga0466726_118718 | 3300042619 | Bacteria | 21537 |
| 49 | Ga0466705_328741 | 3300042612 | Bacteria | 2125 |
| 50 | Ga0466705_368709 | 3300042612 | Unclassified | 2478 |
| 51 | Ga0562376_0127 | 3300056857 | Unclassified | 169220 |
| 52 | Ga0160467_100524 | 3300012829 | Bacteria | 35881 |
| 53 | Ga0160460_100013 | 3300012845 | Bacteria | 460073 |
| 54 | Ga0466693_418660 | 3300042592 | Bacteria | 6766 |
| 55 | Ga0123357_10092066 | 3300009784 | Unclassified | 3945 |
| 56 | Ga0123354_10003410 | 3300010882 | Bacteria | 21911 |
| 57 | Ga0123354_10027319 | 3300010882 | Bacteria | 8992 |
| 58 | IMNBL1DRAFT_c0001550 | 3300000062 | Unclassified | 17156 |
| 59 | Ga0466734_021549 | 3300042623 | Bacteria | 2709 |
| 60 | Ga0466713_088843 | 3300042602 | Bacteria | 126256 |
| 61 | Ga0466717_141392 | 3300042604 | Bacteria | 6085 |
| 62 | Ga0466705_505461 | 3300042612 | Bacteria | 8713 |
| 63 | Ga0466715_079621 | 3300042616 | Bacteria | 17914 |
| 64 | Ga0466715_309330 | 3300042616 | Bacteria | 5953 |
| 65 | Ga0562379_2581 | 3300056790 | Unclassified | 14615 |
| 66 | Ga0562377_0368 | 3300056842 | Unclassified | 85022 |
| 67 | Ga0160472_100003 | 3300012839 | Bacteria | 833437 |
| 68 | Ga0160471_100110 | 3300012812 | Bacteria | 42140 |
| 69 | IMNBL1DRAFT_c0001764 | 3300000062 | Bacteria | 15837 |
| 70 | Ga0466704_385792 | 3300042643 | Bacteria | 4261 |
| 71 | Ga0466725_318275 | 3300042654 | Bacteria | 4964 |
| 72 | Ga0466726_017086 | 3300042619 | Bacteria | 1921 |
| 73 | Ga0466726_091348 | 3300042619 | Bacteria | 2332 |
| 74 | Ga0466728_298051 | 3300042620 | Bacteria | 8122 |
| 75 | Ga0466705_183888 | 3300042612 | Bacteria | 2397 |
| 76 | Ga0530661_000603 | 3300056564 | Bacteria | 24809 |
| 77 | Ga0160453_100645 | 3300012814 | Bacteria | 22109 |
| 78 | Ga0160467_100200 | 3300012829 | Bacteria | 77791 |
| 79 | Ga0466692_021563 | 3300042591 | Bacteria | 4601 |
| 80 | Ga0123355_10013573 | 3300009826 | Unclassified | 12689 |
| 81 | Ga0123353_10096962 | 3300010167 | Bacteria | 4752 |
| 82 | 2227330784 | 2225789004 | Bacteria | 28580 |
| 83 | IMNBL1DRAFT_c0002968 | 3300000062 | Bacteria | 11270 |
| 84 | Ga0466703_189371 | 3300042636 | Bacteria | 13987 |
| 85 | Ga0466705_399879 | 3300042612 | Unclassified | 6812 |
| 86 | Ga0562374_0097 | 3300057007 | Unclassified | 247554 |
| 87 | Ga0160459_103364 | 3300012831 | Bacteria | 2318 |
| 88 | Ga0255809_1027225 | 3300022820 | Bacteria | 2336 |
| 89 | Ga0466657_076860 | 3300042582 | Bacteria | 3270 |
| 90 | JGI24702J35022_10027454 | 3300002462 | Unclassified | 3063 |
| 91 | Ga0466704_184968 | 3300042643 | Unclassified | 13986 |
| 92 | Ga0466708_220316 | 3300042652 | Bacteria | 10870 |
| 93 | Ga0466725_184039 | 3300042654 | Bacteria | 4518 |
| 94 | Ga0466725_285254 | 3300042654 | Bacteria | 86814 |
| 95 | Ga0466701_095618 | 3300042598 | Bacteria | 2161 |
| 96 | Ga0466714_029348 | 3300042603 | Bacteria | 10292 |
| 97 | Ga0466710_275799 | 3300042613 | Bacteria | 39037 |
| 98 | Ga0466729_012060 | 3300042621 | Bacteria | 1421 |
| 99 | Ga0466705_106787 | 3300042612 | Bacteria | 6891 |
