Protein Family IF07255

Metagenome Metatranscriptome Isolate
170 Members
119 Samples
112 Scaffolds
390.6 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_505461|Ga0466705_505461_4153_5532
Length
459 aa
Sequence
MSRYTARPAAPLFPFQEKAFFAAVLYRSKSAGMGIAFYTIGGSVPVISEKTAGALFRHFTKSCRFEGGIRGMCMSHRDAVIVAYGRSAIAKASKKGFLRDNSPVEYGSEVLRGVLARIPQCKPESIGDIVIGCAKPEGVQGMNIGRIIAQRAQLPDSVPGKTVNRFCASGLEAIAIGANEIMSGQAEVLAAGGVESMTAIPMGGGAEYRNLWLESNTHVYMSMGLTAENVAEIYGVTREDMERMAVESNRKAGRAQDDGLFEKEIIPVTGTNEAGEPFSFRLDQGVRRTTTMETLAGLKPSFKEDGRVTAATASQVSDGAAFVVMMSADKAAELNVRPIARFVAYAVAGVPADQMGLGPIRAIPQVMARSGLTIADMDVIELNEAFAAQAIPCIQALGLDPEKVNPRGGALALGHPLGATGGILTCKALSYLQDTGGKYALIAMCIGGGMGAAGIIQAI

📊 Sample Types

Isolate 34.1%
Metagenome 64.7%
MAG 0.0%
Metatranscriptome 1.2%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 16.2%
Unclassified 13.5%
Kalotermitidae 9.0%
Culicidae 6.3%
Tenebrionidae 6.3%
Elmidae 5.4%
Pyralidae 5.4%
Armadillidiidae 5.4%
Ixodidae 4.5%
Drosophilidae 3.6%
Scarabaeidae 3.6%
Rhinotermitidae 2.7%
Bombycidae 1.8%
Argasidae 1.8%
Formicidae 1.8%
Passalidae 1.8%
Coreidae 0.9%
Calliphoridae 0.9%
Euphausiidae 0.9%
Termopsidae 0.9%
Portunidae 0.9%
Crambidae 0.9%
Alydidae 0.9%
Curculionidae 0.9%
Noctuidae 0.9%
Eresidae 0.9%
Ocypodidae 0.9%
Nephropidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
2 2864909992 Bacillus velezensis S00166 Isolate Elmidae
3 2874209778 Francisella tularensis holarctica FT16C-B1 Isolate Ixodidae
4 2506210010 Francisella tularensis tularensis FSC041 Isolate
5 2506210015 Francisella tularensis holarctica FSC185 Isolate
6 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 637000113 Francisella tularensis tularensis FSC 198 Isolate
10 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
11 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2820951912 Unclassified Acidobacteria Emb289P4bin26 Isolate Unclassified
15 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
16 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
17 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
18 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
19 2791354885 Francisella endosymbiont of Ornithodoros moubata FLE-Om Isolate Argasidae
20 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
21 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
26 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
27 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
30 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
31 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
32 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
33 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
36 2537562000 Bacillus cereus HD73 Isolate Pyralidae
37 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
38 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
39 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
40 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
41 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
42 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
43 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
44 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
45 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
50 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
51 2871564055 Francisella tularensis holarctica FT9C-G7 Isolate Ixodidae
52 2874203443 Francisella tularensis holarctica FT8C-4F Isolate Ixodidae
53 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
54 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
55 2969145278 Bacillus cereus 29 Isolate Portunidae
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
57 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
