Protein Family IF07251

Metagenome Isolate
149 Members
46 Samples
142 Scaffolds
370.58 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_496138|Ga0466705_496138_3994_5244
Length
416 aa
Sequence
LKNVTLGNAEYSNLFFSCSDFKLFIWIHGTLLDARNFAGGAALGNYESRVRGMKLSLIIPCYNEERTIEDCVSRVLGIAKGRDFSIEAVVVDDASTDRSLSVLEKIAKEHEEVTVLRHERNRGKGAALRTGLMRATGDFVGIQDADAEYDPAEYVDMLEPLLDGRADVVYGSRYLRPDTRRVLYFWHTWMNKALTFVSNMFTNLDITDMETCYKLFRGDVIRSIAPTLREERFGFEPEITAKVAQERCRVYECAISYNPRTYEEGKKIGWKDGFHALYCILHYSAPTAPLPMQILIYFFIGFLSLLLNLSIFSLTFPLTGTTLSIVGSFMIAAVFNYLLCVSLLFRHKARWDTFGEAALYVVSVALMGLVDYGVTLGLMALSWSPGYSKFWAAVTGFVGNFIVRKYLVFPEKKRVR

📊 Sample Types

Isolate 4.7%
Metagenome 95.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.9%
Kalotermitidae 25.0%
Unclassified 22.7%
Termopsidae 6.8%
Rhinotermitidae 4.5%

🌳 Taxonomy

Archaea 0
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
2 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
9 2820716747 Unclassified Fibrobacteres Nc150P3bin18 Isolate Unclassified
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
18 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
21 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
43 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
44 2778260939 Unclassified Fibrobacteres Co191P4bin13 Isolate Unclassified
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_000710 3300042656 Bacteria 21752
2 Ga0466713_105184 3300042602 Unclassified 6933
3 Ga0466722_232757 3300042609 Bacteria 3778
4 Ga0264413_112037 3300024493 Bacteria 36190
5 Ga0264413_112497 3300024493 Bacteria 22746
6 Ga0466705_496138 3300042612 Bacteria 5626
7 Ga0466712_025014 3300042614 Bacteria 1782
8 Ga0466712_089947 3300042614 Unclassified 11406
9 Ga0466711_116183 3300042615 Bacteria 21585
10 Ga0466718_129007 3300042617 Bacteria 23764
11 AustNasuHG_c1011546 3300000089 Bacteria 3061
12 JGI24698J34947_10024871 3300002449 Bacteria 3192
13 JGI24698J34947_10043723 3300002449 Unclassified 2295
14 Ga0466708_280760 3300042652 Bacteria 81850
15 Ga0466700_073820 3300042600 Bacteria 93486
16 Ga0466719_206789 3300042606 Bacteria 9370
17 Ga0466721_272980 3300042608 Bacteria 1775
18 Ga0264413_109210 3300024493 Bacteria 4673
19 Ga0264413_113760 3300024493 Bacteria 8890
20 Ga0466694_407010 3300042594 Bacteria 2571
21 Ga0466699_008070 3300042597 Bacteria 23608
22 Ga0466699_063131 3300042597 Bacteria 2836
23 Ga0466712_020317 3300042614 Bacteria 13424
24 Ga0466712_157001 3300042614 Bacteria 4199
25 Ga0466711_142820 3300042615 Bacteria 35097
26 Ga0466711_170527 3300042615 Bacteria 7921
27 Ga0466711_425000 3300042615 Unclassified 2919
28 Ga0466715_547093 3300042616 Bacteria 7487
29 Ga0466726_229267 3300042619 Bacteria 12683
30 AustNasuHG_c1030815 3300000089 Bacteria 1532
31 JGI24698J34947_10013395 3300002449 Bacteria 4478
32 JGI24698J34947_10036959 3300002449 Unclassified 2540
33 Ga0068305_10154065 3300005083 Bacteria 5926
