Protein Family IF07248

Metagenome Isolate
128 Members
50 Samples
114 Scaffolds
278 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_487658|Ga0466705_487658_190_1173
Length
327 aa
Sequence
MQKKLRSSALCYIRPVTEFQSTASKFSGRTIINQFAEAYPKGRCLPDRGAGTMKERNELEKFAAEIRIAALESIGKCGFGHVGGSMSIADVLAVLYGDVMKYDAKNNRWEERDWLIVSKGHAGPAVYAALAIKGFFDREMLYTLNQPGTNLPSHCDANKTPGIDMTTGSLGQGLSLGAGVAIGNKMQGRDSYAYVIIGDGESQEGQVWEAVMFAAQSEIDNLILFVDNNKDQIDGYTKTINNVENFEDKFRAFNWDVRRVDGHDVIAIEKAVEKAKAEKGMPSAIVLDTVKGKGCSFCEGVRGNHHIQVTQEQISEAVQTLRSQYCV

📊 Sample Types

Isolate 10.9%
Metagenome 89.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 32.7%
Kalotermitidae 28.6%
Termitidae 24.5%
Termopsidae 4.1%
Rhinotermitidae 2.0%
Hodotermitidae 2.0%
Tenebrionidae 2.0%
Passalidae 2.0%
Blaberidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
3 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
4 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
5 2820176377 Unclassified Planctomycetes Th196P3bin111 Isolate Unclassified
6 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
7 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
12 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
13 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
14 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
15 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
16 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
17 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
18 2820556368 Unclassified Firmicutes Emb289P3bin92 Isolate Unclassified
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
33 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
34 2820038975 Unclassified Saccharibacteria Emb289P3bin132 Isolate Unclassified
35 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
36 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
37 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
45 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
49 2772190975 Treponema sp. RmG30 Isolate Blaberidae
50 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_018252 3300042656 Bacteria 25875
2 Ga0466705_487658 3300042612 Bacteria 1720
3 Ga0466723_093420 3300042618 Bacteria 10502
4 Ga0466723_220366 3300042618 Bacteria 3367
5 Ga0466691_000125 3300042593 Bacteria 15560
6 Ga0123357_10364475 3300009784 Bacteria 1364
7 Ga0123356_10044966 3300010049 Bacteria 4109
8 Ga0123353_10000193 3300010167 Bacteria 77168
9 Ga0123353_10735367 3300010167 Bacteria 1377
10 Ga0123353_11026920 3300010167 Bacteria 1104
11 Ga0466706_020567 3300042599 Bacteria 2164
12 Ga0466713_137088 3300042602 Bacteria 5198
13 Ga0466716_246630 3300042605 Bacteria 4295
14 Ga0466719_566806 3300042606 Bacteria 4540
15 Ga0466705_050551 3300042612 Bacteria 17069
16 Ga0466711_101269 3300042615 Bacteria 28356
17 Ga0466690_096159 3300042590 Bacteria 1186
18 Ga0466709_058781 3300042648 Bacteria 14197
19 Ga0123355_10063903 3300009826 Bacteria 5934
20 Ga0123356_10534780 3300010049 Bacteria 1332
21 Ga0123353_10000006 3300010167 Bacteria 279423
22 Ga0123353_10044500 3300010167 Bacteria 7038
23 Ga0123353_10492702 3300010167 Bacteria 1789
24 Ga0123354_10110002 3300010882 Bacteria 3647
25 Ga0466719_045950 3300042606 Unclassified 3415
26 Ga0466719_269883 3300042606 Bacteria 2024
27 Ga0466719_367498 3300042606 Bacteria 2887
28 Ga0562379_1937 3300056790 Bacteria 20148
29 2227312465 2225789004 Bacteria 1203