58 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
59 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
60 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
61 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
62 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
63 8064008355 Heyndrickxia oleronia Isolate Unclassified
64 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
65 2864801025 Bacillus aerius S00042 Isolate Elmidae
66 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
67 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
68 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
69 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
70 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
71 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
72 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
73 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
74 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
75 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
76 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
77 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
78 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
79 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
80 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
81 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
82 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
83 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
84 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
85 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
86 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
87 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
88 2864895409 Bacillus aerius S00152 Isolate Elmidae
89 2916858470 Heyndrickxia oleronia Isolate Unclassified
90 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
91 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
92 2791354884 Francisella endosymbiont of Amblyomma maculatum FLE-Am Isolate Ixodidae
93 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
94 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
95 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
96 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
97 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
98 8022725327 Bacillus sp. SN10 Isolate Eresidae
99 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
100 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
101 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
102 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
103 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
104 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
105 2871595141 Francisella tularensis 503 Isolate Ixodidae
106 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
107 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
108 2788500057 Francisella-like endosymbiont F-Om Isolate Argasidae
109 2978778678 Bacillus cereus 25 Isolate Ocypodidae
110 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
111 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
112 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
113 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
114 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
115 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
116 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
117 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
118 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
119 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_195957 3300042612 Bacteria 3263
2 Ga0562379_0047 3300056790 Bacteria 538703