34 Ga0072941_1004046 3300005201 Bacteria 45352
35 Ga0072941_1009759 3300005201 Bacteria 77968
36 Ga0466702_043906 3300042635 Bacteria 4131
37 Ga0466702_118763 3300042635 Bacteria 2829
38 Ga0466702_300364 3300042635 Bacteria 2948
39 Ga0466709_168357 3300042648 Bacteria 5413
40 Ga0466725_389559 3300042654 Bacteria 1706
41 Ga0466717_189644 3300042604 Bacteria 2451
42 Ga0466719_401254 3300042606 Bacteria 2177
43 Ga0264413_116607 3300024493 Unclassified 10601
44 Ga0466692_120707 3300042591 Bacteria 8648
45 Ga0466694_268653 3300042594 Bacteria 2620
46 Ga0466696_298520 3300042596 Bacteria 7147
47 Ga0466712_223181 3300042614 Bacteria 12732
48 Ga0466711_447405 3300042615 Bacteria 11641
49 Ga0466715_036183 3300042616 Bacteria 2424
50 Ga0466715_144891 3300042616 Bacteria 8735
51 Ga0466715_328069 3300042616 Bacteria 3994
52 Ga0466718_075768 3300042617 Bacteria 28444
53 Ga0466723_107106 3300042618 Bacteria 15083
54 JGI24698J34947_10001174 3300002449 Bacteria 13653
55 Ga0072940_1172388 3300005200 Bacteria 2840
56 Ga0072941_1012172 3300005201 Bacteria 11972
57 Ga0466703_103119 3300042636 Bacteria 4060
58 Ga0466704_127837 3300042643 Bacteria 6059
59 Ga0466720_057161 3300042607 Bacteria 10519
60 Ga0466722_173329 3300042609 Bacteria 4072
61 Ga0264413_122825 3300024493 Bacteria 13982
62 Ga0466694_115165 3300042594 Bacteria 3845
63 Ga0466712_180254 3300042614 Unclassified 5498
64 Ga0466711_225804 3300042615 Unclassified 1751
65 Ga0466715_157238 3300042616 Bacteria 4104
66 Ga0466715_216059 3300042616 Bacteria 7668
67 Ga0466718_027823 3300042617 Bacteria 12126
68 Ga0466726_067353 3300042619 Bacteria 5057
69 AustNasuHG_c1004940 3300000089 Bacteria 4772
70 AustNasuHG_c1007290 3300000089 Bacteria 3938
71 AustNasuHG_c1017162 3300000089 Bacteria 2411
72 JGI24698J34947_10015812 3300002449 Bacteria 4104
73 JGI24695J34938_10001406 3300002450 Bacteria 20562
74 Ga0068305_10044636 3300005083 Bacteria 5020
75 Ga0072941_1013742 3300005201 Bacteria 14140
76 Ga0466703_239917 3300042636 Bacteria 2932
77 Ga0466704_590883 3300042643 Bacteria 6512
78 Ga0466727_224459 3300042655 Bacteria 1474
79 Ga0466705_205589 3300042612 Bacteria 5021
80 Ga0466707_292198 3300042601 Bacteria 1707
81 Ga0466716_508803 3300042605 Bacteria 1400
82 Ga0466720_030897 3300042607 Bacteria 17817
83 Ga0466722_118904 3300042609 Bacteria 1233
84 Ga0264413_104201 3300024493 Bacteria 22073
85 Ga0415639_055092 3300038395 Bacteria 3901
86 Ga0466694_004667 3300042594 Bacteria 11434
87 Ga0466711_422813 3300042615 Bacteria 2481
88 Ga0466726_360339 3300042619 Bacteria 5122
89 AustNasuHG_c1000273 3300000089 Bacteria 17705
90 JGI24695J34938_10003112 3300002450 Bacteria 11842
91 Ga0072941_1077104 3300005201 Bacteria 7008
92 Ga0466704_550429 3300042643 Bacteria 2021
93 Ga0466708_206730 3300042652 Unclassified 6428
94 Ga0466732_181065 3300042656 Bacteria 4825
95 Ga0466707_058149 3300042601 Bacteria 1942
96 Ga0466713_017199 3300042602 Bacteria 4606
