Protein Family IF07253

Metagenome Isolate
152 Members
71 Samples
132 Scaffolds
211.07 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_500146|Ga0466705_500146_303_1070
Length
255 aa
Sequence
MIICSEDTLIKGILSSEQQSPLKYGGANFELSPPVPDRPRRFDMEELKPRERQILEFMKVQIARKGYPPTVREINAALGIKSTSTTHKDIERLENKGYIRKDPSKPRAIMIIDPSGSGPAGNVSADRHDIVEIPLVGRIAAGEPITSEQNIEEFVPVPAAYVKGENFMLKVQGDSMVDAGIFNGDLILVRQQQTADNGDIVVAMIDGFENEATVKTFYKEDGHIRLQPQNSTMSPIIVNDVTVLGKVRGVFRYLS

📊 Sample Types

Isolate 13.2%
Metagenome 86.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 20.3%
Unclassified 17.4%
Blattidae 14.5%
Passalidae 4.3%
Termopsidae 4.3%
Rhinotermitidae 2.9%
Tenebrionidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
3 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
4 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
5 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
6 2820811576 Unclassified Actinobacteria Nt197P3bin53 Isolate Unclassified
7 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
8 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
9 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
18 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
19 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
20 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
21 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
22 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
23 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
26 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
27 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
30 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
31 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
32 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
33 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
40 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
41 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
42 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
43 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
44 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
47 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
53 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
54 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
55 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
58 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
59 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
60 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
61 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
62 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
63 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
64 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
65 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
66 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
67 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
68 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
69 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
70 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
71 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_196764 3300042612 Bacteria 1275
2 Ga0466733_195460 3300042659 Bacteria 4621
3 Ga0466726_428673 3300042619 Unclassified 1323
4 Ga0466692_036918 3300042591 Bacteria 18026
5 Ga0466696_170012 3300042596 Bacteria 1937
6 Ga0466707_083431 3300042601 Bacteria 3950
7 Ga0466721_136209 3300042608 Bacteria 77160
8 Ga0466731_331742 3300042622 Bacteria 1521
9 Ga0466734_071243 3300042623 Bacteria 1375
10 Ga0466704_173376 3300042643 Bacteria 1825
11 Ga0466708_206315 3300042652 Bacteria 7379
12 Ga0466725_056529 3300042654 Bacteria 1104
13 2227253035 2225789004 Bacteria 7079