| 100 | Ga0160468_100091 | 3300012819 | Unclassified | 107525 |
| 101 | Ga0160448_104873 | 3300012854 | Unclassified | 3630 |
| 102 | Ga0123355_10020773 | 3300009826 | Bacteria | 10496 |
| 103 | Ga0123356_10093122 | 3300010049 | Bacteria | 2875 |
| 104 | 2227594082 | 2225789004 | Unclassified | 12767 |
| 105 | Ga0466730_017026 | 3300042625 | Unclassified | 3789 |
| 106 | Ga0466704_043947 | 3300042643 | Bacteria | 5149 |
| 107 | Ga0466704_099742 | 3300042643 | Bacteria | 4208 |
| 108 | Ga0466704_605906 | 3300042643 | Bacteria | 35044 |
| 109 | Ga0466705_515135 | 3300042612 | Bacteria | 7522 |
| 110 | Ga0466710_347771 | 3300042613 | Unclassified | 1449 |
| 111 | Ga0466715_316170 | 3300042616 | Bacteria | 4238 |
| 112 | Ga0466726_012845 | 3300042619 | Bacteria | 4710 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 8061039349 | 8061040857 | 335 |
| 2 | 3300042602 | Ga0466713_088843 | Ga0466713_088843_99680_100753 | 357 |
| 3 | 3300042612 | Ga0466705_368709 | Ga0466705_368709_966_2126 | 358 |
| 4 | iso_pr_bacteria | 2820014844 | 2820015586 | 358 |
| 5 | 3300042606 | Ga0466719_349244 | Ga0466719_349244_8386_9483 | 365 |
| 6 | 3300042612 | Ga0466705_096757 | Ga0466705_096757_538_1644 | 368 |
| 7 | 3300042596 | Ga0466696_301346 | Ga0466696_301346_377_1489 | 370 |
| 8 | 3300042612 | Ga0466705_106787 | Ga0466705_106787_1105_2253 | 370 |
| 9 | 3300042616 | Ga0466715_368943 | Ga0466715_368943_316_1491 | 370 |
| 10 | 3300000062 | IMNBL1DRAFT_c0002968 | IMNBL1DRAFT_00029688 | 373 |
| 11 | 3300010167 | Ga0123353_10084770 | Ga0123353_100847703 | 373 |
| 12 | 2225789004 | 2227594082 | 2228155626 | 374 |
| 13 | 3300042613 | Ga0466710_347771 | Ga0466710_347771_35_1159 | 374 |
| 14 | 3300000062 | IMNBL1DRAFT_c0001764 | IMNBL1DRAFT_000176412 | 375 |
| 15 | 3300009826 | Ga0123355_10013573 | Ga0123355_100135736 | 376 |
| 16 | 3300042612 | Ga0466705_183888 | Ga0466705_183888_570_1730 | 376 |
| 17 | 3300042619 | Ga0466726_012845 | Ga0466726_012845_62_1201 | 379 |
| 18 | 3300042619 | Ga0466726_118718 | Ga0466726_118718_16574_17758 | 379 |
| 19 | 3300009826 | Ga0123355_10002033 | Ga0123355_1000203313 | 380 |
| 20 | 3300010049 | Ga0123356_10093122 | Ga0123356_100931222 | 381 |
| 21 | 3300010167 | Ga0123353_10096962 | Ga0123353_100969623 | 381 |
| 22 | 3300010882 | Ga0123354_10027319 | Ga0123354_100273193 | 381 |
| 23 | 3300009826 | Ga0123355_10020773 | Ga0123355_100207734 | 382 |
| 24 | 3300042612 | Ga0466705_328741 | Ga0466705_328741_340_1488 | 382 |
| 25 | 3300042636 | Ga0466703_189371 | Ga0466703_189371_914_2062 | 382 |
| 26 | 3300042643 | Ga0466704_605906 | Ga0466704_605906_21154_22302 | 382 |
| 27 | 3300042612 | Ga0466705_195957 | Ga0466705_195957_994_2178 | 383 |
| 28 | 3300042621 | Ga0466729_012060 | Ga0466729_012060_260_1411 | 383 |
| 29 | 3300042596 | Ga0466696_310832 | Ga0466696_310832_4314_5492 | 384 |
| 30 | 3300042652 | Ga0466708_216513 | Ga0466708_216513_4169_5323 | 384 |
| 31 | 3300042616 | Ga0466715_079621 | Ga0466715_079621_9714_10871 | 385 |
| 32 | 3300042603 | Ga0466714_074721 | Ga0466714_074721_8690_9850 | 386 |