97 Ga0466713_120859 3300042602 Bacteria 2399
98 Ga0466699_249018 3300042597 Bacteria 2944
99 Ga0466711_339224 3300042615 Bacteria 1875
100 Ga0466718_118076 3300042617 Bacteria 20033
101 Ga0466726_235932 3300042619 Bacteria 6201
102 Ga0466726_282115 3300042619 Unclassified 1854
103 Ga0466735_055244 3300042624 Bacteria 3378
104 Ga0466704_119528 3300042643 Bacteria 1792
105 Ga0466705_371557 3300042612 Bacteria 2021
106 Ga0466719_195905 3300042606 Bacteria 7284
107 Ga0264413_113368 3300024493 Bacteria 14498
108 Ga0466692_192613 3300042591 Bacteria 2810
109 Ga0466694_065026 3300042594 Bacteria 24875
110 Ga0466696_268085 3300042596 Bacteria 4298
111 Ga0466699_382868 3300042597 Bacteria 1902
112 Ga0466712_217249 3300042614 Bacteria 27211
113 Ga0466711_260628 3300042615 Bacteria 11863
114 Ga0466718_044196 3300042617 Bacteria 15851
115 Ga0466718_061196 3300042617 Bacteria 25905
116 Ga0123356_10037823 3300010049 Bacteria 4500
117 AustNasuHG_c1015109 3300000089 Unclassified 2611
118 JGI24698J34947_10018139 3300002449 Bacteria 3808
119 JGI24695J34938_10005268 3300002450 Bacteria 8145
120 Ga0072941_1003790 3300005201 Bacteria 20719
121 Ga0072941_1023644 3300005201 Bacteria 4916
122 Ga0466704_130684 3300042643 Bacteria 12057
123 Ga0466727_255020 3300042655 Bacteria 1727
124 Ga0466705_129858 3300042612 Unclassified 4915
125 Ga0466732_234248 3300042656 Bacteria 1487
126 Ga0466707_372628 3300042601 Bacteria 2182
127 Ga0466719_234595 3300042606 Bacteria 2252
128 Ga0466720_045967 3300042607 Bacteria 61775
129 Ga0466720_071927 3300042607 Bacteria 79746
130 Ga0264413_110785 3300024493 Bacteria 16824
131 Ga0264413_124563 3300024493 Unclassified 6050
132 Ga0466712_021178 3300042614 Bacteria 5639
133 Ga0466712_038227 3300042614 Bacteria 14314
134 Ga0466726_246579 3300042619 Bacteria 3939
135 JGI24698J34947_10015901 3300002449 Bacteria 4091
136 JGI24696J40584_12961263 3300002834 Unclassified 12783
137 Ga0072940_1019143 3300005200 Bacteria 4838
138 Ga0072941_1013741 3300005201 Bacteria 21395
139 Ga0072941_1110436 3300005201 Bacteria 3997
140 Ga0466704_285321 3300042643 Bacteria 12799
141 Ga0466704_450884 3300042643 Bacteria 7566
142 Ga0466708_362367 3300042652 Bacteria 4357

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_103119 Ga0466703_103119_253_1245 330
2 3300042609 Ga0466722_173329 Ga0466722_173329_28_1023 331
3 3300042615 Ga0466711_425000 Ga0466711_425000_1800_2840 333
4 3300042612 Ga0466705_371557 Ga0466705_371557_712_1719 335
5 3300042609 Ga0466722_118904 Ga0466722_118904_200_1210 336
6 3300042643 Ga0466704_450884 Ga0466704_450884_2732_3754 340
7 3300042597 Ga0466699_382868 Ga0466699_382868_636_1664 342
8 3300042615 Ga0466711_260628 Ga0466711_260628_10258_11286 342
9 3300042615 Ga0466711_339224 Ga0466711_339224_22_1053 343
10 3300042619 Ga0466726_246579 Ga0466726_246579_2720_3754 344
11 3300042601 Ga0466707_292198 Ga0466707_292198_614_1651 345