14 JGI24702J35022_10043935 3300002462 Bacteria 2381
15 Ga0466715_343745 3300042616 Bacteria 5548
16 Ga0466728_053668 3300042620 Bacteria 5426
17 Ga0123356_10500742 3300010049 Bacteria 1371
18 Ga0466692_065539 3300042591 Bacteria 30371
19 Ga0466691_083359 3300042593 Bacteria 22144
20 Ga0466700_185234 3300042600 Bacteria 1054
21 Ga0466707_165872 3300042601 Bacteria 1163
22 Ga0466713_033410 3300042602 Bacteria 35675
23 Ga0466716_058274 3300042605 Bacteria 5057
24 Ga0466716_126932 3300042605 Bacteria 45619
25 Ga0466719_056357 3300042606 Bacteria 10518
26 Ga0466704_106790 3300042643 Bacteria 2227
27 Ga0466709_366025 3300042648 Bacteria 5022
28 Ga0466727_261360 3300042655 Bacteria 1561
29 2226991482 2225789003 Bacteria 7230
30 2227187742 2225789004 Bacteria 1475
31 2227646837 2225789004 Bacteria 42193
32 Ga0466705_092012 3300042612 Bacteria 1261
33 Ga0466733_114121 3300042659 Bacteria 9996
34 Ga0466705_500146 3300042612 Bacteria 1248
35 Ga0466728_064481 3300042620 Bacteria 3099
36 Ga0466728_102679 3300042620 Bacteria 9345
37 Ga0123355_10050113 3300009826 Bacteria 6786
38 Ga0123354_10207698 3300010882 Unclassified 2128
39 Ga0123354_10244536 3300010882 Bacteria 1836
40 Ga0466692_189411 3300042591 Bacteria 8875
41 Ga0466706_107682 3300042599 Unclassified 3062
42 Ga0466707_375862 3300042601 Bacteria 6650
43 Ga0466713_054165 3300042602 Bacteria 4722
44 Ga0466714_059644 3300042603 Bacteria 29769
45 Ga0466717_277218 3300042604 Bacteria 3013
46 Ga0466719_511311 3300042606 Bacteria 1213
47 Ga0466703_221949 3300042636 Bacteria 1133
48 Ga0466727_278491 3300042655 Unclassified 5406
49 Ga0068302_10431661 3300005071 Bacteria 1092
50 Ga0123355_10530573 3300009826 Bacteria 1434
51 Ga0123354_10090553 3300010882 Bacteria 4234
52 Ga0123354_10115361 3300010882 Bacteria 3511
53 Ga0466694_154991 3300042594 Bacteria 2733
54 Ga0466696_005815 3300042596 Bacteria 8413
55 Ga0466706_071567 3300042599 Bacteria 8783
56 Ga0466713_049964 3300042602 Bacteria 10595
57 Ga0466719_055643 3300042606 Bacteria 1660
58 Ga0466719_276360 3300042606 Bacteria 4066
59 Ga0466704_115834 3300042643 Bacteria 49579
60 Ga0466724_55877 3300042649 Bacteria 4568
61 Ga0466708_134911 3300042652 Bacteria 1058
62 Ga0466708_237126 3300042652 Bacteria 17704
63 Ga0466725_061025 3300042654 Bacteria 1425
64 JGI24705J35276_12188727 3300002504 Bacteria 1444
65 Ga0466705_180877 3300042612 Bacteria 10314
66 Ga0466715_461326 3300042616 Bacteria 4073
67 Ga0466723_232922 3300042618 Bacteria 8946
68 Ga0466707_404385 3300042601 Bacteria 5608
69 Ga0466707_420054 3300042601 Bacteria 2046
70 Ga0466716_280595 3300042605 Bacteria 1053
71 Ga0466722_080045 3300042609 Bacteria 3495
72 Ga0466708_131412 3300042652 Bacteria 35296
73 IMNBL1DRAFT_c0000324 3300000062 Bacteria 40656
74 Ga0072941_1432099 3300005201 Bacteria 3401
75 Ga0466705_505278 3300042612 Bacteria 6125
76 Ga0123355_10098945 3300009826 Bacteria 4598
77 Ga0123353_10051406 3300010167 Bacteria 6576
78 Ga0123353_10200950 3300010167 Bacteria 3136
79 Ga0123353_10408881 3300010167 Bacteria 2016
80 Ga0123353_11359580 3300010167 Bacteria 917
81 Ga0466701_011001 3300042598 Bacteria 1270
82 Ga0466707_020353 3300042601 Bacteria 1778
83 Ga0466707_097664 3300042601 Bacteria 1068
84 Ga0466713_083672 3300042602 Bacteria 2259
85 Ga0466713_146655 3300042602 Unclassified 2648
86 Ga0466719_389882 3300042606 Bacteria 4071
87 Ga0466734_100908 3300042623 Bacteria 2074
88 Ga0466703_334577 3300042636 Bacteria 15759
89 Ga0466708_002088 3300042652 Bacteria 4158
90 Ga0466708_173241 3300042652 Bacteria 6534
91 2227358543 2225789004 Bacteria 130700
92 IMNBL1DRAFT_c0000006 3300000062 Bacteria 247403
93 IMNBL1DRAFT_c0019963 3300000062 Unclassified 2727