30 Ga0072941_1000668 3300005201 Bacteria 9324
31 Ga0466712_023799 3300042614 Bacteria 49566
32 Ga0466723_264021 3300042618 Bacteria 3812
33 Ga0466726_267047 3300042619 Bacteria 4853
34 Ga0466728_324178 3300042620 Bacteria 2699
35 Ga0466728_432742 3300042620 Bacteria 7099
36 Ga0466696_430987 3300042596 Bacteria 8140
37 Ga0466708_027653 3300042652 Bacteria 2585
38 Ga0466708_449842 3300042652 Bacteria 4635
39 Ga0123355_10411028 3300009826 Bacteria 1737
40 Ga0466707_393556 3300042601 Bacteria 121495
41 Ga0466733_059354 3300042659 Bacteria 1292
42 Ga0466733_120859 3300042659 Bacteria 5142
43 Ga0466715_215582 3300042616 Bacteria 3140
44 Ga0466715_369538 3300042616 Bacteria 8814
45 Ga0466728_129199 3300042620 Bacteria 1577
46 Ga0466691_082745 3300042593 Bacteria 1574
47 Ga0466696_358657 3300042596 Bacteria 2132
48 Ga0466703_247142 3300042636 Bacteria 96407
49 Ga0466704_076757 3300042643 Bacteria 271570
50 Ga0466725_303896 3300042654 Bacteria 2125
51 Ga0466727_133423 3300042655 Bacteria 2087
52 Ga0123353_10397144 3300010167 Bacteria 2054
53 Ga0123353_10548429 3300010167 Bacteria 1668
54 Ga0466706_052515 3300042599 Bacteria 1328
55 Ga0466716_257018 3300042605 Bacteria 1260
56 Ga0466705_449164 3300042612 Bacteria 1196
57 Ga0466705_487151 3300042612 Bacteria 2896
58 Ga0466723_022774 3300042618 Bacteria 1738
59 Ga0466726_104824 3300042619 Bacteria 3350
60 Ga0466703_040307 3300042636 Bacteria 17717
61 Ga0466704_025649 3300042643 Bacteria 3479
62 Ga0466713_077177 3300042602 Bacteria 4545
63 Ga0466717_006210 3300042604 Bacteria 1388
64 Ga0466719_466912 3300042606 Bacteria 7998
65 AustNasuHG_c1007244 3300000089 Bacteria 3947
66 Ga0123357_10000238 3300009784 Bacteria 52234
67 Ga0466705_434363 3300042612 Bacteria 2163
68 Ga0466711_229149 3300042615 Bacteria 3948
69 Ga0466723_142062 3300042618 Bacteria 2739
70 Ga0466726_040232 3300042619 Bacteria 21530
71 Ga0466690_049425 3300042590 Bacteria 5034
72 Ga0466695_379021 3300042595 Bacteria 1985
73 Ga0466696_124621 3300042596 Bacteria 2730
74 Ga0466696_286446 3300042596 Bacteria 6088
75 Ga0466703_138069 3300042636 Bacteria 8499
76 Ga0466704_072057 3300042643 Bacteria 8432
77 Ga0466727_108208 3300042655 Bacteria 10340
78 Ga0123357_10043089 3300009784 Bacteria 6132
79 Ga0123355_10093440 3300009826 Bacteria 4761
80 Ga0123355_10162085 3300009826 Bacteria 3366
81 Ga0123356_10058362 3300010049 Unclassified 3598
82 Ga0123353_10118811 3300010167 Bacteria 4251
83 Ga0123353_11118752 3300010167 Unclassified 1043
84 Ga0466706_128056 3300042599 Bacteria 4576
85 Ga0466707_047554 3300042601 Bacteria 59264
86 Ga0466716_433218 3300042605 Bacteria 1060
87 Ga0466722_184632 3300042609 Bacteria 9749
88 Ga0466691_058565 3300042593 Bacteria 12617
89 Ga0466696_342148 3300042596 Bacteria 66133
90 Ga0466703_089301 3300042636 Bacteria 25953
91 Ga0466703_301969 3300042636 Bacteria 2216
92 Ga0466708_047224 3300042652 Bacteria 4922
93 Ga0123355_10137779 3300009826 Unclassified 3744
94 Ga0123356_10001529 3300010049 Bacteria 25478
95 Ga0123356_10011290 3300010049 Bacteria 8716
96 Ga0123353_10053808 3300010167 Bacteria 6433
97 Ga0123353_10705192 3300010167 Bacteria 1415
98 Ga0466705_115121 3300042612 Bacteria 5980
99 Ga0068305_10001566 3300005083 Bacteria 16174
100 Ga0466705_460621 3300042612 Bacteria 2670
101 Ga0466715_351736 3300042616 Bacteria 15874
102 Ga0466723_144955 3300042618 Bacteria 5902