3 Ga0160445_100194 3300012847 Bacteria 46960
4 Ga0160457_1001820 3300012858 Unclassified 5242
5 Ga0223674_1015973 3300021235 Bacteria 1472
6 Ga0466657_150388 3300042582 Bacteria 3463
7 Ga0466696_301346 3300042596 Bacteria 1514
8 Ga0123353_10075994 3300010167 Bacteria 5397
9 Ga0063521_1000134 3300003973 Unclassified 55239
10 Ga0104019_1190027 3300007150 Bacteria 2950
11 Ga0103267_1000029 3300007190 Bacteria 51888
12 Ga0466704_044932 3300042643 Bacteria 41096
13 Ga0466710_081347 3300042613 Bacteria 8616
14 Ga0466711_513774 3300042615 Bacteria 4046
15 Ga0562379_0722 3300056790 Bacteria 55658
16 Ga0562378_0086 3300056814 Bacteria 259059
17 Ga0160469_100015 3300012824 Bacteria 373407
18 Ga0160435_1003187 3300012857 Unclassified 3911
19 Ga0466691_110958 3300042593 Bacteria 1917
20 Ga0466696_310832 3300042596 Bacteria 8722
21 Ga0123355_10002033 3300009826 Bacteria 28590
22 Ga0160454_100948 3300012798 Bacteria 5239
23 2212037346 2209111004 Bacteria 27738
24 Ga0466734_005160 3300042623 Bacteria 17019
25 Ga0466708_216513 3300042652 Bacteria 29706
26 Ga0466725_394629 3300042654 Bacteria 1498
27 Ga0466714_074721 3300042603 Bacteria 12135
28 Ga0466719_349244 3300042606 Bacteria 9906
29 Ga0466722_146381 3300042609 Bacteria 11216
30 Ga0466715_368943 3300042616 Bacteria 2781
31 Ga0466705_021697 3300042612 Bacteria 9820
32 Ga0466705_096757 3300042612 Bacteria 1710
33 Ga0562379_0045 3300056790 Bacteria 579951
34 Ga0562377_0319 3300056842 Unclassified 96869
35 Ga0562377_0358 3300056842 Unclassified 87064
36 Ga0160443_101861 3300012848 Bacteria 5806
37 Ga0160443_101947 3300012848 Bacteria 5491
38 Ga0160457_1001949 3300012858 Bacteria 4900
39 Ga0466693_047554 3300042592 Bacteria 4831
40 Ga0123353_10084770 3300010167 Bacteria 5101
41 Ga0123353_10371265 3300010167 Bacteria 2145
42 Ga0160454_100323 3300012798 Bacteria 35852
43 Ga0160465_100021 3300012803 Bacteria 245261
44 Ga0104050_1199780 3300007153 Bacteria 3788
45 Ga0466707_288518 3300042601 Bacteria 153363
46 Ga0466722_085318 3300042609 Bacteria 5553
47 Ga0466710_081059 3300042613 Bacteria 6615
48 Ga0466726_118718 3300042619 Bacteria 21537
49 Ga0466705_328741 3300042612 Bacteria 2125
50 Ga0466705_368709 3300042612 Unclassified 2478
51 Ga0562376_0127 3300056857 Unclassified 169220
52 Ga0160467_100524 3300012829 Bacteria 35881
53 Ga0160460_100013 3300012845 Bacteria 460073
54 Ga0466693_418660 3300042592 Bacteria 6766
55 Ga0123357_10092066 3300009784 Unclassified 3945
56 Ga0123354_10003410 3300010882 Bacteria 21911
57 Ga0123354_10027319 3300010882 Bacteria 8992
58 IMNBL1DRAFT_c0001550 3300000062 Unclassified 17156
59 Ga0466734_021549 3300042623 Bacteria 2709
60 Ga0466713_088843 3300042602 Bacteria 126256
61 Ga0466717_141392 3300042604 Bacteria 6085
62 Ga0466705_505461 3300042612 Bacteria 8713
63 Ga0466715_079621 3300042616 Bacteria 17914
64 Ga0466715_309330 3300042616 Bacteria 5953
65 Ga0562379_2581 3300056790 Unclassified 14615
66 Ga0562377_0368 3300056842 Unclassified 85022
67 Ga0160472_100003 3300012839 Bacteria 833437
68 Ga0160471_100110 3300012812 Bacteria 42140
69 IMNBL1DRAFT_c0001764 3300000062 Bacteria 15837
70 Ga0466704_385792 3300042643 Bacteria 4261
71 Ga0466725_318275 3300042654 Bacteria 4964
72 Ga0466726_017086 3300042619 Bacteria 1921
73 Ga0466726_091348 3300042619 Bacteria 2332
74 Ga0466728_298051 3300042620 Bacteria 8122
75 Ga0466705_183888 3300042612 Bacteria 2397
76 Ga0530661_000603 3300056564 Bacteria 24809
77 Ga0160453_100645 3300012814 Bacteria 22109
78 Ga0160467_100200 3300012829 Bacteria 77791
79 Ga0466692_021563 3300042591 Bacteria 4601
80 Ga0123355_10013573 3300009826 Unclassified 12689
81 Ga0123353_10096962 3300010167 Bacteria 4752
82 2227330784 2225789004 Bacteria 28580