94 IMNBL1DRAFT_c0028895 3300000062 Bacteria 2060
95 JGI24705J35276_12238294 3300002504 Bacteria 18750
96 Ga0072941_1223334 3300005201 Bacteria 989
97 Ga0562377_0006 3300056842 Bacteria 3350072
98 Ga0466710_150753 3300042613 Bacteria 1043
99 Ga0466728_105263 3300042620 Bacteria 3329
100 Ga0466728_286612 3300042620 Bacteria 1897
101 Ga0123353_10031843 3300010167 Bacteria 8178
102 Ga0123353_11412638 3300010167 Bacteria 894
103 Ga0123354_10065467 3300010882 Bacteria 5317
104 Ga0160452_110396 3300012834 Bacteria 1135
105 Ga0466691_017695 3300042593 Bacteria 6083
106 Ga0466706_021009 3300042599 Bacteria 55440
107 Ga0466713_052392 3300042602 Bacteria 216200
108 Ga0466717_114107 3300042604 Bacteria 5697
109 Ga0466702_243435 3300042635 Bacteria 3318
110 2227330786 2225789004 Bacteria 28531
111 IMNBL1DRAFT_c0049400 3300000062 Bacteria 1342
112 JGI24695J34938_10004017 3300002450 Bacteria 9894
113 Ga0466697_107487 3300042611 Bacteria 17354
114 Ga0466705_261139 3300042612 Bacteria 2139
115 Ga0466733_004107 3300042659 Bacteria 5547
116 Ga0466711_096199 3300042615 Bacteria 8415
117 Ga0466711_152227 3300042615 Bacteria 1580
118 Ga0466723_002457 3300042618 Bacteria 13923
119 Ga0123357_10040528 3300009784 Bacteria 6332
120 Ga0123356_10158205 3300010049 Bacteria 2259
121 Ga0123356_10867195 3300010049 Bacteria 1074
122 Ga0123353_10080306 3300010167 Bacteria 5245
123 Ga0123353_10162708 3300010167 Bacteria 3551
124 Ga0466690_012691 3300042590 Bacteria 4011
125 Ga0466690_390444 3300042590 Bacteria 1506
126 Ga0466696_334121 3300042596 Bacteria 8833
127 Ga0466706_233135 3300042599 Bacteria 4873
128 Ga0466707_327496 3300042601 Bacteria 7172
129 Ga0466697_042908 3300042611 Bacteria 2317
130 Ga0466704_566009 3300042643 Unclassified 7342
131 JGI24703J35330_11560415 3300002501 Bacteria 1251
132 Ga0072941_1720106 3300005201 Bacteria 896

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_012691 Ga0466690_012691_1790_2401 203
2 3300042593 Ga0466691_017695 Ga0466691_017695_2241_2852 203
3 3300042593 Ga0466691_083359 Ga0466691_083359_7775_8386 203
4 3300042596 Ga0466696_005815 Ga0466696_005815_4235_4846 203
5 3300042596 Ga0466696_170012 Ga0466696_170012_927_1538 203
6 3300042605 Ga0466716_126932 Ga0466716_126932_7119_7730 203
7 3300042612 Ga0466705_505278 Ga0466705_505278_1799_2410 203
8 3300042618 Ga0466723_232922 Ga0466723_232922_5141_5752 203
9 3300042620 Ga0466728_053668 Ga0466728_053668_1248_1859 203
10 3300042620 Ga0466728_064481 Ga0466728_064481_1248_1859 203
11 3300042620 Ga0466728_102679 Ga0466728_102679_2019_2630 203
12 3300042643 Ga0466704_173376 Ga0466704_173376_17_628 203
13 3300042652 Ga0466708_002088 Ga0466708_002088_3024_3635 203
14 3300042652 Ga0466708_134911 Ga0466708_134911_424_1035 203
15 3300042652 Ga0466708_237126 Ga0466708_237126_8471_9082 203
16 3300042635 Ga0466702_243435 Ga0466702_243435_2588_3202 204
17 3300042652 Ga0466708_173241 Ga0466708_173241_5068_5682 204
18 3300042652 Ga0466708_206315 Ga0466708_206315_5694_6308 204
19 3300042659 Ga0466733_004107 Ga0466733_004107_3882_4496 204
20 iso_pr_bacteria 2820492969 2820493391 204
21 2225789004 2227358543 2227803548 205
22 2225789004 2227646837 2228240131 205
23 3300002501 JGI24703J35330_11560415 JGI24703J35330_115604151 205
24 3300012834 Ga0160452_110396 Ga0160452_1103962 205
25 3300042599 Ga0466706_021009 Ga0466706_021009_46554_47171 205
26 3300042605 Ga0466716_058274 Ga0466716_058274_687_1304 205
27 3300042606 Ga0466719_056357 Ga0466719_056357_9546_10163 205
28 3300042608 Ga0466721_136209 Ga0466721_136209_73445_74062 205
29 3300042659 Ga0466733_114121 Ga0466733_114121_6872_7489 205
30 iso_pr_bacteria 2820277137 2820279028 205