| 33 | 3300042643 | Ga0466704_099742 | Ga0466704_099742_2900_4060 | 386 |
| 34 | 3300042643 | Ga0466704_385792 | Ga0466704_385792_119_1300 | 386 |
| 35 | 3300022820 | Ga0255809_1027225 | Ga0255809_10272252 | 387 |
| 36 | 3300042591 | Ga0466692_021563 | Ga0466692_021563_160_1323 | 387 |
| 37 | 3300042609 | Ga0466722_085318 | Ga0466722_085318_3014_4177 | 387 |
| 38 | 3300042619 | Ga0466726_091348 | Ga0466726_091348_834_1997 | 387 |
| 39 | 3300042654 | Ga0466725_394629 | Ga0466725_394629_131_1294 | 387 |
| 40 | iso_pr_bacteria | 2820340373 | 2820341498 | 387 |
| 41 | 2225789004 | 2227330784 | 2227778617 | 388 |
| 42 | 3300042603 | Ga0466714_029348 | Ga0466714_029348_7390_8556 | 388 |
| 43 | 3300042643 | Ga0466704_044932 | Ga0466704_044932_5408_6574 | 388 |
| 44 | 3300042652 | Ga0466708_220316 | Ga0466708_220316_1185_2351 | 388 |
| 45 | 3300000062 | IMNBL1DRAFT_c0001550 | IMNBL1DRAFT_00015506 | 389 |
| 46 | 3300042612 | Ga0466705_021697 | Ga0466705_021697_3382_4551 | 389 |
| 47 | 3300042612 | Ga0466705_399879 | Ga0466705_399879_5452_6621 | 389 |
| 48 | 3300042612 | Ga0466705_515135 | Ga0466705_515135_1298_2467 | 389 |
| 49 | 3300042613 | Ga0466710_275799 | Ga0466710_275799_24037_25206 | 389 |
| 50 | 3300042619 | Ga0466726_017086 | Ga0466726_017086_104_1273 | 389 |
| 51 | 3300042620 | Ga0466728_298051 | Ga0466728_298051_2568_3737 | 389 |
| 52 | 3300042643 | Ga0466704_043947 | Ga0466704_043947_3183_4352 | 389 |
| 53 | 3300042643 | Ga0466704_184968 | Ga0466704_184968_3903_5072 | 389 |
| 54 | 3300042601 | Ga0466707_288518 | Ga0466707_288518_91702_92874 | 390 |
| 55 | 3300042625 | Ga0466730_017026 | Ga0466730_017026_13_1185 | 390 |
| 56 | iso_pr_bacteria | 2524614537 | 2524832632 | 390 |
| 57 | iso_pr_bacteria | 2537562000 | 2539438716 | 390 |
| 58 | iso_pr_bacteria | 2563367190 | 2565787990 | 390 |
| 59 | iso_pr_bacteria | 2751185832 | 2753509709 | 390 |
| 60 | iso_pr_bacteria | 2822232166 | 2822236715 | 390 |
| 61 | iso_pr_bacteria | 2822450720 | 2822452453 | 390 |
| 62 | iso_pr_bacteria | 2843246524 | 2843247590 | 390 |
| 63 | iso_pr_bacteria | 2852123468 | 2852126236 | 390 |
| 64 | iso_pr_bacteria | 2855361764 | 2855364104 | 390 |
| 65 | iso_pr_bacteria | 2864782175 | 2864786767 | 390 |
| 66 | iso_pr_bacteria | 2912849059 | 2912854291 | 390 |
| 67 | iso_pr_bacteria | 2916873227 | 2916878736 | 390 |
| 68 | iso_pr_bacteria | 2969145278 | 2969146094 | 390 |
| 69 | iso_pr_bacteria | 2978778678 | 2978782937 | 390 |
| 70 | iso_pr_bacteria | 643886085 | 644682384 | 390 |
| 71 | iso_pr_bacteria | 643886087 | 644670003 | 390 |
| 72 | iso_pr_bacteria | 643886090 | 644663924 | 390 |
| 73 | iso_pr_bacteria | 643886091 | 644651066 | 390 |
| 74 | iso_pr_bacteria | 8002519755 | 8002521061 | 390 |
| 75 | iso_pr_bacteria | 8022725327 | 8022731292 | 390 |
| 76 | iso_pr_bacteria | 8022781829 | 8022787241 | 390 |
| 77 | iso_pr_bacteria | 8061045771 | 8061047545 | 390 |
| 78 | iso_pr_bacteria | 8061100935 | 8061103015 | 390 |
| 79 | 2209111004 | 2212037346 | 2212063238 | 391 |
| 80 | 3300003973 | Ga0063521_1000134 | Ga0063521_100013410 | 391 |