12 3300042601 Ga0466707_058149 Ga0466707_058149_394_1434 346
13 3300042615 Ga0466711_225804 Ga0466711_225804_133_1173 346
14 3300005201 Ga0072941_1023644 Ga0072941_10236444 350
15 3300042597 Ga0466699_008070 Ga0466699_008070_15324_16379 351
16 3300042617 Ga0466718_044196 Ga0466718_044196_5650_6741 353
17 3300042594 Ga0466694_115165 Ga0466694_115165_1859_2926 355
18 3300042635 Ga0466702_043906 Ga0466702_043906_1153_2265 356
19 3300042615 Ga0466711_116183 Ga0466711_116183_12175_13281 357
20 3300042615 Ga0466711_422813 Ga0466711_422813_764_1888 361
21 3300042643 Ga0466704_550429 Ga0466704_550429_543_1655 362
22 3300042652 Ga0466708_280760 Ga0466708_280760_78318_79406 362
23 3300002449 JGI24698J34947_10013395 JGI24698J34947_100133954 363
24 3300042614 Ga0466712_025014 Ga0466712_025014_414_1565 363
25 3300002450 JGI24695J34938_10005268 JGI24695J34938_100052686 364
26 3300024493 Ga0264413_124563 Ga0264413_1245635 365
27 3300042594 Ga0466694_065026 Ga0466694_065026_23518_24615 365
28 3300042605 Ga0466716_508803 Ga0466716_508803_82_1179 365
29 3300042606 Ga0466719_401254 Ga0466719_401254_915_2039 365
30 3300024493 Ga0264413_112497 Ga0264413_1124979 366
31 3300024493 Ga0264413_116607 Ga0264413_1166078 366
32 3300042617 Ga0466718_075768 Ga0466718_075768_5514_6614 366
33 3300042656 Ga0466732_181065 Ga0466732_181065_3558_4658 366
34 3300038395 Ga0415639_055092 Ga0415639_055092_2425_3528 367
35 3300042604 Ga0466717_189644 Ga0466717_189644_548_1651 367
36 3300042617 Ga0466718_061196 Ga0466718_061196_24356_25459 367
37 iso_pr_bacteria 2778260941 2778358176 367
38 3300002449 JGI24698J34947_10036959 JGI24698J34947_100369592 368
39 3300002449 JGI24698J34947_10043723 JGI24698J34947_100437232 368
40 3300002450 JGI24695J34938_10003112 JGI24695J34938_100031129 368
41 3300005201 Ga0072941_1004046 Ga0072941_100404612 368
42 3300042602 Ga0466713_120859 Ga0466713_120859_874_1980 368
43 3300042614 Ga0466712_180254 Ga0466712_180254_2474_3580 368
44 3300042619 Ga0466726_360339 Ga0466726_360339_1396_2502 368
45 3300000089 AustNasuHG_c1007290 AustNasuHG_10072902 369
46 3300002449 JGI24698J34947_10015901 JGI24698J34947_100159013 369
47 3300005201 Ga0072941_1003790 Ga0072941_100379022 369
48 3300005201 Ga0072941_1013742 Ga0072941_10137426 369
49 3300024493 Ga0264413_113760 Ga0264413_1137602 369
50 iso_pr_bacteria 2778260939 2778353602 369
51 3300002834 JGI24696J40584_12961263 JGI24696J40584_129612634 370
52 3300005201 Ga0072941_1110436 Ga0072941_11104361 370
53 3300042602 Ga0466713_017199 Ga0466713_017199_2623_3735 370
54 3300042602 Ga0466713_105184 Ga0466713_105184_1237_2349 370
55 3300042612 Ga0466705_129858 Ga0466705_129858_3435_4568 370
56 3300042619 Ga0466726_067353 Ga0466726_067353_286_1398 370
57 3300000089 AustNasuHG_c1017162 AustNasuHG_10171622 371
58 3300005083 Ga0068305_10044636 Ga0068305_100446362 371
59 3300042594 Ga0466694_004667 Ga0466694_004667_8096_9211 371