31 iso_pr_bacteria 2820507989 2820509381 205
32 iso_pr_bacteria 2820688768 2820688914 205
33 iso_pr_bacteria 2940230426 2940231251 205
34 iso_pr_bacteria 2940233634 2940234456 205
35 iso_pr_bacteria 2940277027 2940277376 205
36 iso_pr_bacteria 2940280053 2940280605 205
37 iso_pr_bacteria 2940283334 2940283948 205
38 iso_pr_bacteria 2940286528 2940286625 205
39 iso_pr_bacteria 2940289514 2940289794 205
40 iso_pr_bacteria 2940292506 2940292786 205
41 iso_pr_bacteria 2940295490 2940295490 205
42 iso_pr_bacteria 2944625312 2944625863 205
43 2225789003 2226991482 2227341706 206
44 2225789004 2227187742 2227607846 206
45 2225789004 2227253035 2227696870 206
46 3300000062 IMNBL1DRAFT_c0000324 IMNBL1DRAFT_000032429 206
47 3300002450 JGI24695J34938_10004017 JGI24695J34938_100040172 206
48 3300009826 Ga0123355_10050113 Ga0123355_100501134 206
49 3300042599 Ga0466706_107682 Ga0466706_107682_129_749 206
50 3300042602 Ga0466713_052392 Ga0466713_052392_152655_153275 206
51 3300042649 Ga0466724_55877 Ga0466724_55877_2421_3041 206
52 3300056842 Ga0562377_0006 Ga0562377_0006_2000870_2001490 206
53 3300000062 IMNBL1DRAFT_c0000006 IMNBL1DRAFT_0000006117 207
54 3300000062 IMNBL1DRAFT_c0019963 IMNBL1DRAFT_00199632 207
55 3300000062 IMNBL1DRAFT_c0049400 IMNBL1DRAFT_00494002 207
56 3300005201 Ga0072941_1223334 Ga0072941_12233341 207
57 3300005201 Ga0072941_1720106 Ga0072941_17201062 207
58 3300010167 Ga0123353_11359580 Ga0123353_113595801 207
59 3300042590 Ga0466690_390444 Ga0466690_390444_740_1363 207
60 3300042594 Ga0466694_154991 Ga0466694_154991_1596_2219 207
61 3300042611 Ga0466697_107487 Ga0466697_107487_15664_16287 207
62 3300042613 Ga0466710_150753 Ga0466710_150753_328_951 207
63 3300042623 Ga0466734_071243 Ga0466734_071243_487_1110 207
64 3300002462 JGI24702J35022_10043935 JGI24702J35022_100439352 208
65 3300002504 JGI24705J35276_12188727 JGI24705J35276_121887273 208
66 3300005201 Ga0072941_1432099 Ga0072941_14320993 208
67 3300010882 Ga0123354_10090553 Ga0123354_100905534 208
68 3300010167 Ga0123353_10031843 Ga0123353_100318437 209
69 3300010167 Ga0123353_10080306 Ga0123353_100803062 209
70 3300010167 Ga0123353_11412638 Ga0123353_114126382 209
71 3300010049 Ga0123356_10158205 Ga0123356_101582052 210
72 3300042601 Ga0466707_097664 Ga0466707_097664_404_1036 210
73 3300042609 Ga0466722_080045 Ga0466722_080045_597_1229 210
74 3300042601 Ga0466707_083431 Ga0466707_083431_2872_3507 211
75 3300042601 Ga0466707_404385 Ga0466707_404385_1954_2589 211
76 2225789004 2227330786 2227778658 212
77 3300042591 Ga0466692_065539 Ga0466692_065539_21962_22600 212
78 3300042601 Ga0466707_020353 Ga0466707_020353_17_655 212
79 3300042601 Ga0466707_165872 Ga0466707_165872_428_1066 212
80 3300042601 Ga0466707_327496 Ga0466707_327496_264_902 212
81 3300042601 Ga0466707_375862 Ga0466707_375862_5023_5661 212
82 3300042601 Ga0466707_420054 Ga0466707_420054_92_730 212
83 3300042602 Ga0466713_033410 Ga0466713_033410_26606_27244 212
84 3300042602 Ga0466713_049964 Ga0466713_049964_3388_4026 212
85 3300042605 Ga0466716_280595 Ga0466716_280595_265_903 212
86 3300042606 Ga0466719_055643 Ga0466719_055643_341_979 212
87 3300042606 Ga0466719_276360 Ga0466719_276360_1955_2593 212
88 3300042606 Ga0466719_389882 Ga0466719_389882_2877_3515 212
89 3300042606 Ga0466719_511311 Ga0466719_511311_199_837 212
90 3300042612 Ga0466705_092012 Ga0466705_092012_15_653 212
91 3300042612 Ga0466705_180877 Ga0466705_180877_3997_4635 212
92 3300042616 Ga0466715_343745 Ga0466715_343745_2826_3464 212
93 3300042619 Ga0466726_428673 Ga0466726_428673_341_979 212
94 3300042620 Ga0466728_105263 Ga0466728_105263_1157_1795 212
95 3300042620 Ga0466728_286612 Ga0466728_286612_690_1328 212