| 81 | iso_pr_bacteria | 2574180310 | 2576358332 | 391 |
| 82 | iso_pr_bacteria | 2731957677 | 2732687011 | 391 |
| 83 | iso_pr_bacteria | 2767802234 | 2769332021 | 391 |
| 84 | iso_pr_bacteria | 2791355481 | 2794425323 | 391 |
| 85 | iso_pr_bacteria | 2864801025 | 2864801242 | 391 |
| 86 | iso_pr_bacteria | 2864895409 | 2864896209 | 391 |
| 87 | iso_pr_bacteria | 2864909992 | 2864911727 | 391 |
| 88 | iso_pr_bacteria | 2890957088 | 2890957922 | 391 |
| 89 | iso_pr_bacteria | 2916858470 | 2916859669 | 391 |
| 90 | iso_pr_bacteria | 8043041867 | 8043044022 | 391 |
| 91 | iso_pr_bacteria | 8064008355 | 8064009832 | 391 |
| 92 | 3300007150 | Ga0104019_1190027 | Ga0104019_11900272 | 392 |
| 93 | 3300007153 | Ga0104050_1199780 | Ga0104050_11997802 | 392 |
| 94 | 3300012803 | Ga0160465_100021 | Ga0160465_10002126 | 392 |
| 95 | 3300012819 | Ga0160468_100091 | Ga0160468_10009115 | 392 |
| 96 | 3300012829 | Ga0160467_100524 | Ga0160467_1005247 | 392 |
| 97 | 3300012845 | Ga0160460_100013 | Ga0160460_100013270 | 392 |
| 98 | 3300012847 | Ga0160445_100194 | Ga0160445_10019411 | 392 |
| 99 | 3300012848 | Ga0160443_101947 | Ga0160443_1019472 | 392 |
| 100 | 3300012858 | Ga0160457_1001820 | Ga0160457_10018204 | 392 |
| 101 | 3300042582 | Ga0466657_150388 | Ga0466657_150388_1039_2217 | 392 |
| 102 | iso_pr_bacteria | 2852431164 | 2852434596 | 392 |
| 103 | iso_pr_bacteria | 2864816158 | 2864820848 | 392 |
| 104 | iso_pr_bacteria | 2864981449 | 2864985246 | 392 |
| 105 | 3300010167 | Ga0123353_10075994 | Ga0123353_100759943 | 393 |
| 106 | 3300012814 | Ga0160453_100645 | Ga0160453_1006455 | 393 |
| 107 | 3300012824 | Ga0160469_100015 | Ga0160469_100015113 | 393 |
| 108 | 3300012839 | Ga0160472_100003 | Ga0160472_100003376 | 393 |
| 109 | 3300012858 | Ga0160457_1001949 | Ga0160457_10019492 | 393 |
| 110 | 3300042609 | Ga0466722_146381 | Ga0466722_146381_1281_2462 | 393 |
| 111 | iso_pr_bacteria | 2855798354 | 2855799614 | 393 |
| 112 | 3300007190 | Ga0103267_1000029 | Ga0103267_100002917 | 394 |
| 113 | 3300012812 | Ga0160471_100110 | Ga0160471_10011026 | 394 |
| 114 | 3300012829 | Ga0160467_100200 | Ga0160467_10020074 | 394 |
| 115 | 3300012854 | Ga0160448_104873 | Ga0160448_1048733 | 394 |
| 116 | 3300042654 | Ga0466725_184039 | Ga0466725_184039_3173_4357 | 394 |
| 117 | 3300056790 | Ga0562379_0045 | Ga0562379_0045_469021_470205 | 394 |
| 118 | 3300056790 | Ga0562379_0047 | Ga0562379_0047_123313_124497 | 394 |
| 119 | 3300056790 | Ga0562379_2581 | Ga0562379_2581_12161_13345 | 394 |
| 120 | 3300056814 | Ga0562378_0086 | Ga0562378_0086_176556_177740 | 394 |
| 121 | 3300056842 | Ga0562377_0319 | Ga0562377_0319_73626_74810 | 394 |
| 122 | 3300056842 | Ga0562377_0358 | Ga0562377_0358_63678_64862 | 394 |
| 123 | 3300056842 | Ga0562377_0368 | Ga0562377_0368_30181_31365 | 394 |
| 124 | 3300056857 | Ga0562376_0127 | Ga0562376_0127_120652_121836 | 394 |
| 125 | 3300057007 | Ga0562374_0097 | Ga0562374_0097_142537_143721 | 394 |
| 126 | iso_pr_bacteria | 2740892557 | 2743952965 | 394 |