83 IMNBL1DRAFT_c0002968 3300000062 Bacteria 11270
84 Ga0466703_189371 3300042636 Bacteria 13987
85 Ga0466705_399879 3300042612 Unclassified 6812
86 Ga0562374_0097 3300057007 Unclassified 247554
87 Ga0160459_103364 3300012831 Bacteria 2318
88 Ga0255809_1027225 3300022820 Bacteria 2336
89 Ga0466657_076860 3300042582 Bacteria 3270
90 JGI24702J35022_10027454 3300002462 Unclassified 3063
91 Ga0466704_184968 3300042643 Unclassified 13986
92 Ga0466708_220316 3300042652 Bacteria 10870
93 Ga0466725_184039 3300042654 Bacteria 4518
94 Ga0466725_285254 3300042654 Bacteria 86814
95 Ga0466701_095618 3300042598 Bacteria 2161
96 Ga0466714_029348 3300042603 Bacteria 10292
97 Ga0466710_275799 3300042613 Bacteria 39037
98 Ga0466729_012060 3300042621 Bacteria 1421
99 Ga0466705_106787 3300042612 Bacteria 6891
100 Ga0160468_100091 3300012819 Unclassified 107525
101 Ga0160448_104873 3300012854 Unclassified 3630
102 Ga0123355_10020773 3300009826 Bacteria 10496
103 Ga0123356_10093122 3300010049 Bacteria 2875
104 2227594082 2225789004 Unclassified 12767
105 Ga0466730_017026 3300042625 Unclassified 3789
106 Ga0466704_043947 3300042643 Bacteria 5149
107 Ga0466704_099742 3300042643 Bacteria 4208
108 Ga0466704_605906 3300042643 Bacteria 35044
109 Ga0466705_515135 3300042612 Bacteria 7522
110 Ga0466710_347771 3300042613 Unclassified 1449
111 Ga0466715_316170 3300042616 Bacteria 4238
112 Ga0466726_012845 3300042619 Bacteria 4710

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 8061039349 8061040857 335
2 3300042602 Ga0466713_088843 Ga0466713_088843_99680_100753 357
3 3300042612 Ga0466705_368709 Ga0466705_368709_966_2126 358
4 iso_pr_bacteria 2820014844 2820015586 358
5 3300042606 Ga0466719_349244 Ga0466719_349244_8386_9483 365
6 3300042612 Ga0466705_096757 Ga0466705_096757_538_1644 368
7 3300042596 Ga0466696_301346 Ga0466696_301346_377_1489 370
8 3300042612 Ga0466705_106787 Ga0466705_106787_1105_2253 370
9 3300042616 Ga0466715_368943 Ga0466715_368943_316_1491 370
10 3300000062 IMNBL1DRAFT_c0002968 IMNBL1DRAFT_00029688 373
11 3300010167 Ga0123353_10084770 Ga0123353_100847703 373
12 2225789004 2227594082 2228155626 374
13 3300042613 Ga0466710_347771 Ga0466710_347771_35_1159 374
14 3300000062 IMNBL1DRAFT_c0001764 IMNBL1DRAFT_000176412 375
15 3300009826 Ga0123355_10013573 Ga0123355_100135736 376
16 3300042612 Ga0466705_183888 Ga0466705_183888_570_1730 376
17 3300042619 Ga0466726_012845 Ga0466726_012845_62_1201 379
18 3300042619 Ga0466726_118718 Ga0466726_118718_16574_17758 379
19 3300009826 Ga0123355_10002033 Ga0123355_1000203313 380
20 3300010049 Ga0123356_10093122 Ga0123356_100931222 381
21 3300010167 Ga0123353_10096962 Ga0123353_100969623 381
22 3300010882 Ga0123354_10027319 Ga0123354_100273193 381
23 3300009826 Ga0123355_10020773 Ga0123355_100207734 382
24 3300042612 Ga0466705_328741 Ga0466705_328741_340_1488 382
25 3300042636 Ga0466703_189371 Ga0466703_189371_914_2062 382
26 3300042643 Ga0466704_605906 Ga0466704_605906_21154_22302 382
27 3300042612 Ga0466705_195957 Ga0466705_195957_994_2178 383
28 3300042621 Ga0466729_012060 Ga0466729_012060_260_1411 383
29 3300042596 Ga0466696_310832 Ga0466696_310832_4314_5492 384
30 3300042652 Ga0466708_216513 Ga0466708_216513_4169_5323 384
31 3300042616 Ga0466715_079621 Ga0466715_079621_9714_10871 385
32 3300042603 Ga0466714_074721 Ga0466714_074721_8690_9850 386
33 3300042643 Ga0466704_099742 Ga0466704_099742_2900_4060 386
34 3300042643 Ga0466704_385792 Ga0466704_385792_119_1300 386
35 3300022820 Ga0255809_1027225 Ga0255809_10272252 387
36 3300042591 Ga0466692_021563 Ga0466692_021563_160_1323 387
37 3300042609 Ga0466722_085318 Ga0466722_085318_3014_4177 387