60 3300042597 Ga0466699_063131 Ga0466699_063131_1557_2672 371
61 3300042597 Ga0466699_249018 Ga0466699_249018_833_1948 371
62 3300042606 Ga0466719_195905 Ga0466719_195905_3040_4155 371
63 3300042606 Ga0466719_206789 Ga0466719_206789_6381_7517 371
64 3300042607 Ga0466720_045967 Ga0466720_045967_12657_13772 371
65 3300042607 Ga0466720_057161 Ga0466720_057161_2167_3282 371
66 3300042614 Ga0466712_020317 Ga0466712_020317_5051_6166 371
67 3300042619 Ga0466726_235932 Ga0466726_235932_4292_5407 371
68 3300042624 Ga0466735_055244 Ga0466735_055244_1904_3019 371
69 3300042635 Ga0466702_300364 Ga0466702_300364_1496_2611 371
70 3300042656 Ga0466732_000710 Ga0466732_000710_5322_6437 371
71 3300000089 AustNasuHG_c1030815 AustNasuHG_10308152 372
72 3300005200 Ga0072940_1019143 Ga0072940_10191432 372
73 3300010049 Ga0123356_10037823 Ga0123356_100378233 372
74 3300024493 Ga0264413_109210 Ga0264413_1092105 372
75 3300042591 Ga0466692_120707 Ga0466692_120707_1878_2996 372
76 3300042614 Ga0466712_217249 Ga0466712_217249_20610_21728 372
77 3300042616 Ga0466715_144891 Ga0466715_144891_1307_2425 372
78 3300042616 Ga0466715_328069 Ga0466715_328069_171_1289 372
79 3300042617 Ga0466718_118076 Ga0466718_118076_500_1618 372
80 3300042619 Ga0466726_229267 Ga0466726_229267_1770_2888 372
81 3300042652 Ga0466708_362367 Ga0466708_362367_2481_3599 372
82 3300042655 Ga0466727_255020 Ga0466727_255020_328_1446 372
83 iso_pr_bacteria 2778260937 2778347942 372
84 3300002449 JGI24698J34947_10018139 JGI24698J34947_100181392 373
85 3300002450 JGI24695J34938_10001406 JGI24695J34938_1000140612 373
86 3300005201 Ga0072941_1012172 Ga0072941_10121722 373
87 3300005201 Ga0072941_1013741 Ga0072941_101374118 373
88 3300042607 Ga0466720_030897 Ga0466720_030897_7817_8938 373
89 3300002449 JGI24698J34947_10001174 JGI24698J34947_100011746 374
90 3300002449 JGI24698J34947_10024871 JGI24698J34947_100248713 374
91 3300024493 Ga0264413_104201 Ga0264413_10420114 374
92 3300024493 Ga0264413_112037 Ga0264413_1120377 374
93 3300042596 Ga0466696_268085 Ga0466696_268085_1886_3010 374
94 3300042614 Ga0466712_089947 Ga0466712_089947_2468_3592 374
95 3300042615 Ga0466711_142820 Ga0466711_142820_28281_29405 374
96 3300042617 Ga0466718_129007 Ga0466718_129007_16939_18063 374
97 3300042615 Ga0466711_170527 Ga0466711_170527_5167_6294 375
98 3300042615 Ga0466711_447405 Ga0466711_447405_1288_2415 375
99 3300042616 Ga0466715_157238 Ga0466715_157238_1229_2356 375
100 3300042648 Ga0466709_168357 Ga0466709_168357_1763_2890 375
101 iso_pr_bacteria 2740892545 2743909355 375
102 iso_pr_bacteria 2820716747 2820718693 375
103 3300000089 AustNasuHG_c1011546 AustNasuHG_10115464 376
104 3300005201 Ga0072941_1077104 Ga0072941_10771046 376
105 3300024493 Ga0264413_113368 Ga0264413_1133683 376
106 3300042614 Ga0466712_223181 Ga0466712_223181_6563_7693 376
107 3300042636 Ga0466703_239917 Ga0466703_239917_766_1896 376