| 127 | 3300012798 | Ga0160454_100323 | Ga0160454_1003235 | 395 |
| 128 | 3300042616 | Ga0466715_316170 | Ga0466715_316170_2334_3521 | 395 |
| 129 | 3300056564 | Ga0530661_000603 | Ga0530661_000603_5261_6448 | 395 |
| 130 | 3300056790 | Ga0562379_0722 | Ga0562379_0722_7625_8812 | 395 |
| 131 | iso_pr_bacteria | 2506210010 | 2506291796 | 395 |
| 132 | iso_pr_bacteria | 2506210015 | 2506301290 | 395 |
| 133 | iso_pr_bacteria | 2788500057 | 2789390869 | 395 |
| 134 | iso_pr_bacteria | 2791354884 | 2791843241 | 395 |
| 135 | iso_pr_bacteria | 2791354885 | 2791845243 | 395 |
| 136 | iso_pr_bacteria | 2820951912 | 2820954196 | 395 |
| 137 | iso_pr_bacteria | 2871564055 | 2871564974 | 395 |
| 138 | iso_pr_bacteria | 2871595141 | 2871596112 | 395 |
| 139 | iso_pr_bacteria | 2874203443 | 2874204354 | 395 |
| 140 | iso_pr_bacteria | 2874209778 | 2874210692 | 395 |
| 141 | iso_pr_bacteria | 637000113 | 638060909 | 395 |
| 142 | iso_pr_bacteria | 8012942269 | 8012943769 | 395 |
| 143 | 3300009784 | Ga0123357_10092066 | Ga0123357_100920662 | 396 |
| 144 | 3300042615 | Ga0466711_513774 | Ga0466711_513774_1968_3158 | 396 |
| 145 | iso_pr_bacteria | 2576861701 | 2579273148 | 396 |
| 146 | 3300042592 | Ga0466693_418660 | Ga0466693_418660_4491_5687 | 398 |
| 147 | iso_pr_bacteria | 2597489944 | 2598056433 | 398 |
| 148 | 3300012798 | Ga0160454_100948 | Ga0160454_1009483 | 399 |
| 149 | 3300012857 | Ga0160435_1003187 | Ga0160435_10031872 | 399 |
| 150 | 3300042623 | Ga0466734_005160 | Ga0466734_005160_1379_2578 | 399 |
| 151 | 3300042623 | Ga0466734_021549 | Ga0466734_021549_1467_2666 | 399 |
| 152 | 3300042654 | Ga0466725_285254 | Ga0466725_285254_2829_4028 | 399 |
| 153 | iso_pr_bacteria | 8102174626 | 8102174994 | 399 |
| 154 | 3300012831 | Ga0160459_103364 | Ga0160459_1033642 | 400 |
| 155 | 3300042582 | Ga0466657_076860 | Ga0466657_076860_619_1824 | 401 |
| 156 | 3300042613 | Ga0466710_081059 | Ga0466710_081059_4403_5608 | 401 |
| 157 | 3300042613 | Ga0466710_081347 | Ga0466710_081347_1551_2759 | 402 |
| 158 | 3300010882 | Ga0123354_10003410 | Ga0123354_100034104 | 403 |
| 159 | 3300012848 | Ga0160443_101861 | Ga0160443_1018612 | 403 |
| 160 | 3300042616 | Ga0466715_309330 | Ga0466715_309330_1801_3021 | 406 |
| 161 | 3300042654 | Ga0466725_318275 | Ga0466725_318275_3348_4568 | 406 |
| 162 | 3300042604 | Ga0466717_141392 | Ga0466717_141392_249_1484 | 411 |
| 163 | 3300021235 | Ga0223674_1015973 | Ga0223674_10159732 | 412 |
| 164 | 3300042592 | Ga0466693_047554 | Ga0466693_047554_160_1398 | 412 |
| 165 | 3300042598 | Ga0466701_095618 | Ga0466701_095618_908_2146 | 412 |
| 166 | iso_pr_bacteria | 2820010479 | 2820012869 | 412 |
| 167 | 3300002462 | JGI24702J35022_10027454 | JGI24702J35022_100274543 | 413 |
| 168 | 3300010167 | Ga0123353_10371265 | Ga0123353_103712652 | 413 |
| 169 | 3300042593 | Ga0466691_110958 | Ga0466691_110958_316_1563 | 415 |
| 170 | 3300042612 | Ga0466705_505461 | Ga0466705_505461_4153_5532 | 459 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02803 | GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.