38 3300042619 Ga0466726_091348 Ga0466726_091348_834_1997 387
39 3300042654 Ga0466725_394629 Ga0466725_394629_131_1294 387
40 iso_pr_bacteria 2820340373 2820341498 387
41 2225789004 2227330784 2227778617 388
42 3300042603 Ga0466714_029348 Ga0466714_029348_7390_8556 388
43 3300042643 Ga0466704_044932 Ga0466704_044932_5408_6574 388
44 3300042652 Ga0466708_220316 Ga0466708_220316_1185_2351 388
45 3300000062 IMNBL1DRAFT_c0001550 IMNBL1DRAFT_00015506 389
46 3300042612 Ga0466705_021697 Ga0466705_021697_3382_4551 389
47 3300042612 Ga0466705_399879 Ga0466705_399879_5452_6621 389
48 3300042612 Ga0466705_515135 Ga0466705_515135_1298_2467 389
49 3300042613 Ga0466710_275799 Ga0466710_275799_24037_25206 389
50 3300042619 Ga0466726_017086 Ga0466726_017086_104_1273 389
51 3300042620 Ga0466728_298051 Ga0466728_298051_2568_3737 389
52 3300042643 Ga0466704_043947 Ga0466704_043947_3183_4352 389
53 3300042643 Ga0466704_184968 Ga0466704_184968_3903_5072 389
54 3300042601 Ga0466707_288518 Ga0466707_288518_91702_92874 390
55 3300042625 Ga0466730_017026 Ga0466730_017026_13_1185 390
56 iso_pr_bacteria 2524614537 2524832632 390
57 iso_pr_bacteria 2537562000 2539438716 390
58 iso_pr_bacteria 2563367190 2565787990 390
59 iso_pr_bacteria 2751185832 2753509709 390
60 iso_pr_bacteria 2822232166 2822236715 390
61 iso_pr_bacteria 2822450720 2822452453 390
62 iso_pr_bacteria 2843246524 2843247590 390
63 iso_pr_bacteria 2852123468 2852126236 390
64 iso_pr_bacteria 2855361764 2855364104 390
65 iso_pr_bacteria 2864782175 2864786767 390
66 iso_pr_bacteria 2912849059 2912854291 390
67 iso_pr_bacteria 2916873227 2916878736 390
68 iso_pr_bacteria 2969145278 2969146094 390
69 iso_pr_bacteria 2978778678 2978782937 390
70 iso_pr_bacteria 643886085 644682384 390
71 iso_pr_bacteria 643886087 644670003 390
72 iso_pr_bacteria 643886090 644663924 390
73 iso_pr_bacteria 643886091 644651066 390
74 iso_pr_bacteria 8002519755 8002521061 390
75 iso_pr_bacteria 8022725327 8022731292 390
76 iso_pr_bacteria 8022781829 8022787241 390
77 iso_pr_bacteria 8061045771 8061047545 390
78 iso_pr_bacteria 8061100935 8061103015 390
79 2209111004 2212037346 2212063238 391
80 3300003973 Ga0063521_1000134 Ga0063521_100013410 391
81 iso_pr_bacteria 2574180310 2576358332 391
82 iso_pr_bacteria 2731957677 2732687011 391
83 iso_pr_bacteria 2767802234 2769332021 391
84 iso_pr_bacteria 2791355481 2794425323 391
85 iso_pr_bacteria 2864801025 2864801242 391
86 iso_pr_bacteria 2864895409 2864896209 391
87 iso_pr_bacteria 2864909992 2864911727 391
88 iso_pr_bacteria 2890957088 2890957922 391
89 iso_pr_bacteria 2916858470 2916859669 391
90 iso_pr_bacteria 8043041867 8043044022 391
91 iso_pr_bacteria 8064008355 8064009832 391
92 3300007150 Ga0104019_1190027 Ga0104019_11900272 392
93 3300007153 Ga0104050_1199780 Ga0104050_11997802 392
94 3300012803 Ga0160465_100021 Ga0160465_10002126 392
95 3300012819 Ga0160468_100091 Ga0160468_10009115 392
96 3300012829 Ga0160467_100524 Ga0160467_1005247 392
97 3300012845 Ga0160460_100013 Ga0160460_100013270 392
98 3300012847 Ga0160445_100194 Ga0160445_10019411 392
99 3300012848 Ga0160443_101947 Ga0160443_1019472 392
100 3300012858 Ga0160457_1001820 Ga0160457_10018204 392
101 3300042582 Ga0466657_150388 Ga0466657_150388_1039_2217 392
102 iso_pr_bacteria 2852431164 2852434596 392
103 iso_pr_bacteria 2864816158 2864820848 392
104 iso_pr_bacteria 2864981449 2864985246 392
105 3300010167 Ga0123353_10075994 Ga0123353_100759943 393
106 3300012814 Ga0160453_100645 Ga0160453_1006455 393
107 3300012824 Ga0160469_100015 Ga0160469_100015113 393
108 3300012839 Ga0160472_100003 Ga0160472_100003376 393
109 3300012858 Ga0160457_1001949 Ga0160457_10019492 393
110 3300042609 Ga0466722_146381 Ga0466722_146381_1281_2462 393