108 3300002449 JGI24698J34947_10015812 JGI24698J34947_100158123 377
109 3300005083 Ga0068305_10154065 Ga0068305_101540652 377
110 3300024493 Ga0264413_110785 Ga0264413_11078515 377
111 3300042594 Ga0466694_268653 Ga0466694_268653_523_1656 377
112 3300042614 Ga0466712_157001 Ga0466712_157001_908_2041 377
113 3300042616 Ga0466715_036183 Ga0466715_036183_253_1386 377
114 3300042643 Ga0466704_127837 Ga0466704_127837_252_1385 377
115 3300042643 Ga0466704_130684 Ga0466704_130684_9874_11007 377
116 3300042643 Ga0466704_285321 Ga0466704_285321_9142_10311 377
117 3300042652 Ga0466708_206730 Ga0466708_206730_4384_5517 377
118 3300042606 Ga0466719_234595 Ga0466719_234595_602_1738 378
119 3300042612 Ga0466705_205589 Ga0466705_205589_224_1360 378
120 3300042619 Ga0466726_282115 Ga0466726_282115_321_1457 378
121 3300042635 Ga0466702_118763 Ga0466702_118763_523_1659 378
122 3300000089 AustNasuHG_c1015109 AustNasuHG_10151092 379
123 3300042600 Ga0466700_073820 Ga0466700_073820_39415_40554 379
124 3300042591 Ga0466692_192613 Ga0466692_192613_1557_2699 380
125 3300042596 Ga0466696_298520 Ga0466696_298520_2606_3748 380
126 3300042607 Ga0466720_071927 Ga0466720_071927_35824_36966 380
127 3300042614 Ga0466712_038227 Ga0466712_038227_561_1703 380
128 3300042643 Ga0466704_119528 Ga0466704_119528_241_1383 380
129 3300042656 Ga0466732_234248 Ga0466732_234248_103_1245 380
130 iso_pr_bacteria 2740892546 2743912389 381
131 3300005201 Ga0072941_1009759 Ga0072941_100975950 382
132 3300024493 Ga0264413_122825 Ga0264413_1228256 382
133 3300042594 Ga0466694_407010 Ga0466694_407010_522_1670 382
134 3300042643 Ga0466704_590883 Ga0466704_590883_3282_4430 382
135 iso_pr_bacteria 2778260940 2778356461 382
136 3300042608 Ga0466721_272980 Ga0466721_272980_129_1280 383
137 3300042609 Ga0466722_232757 Ga0466722_232757_2279_3430 383
138 3300042616 Ga0466715_547093 Ga0466715_547093_5657_6808 383
139 3300000089 AustNasuHG_c1004940 AustNasuHG_10049404 384
140 3300042618 Ga0466723_107106 Ga0466723_107106_9660_10814 384
141 3300000089 AustNasuHG_c1000273 AustNasuHG_100027314 385
142 3300005200 Ga0072940_1172388 Ga0072940_11723883 385
143 3300042654 Ga0466725_389559 Ga0466725_389559_236_1411 391
144 3300042617 Ga0466718_027823 Ga0466718_027823_7992_9170 392
145 3300042616 Ga0466715_216059 Ga0466715_216059_6359_7543 394
146 3300042601 Ga0466707_372628 Ga0466707_372628_621_1808 395
147 3300042655 Ga0466727_224459 Ga0466727_224459_98_1300 400
148 3300042614 Ga0466712_021178 Ga0466712_021178_900_2105 401
149 3300042612 Ga0466705_496138 Ga0466705_496138_3994_5244 416

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00535 Glycos_transf_2 Glycosyl transferase family 2 56 222 0.94
PF04138 GtrA GtrA-like protein 297 409 0.94
PF10111 Glyco_tranf_2_2 Glycosyltransferase like family 2 56 151 0.87
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 55 194 0.77

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.