96 3300042636 Ga0466703_221949 Ga0466703_221949_128_766 212
97 3300042636 Ga0466703_334577 Ga0466703_334577_8817_9455 212
98 3300042643 Ga0466704_106790 Ga0466704_106790_76_714 212
99 3300042643 Ga0466704_115834 Ga0466704_115834_38111_38749 212
100 3300042643 Ga0466704_566009 Ga0466704_566009_867_1505 212
101 3300042652 Ga0466708_131412 Ga0466708_131412_20080_20718 212
102 3300042654 Ga0466725_056529 Ga0466725_056529_191_829 212
103 3300042655 Ga0466727_261360 Ga0466727_261360_138_776 212
104 3300042655 Ga0466727_278491 Ga0466727_278491_4381_5019 212
105 3300005071 Ga0068302_10431661 Ga0068302_104316611 213
106 3300042599 Ga0466706_233135 Ga0466706_233135_665_1306 213
107 3300042602 Ga0466713_054165 Ga0466713_054165_3868_4509 213
108 3300042602 Ga0466713_146655 Ga0466713_146655_1795_2436 213
109 iso_pr_bacteria 2820906387 2820906720 213
110 3300009784 Ga0123357_10040528 Ga0123357_100405287 214
111 3300010882 Ga0123354_10244536 Ga0123354_102445362 214
112 3300042596 Ga0466696_334121 Ga0466696_334121_6952_7596 214
113 3300042598 Ga0466701_011001 Ga0466701_011001_428_1072 214
114 3300042600 Ga0466700_185234 Ga0466700_185234_385_1029 214
115 3300042604 Ga0466717_114107 Ga0466717_114107_3266_3910 214
116 3300042604 Ga0466717_277218 Ga0466717_277218_1640_2284 214
117 3300042611 Ga0466697_042908 Ga0466697_042908_543_1187 214
118 3300042612 Ga0466705_261139 Ga0466705_261139_1224_1868 214
119 3300042615 Ga0466711_096199 Ga0466711_096199_4745_5389 214
120 3300042615 Ga0466711_152227 Ga0466711_152227_34_678 214
121 3300042622 Ga0466731_331742 Ga0466731_331742_814_1458 214
122 iso_pr_bacteria 2820811576 2820811760 214
123 iso_pr_bacteria 2820813074 2820813450 214
124 3300010049 Ga0123356_10867195 Ga0123356_108671952 215
125 3300010167 Ga0123353_10051406 Ga0123353_100514066 216
126 3300010882 Ga0123354_10207698 Ga0123354_102076984 216
127 3300042654 Ga0466725_061025 Ga0466725_061025_57_707 216
128 iso_pr_bacteria 2820314258 2820316555 216
129 iso_pr_bacteria 2820324456 2820326857 216
130 iso_pr_bacteria 2820593525 2820594121 216
131 3300002504 JGI24705J35276_12238294 JGI24705J35276_1223829414 217
132 3300042602 Ga0466713_083672 Ga0466713_083672_395_1048 217
133 3300009826 Ga0123355_10098945 Ga0123355_100989452 218
134 3300042623 Ga0466734_100908 Ga0466734_100908_589_1245 218
135 3300000062 IMNBL1DRAFT_c0028895 IMNBL1DRAFT_00288953 219
136 3300010167 Ga0123353_10200950 Ga0123353_102009504 219
137 3300010049 Ga0123356_10500742 Ga0123356_105007422 220
138 3300010167 Ga0123353_10162708 Ga0123353_101627082 220
139 3300010167 Ga0123353_10408881 Ga0123353_104088812 220
140 3300010882 Ga0123354_10065467 Ga0123354_100654673 220
141 3300009826 Ga0123355_10530573 Ga0123355_105305732 221
142 3300042603 Ga0466714_059644 Ga0466714_059644_8352_9017 221
143 3300042618 Ga0466723_002457 Ga0466723_002457_6104_6769 221
144 3300042659 Ga0466733_195460 Ga0466733_195460_117_782 221
145 3300010882 Ga0123354_10115361 Ga0123354_101153611 224
146 3300042591 Ga0466692_189411 Ga0466692_189411_76_750 224
147 3300042599 Ga0466706_071567 Ga0466706_071567_5002_5676 224
148 3300042591 Ga0466692_036918 Ga0466692_036918_8469_9149 226
149 3300042616 Ga0466715_461326 Ga0466715_461326_1814_2506 230
150 3300042648 Ga0466709_366025 Ga0466709_366025_203_907 234
151 3300042612 Ga0466705_196764 Ga0466705_196764_399_1151 250
152 3300042612 Ga0466705_500146 Ga0466705_500146_303_1070 255

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00717 Peptidase_S24 Peptidase S24-like 134 247 0.99
PF01726 LexA_DNA_bind LexA DNA binding domain 44 108 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.51 0.63 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.