111 iso_pr_bacteria 2855798354 2855799614 393
112 3300007190 Ga0103267_1000029 Ga0103267_100002917 394
113 3300012812 Ga0160471_100110 Ga0160471_10011026 394
114 3300012829 Ga0160467_100200 Ga0160467_10020074 394
115 3300012854 Ga0160448_104873 Ga0160448_1048733 394
116 3300042654 Ga0466725_184039 Ga0466725_184039_3173_4357 394
117 3300056790 Ga0562379_0045 Ga0562379_0045_469021_470205 394
118 3300056790 Ga0562379_0047 Ga0562379_0047_123313_124497 394
119 3300056790 Ga0562379_2581 Ga0562379_2581_12161_13345 394
120 3300056814 Ga0562378_0086 Ga0562378_0086_176556_177740 394
121 3300056842 Ga0562377_0319 Ga0562377_0319_73626_74810 394
122 3300056842 Ga0562377_0358 Ga0562377_0358_63678_64862 394
123 3300056842 Ga0562377_0368 Ga0562377_0368_30181_31365 394
124 3300056857 Ga0562376_0127 Ga0562376_0127_120652_121836 394
125 3300057007 Ga0562374_0097 Ga0562374_0097_142537_143721 394
126 iso_pr_bacteria 2740892557 2743952965 394
127 3300012798 Ga0160454_100323 Ga0160454_1003235 395
128 3300042616 Ga0466715_316170 Ga0466715_316170_2334_3521 395
129 3300056564 Ga0530661_000603 Ga0530661_000603_5261_6448 395
130 3300056790 Ga0562379_0722 Ga0562379_0722_7625_8812 395
131 iso_pr_bacteria 2506210010 2506291796 395
132 iso_pr_bacteria 2506210015 2506301290 395
133 iso_pr_bacteria 2788500057 2789390869 395
134 iso_pr_bacteria 2791354884 2791843241 395
135 iso_pr_bacteria 2791354885 2791845243 395
136 iso_pr_bacteria 2820951912 2820954196 395
137 iso_pr_bacteria 2871564055 2871564974 395
138 iso_pr_bacteria 2871595141 2871596112 395
139 iso_pr_bacteria 2874203443 2874204354 395
140 iso_pr_bacteria 2874209778 2874210692 395
141 iso_pr_bacteria 637000113 638060909 395
142 iso_pr_bacteria 8012942269 8012943769 395
143 3300009784 Ga0123357_10092066 Ga0123357_100920662 396
144 3300042615 Ga0466711_513774 Ga0466711_513774_1968_3158 396
145 iso_pr_bacteria 2576861701 2579273148 396
146 3300042592 Ga0466693_418660 Ga0466693_418660_4491_5687 398
147 iso_pr_bacteria 2597489944 2598056433 398
148 3300012798 Ga0160454_100948 Ga0160454_1009483 399
149 3300012857 Ga0160435_1003187 Ga0160435_10031872 399
150 3300042623 Ga0466734_005160 Ga0466734_005160_1379_2578 399
151 3300042623 Ga0466734_021549 Ga0466734_021549_1467_2666 399
152 3300042654 Ga0466725_285254 Ga0466725_285254_2829_4028 399
153 iso_pr_bacteria 8102174626 8102174994 399
154 3300012831 Ga0160459_103364 Ga0160459_1033642 400
155 3300042582 Ga0466657_076860 Ga0466657_076860_619_1824 401
156 3300042613 Ga0466710_081059 Ga0466710_081059_4403_5608 401
157 3300042613 Ga0466710_081347 Ga0466710_081347_1551_2759 402
158 3300010882 Ga0123354_10003410 Ga0123354_100034104 403
159 3300012848 Ga0160443_101861 Ga0160443_1018612 403
160 3300042616 Ga0466715_309330 Ga0466715_309330_1801_3021 406
161 3300042654 Ga0466725_318275 Ga0466725_318275_3348_4568 406
162 3300042604 Ga0466717_141392 Ga0466717_141392_249_1484 411
163 3300021235 Ga0223674_1015973 Ga0223674_10159732 412
164 3300042592 Ga0466693_047554 Ga0466693_047554_160_1398 412
165 3300042598 Ga0466701_095618 Ga0466701_095618_908_2146 412
166 iso_pr_bacteria 2820010479 2820012869 412
167 3300002462 JGI24702J35022_10027454 JGI24702J35022_100274543 413
168 3300010167 Ga0123353_10371265 Ga0123353_103712652 413
169 3300042593 Ga0466691_110958 Ga0466691_110958_316_1563 415
170 3300042612 Ga0466705_505461 Ga0466705_505461_4153_5532 459

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02803 Thiolase_C Thiolase, C-terminal domain 337 457 0.98
PF00108 Thiolase_N Thiolase, N-terminal domain 80 328 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02803 GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.