103 Ga0466723_176637 3300042618 Bacteria 12703
104 Ga0466723_254467 3300042618 Bacteria 2704
105 Ga0466726_452744 3300042619 Bacteria 3426
106 Ga0466690_338852 3300042590 Bacteria 2934
107 Ga0466704_467352 3300042643 Bacteria 2075
108 Ga0123355_10361568 3300009826 Bacteria 1911
109 Ga0123353_10019141 3300010167 Bacteria 10159
110 Ga0123353_10735003 3300010167 Bacteria 1377
111 Ga0466706_075594 3300042599 Bacteria 269977
112 Ga0466706_121768 3300042599 Bacteria 3063
113 Ga0466713_036428 3300042602 Bacteria 19604
114 Ga0466722_074798 3300042609 Bacteria 2053

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1000668 Ga0072941_10006686 224
2 3300042593 Ga0466691_082745 Ga0466691_082745_22_744 240
3 3300042615 Ga0466711_229149 Ga0466711_229149_1578_2324 248
4 3300042599 Ga0466706_020567 Ga0466706_020567_661_1437 258
5 3300042620 Ga0466728_129199 Ga0466728_129199_671_1486 264
6 3300042599 Ga0466706_075594 Ga0466706_075594_51541_52362 265
7 3300042612 Ga0466705_487151 Ga0466705_487151_638_1441 267
8 3300042599 Ga0466706_052515 Ga0466706_052515_30_836 268
9 3300042659 Ga0466733_120859 Ga0466733_120859_74_880 268
10 iso_pr_bacteria 2820556368 2820558061 268
11 3300010049 Ga0123356_10011290 Ga0123356_100112905 269
12 3300042590 Ga0466690_049425 Ga0466690_049425_4016_4828 270
13 3300042609 Ga0466722_074798 Ga0466722_074798_783_1595 270
14 3300042636 Ga0466703_247142 Ga0466703_247142_90022_90834 270
15 3300010167 Ga0123353_11026920 Ga0123353_110269202 271
16 3300042596 Ga0466696_430987 Ga0466696_430987_5580_6395 271
17 iso_pr_bacteria 2820432912 2820433155 271
18 iso_pr_bacteria 2820530790 2820531252 271
19 3300010167 Ga0123353_10000006 Ga0123353_10000006246 272
20 3300042614 Ga0466712_023799 Ga0466712_023799_10272_11090 272
21 3300005083 Ga0068305_10001566 Ga0068305_1000156621 273
22 3300042616 Ga0466715_215582 Ga0466715_215582_387_1226 273
23 3300042643 Ga0466704_076757 Ga0466704_076757_83956_84777 273
24 3300010049 Ga0123356_10058362 Ga0123356_100583622 274
25 3300042590 Ga0466690_096159 Ga0466690_096159_231_1055 274
26 3300042606 Ga0466719_466912 Ga0466719_466912_4394_5218 274
27 3300042618 Ga0466723_176637 Ga0466723_176637_7721_8545 274
28 iso_pr_bacteria 2781125629 2781263239 274
29 iso_pr_bacteria 2781125632 2781270152 274
30 3300010167 Ga0123353_10019141 Ga0123353_100191419 275
31 3300010167 Ga0123353_10053808 Ga0123353_100538082 275
32 3300010167 Ga0123353_11118752 Ga0123353_111187522 275
33 3300042593 Ga0466691_000125 Ga0466691_000125_8541_9368 275
34 3300042593 Ga0466691_058565 Ga0466691_058565_11006_11833 275
35 3300042596 Ga0466696_124621 Ga0466696_124621_388_1215 275
36 3300042604 Ga0466717_006210 Ga0466717_006210_40_867 275
37 3300042605 Ga0466716_257018 Ga0466716_257018_31_858 275
38 3300042606 Ga0466719_045950 Ga0466719_045950_134_961 275
39 3300042606 Ga0466719_367498 Ga0466719_367498_558_1385 275
40 3300042616 Ga0466715_369538 Ga0466715_369538_3584_4411 275
41 3300042618 Ga0466723_022774 Ga0466723_022774_301_1128 275
42 3300042618 Ga0466723_144955 Ga0466723_144955_4056_4883 275
43 3300042618 Ga0466723_220366 Ga0466723_220366_394_1221 275
44 3300042652 Ga0466708_027653 Ga0466708_027653_933_1760 275
45 3300042652 Ga0466708_047224 Ga0466708_047224_23_850 275
46 3300042652 Ga0466708_449842 Ga0466708_449842_1921_2748 275
47 iso_pr_bacteria 2781125653 2781313966 275
48 iso_pr_bacteria 2781125655 2781319494 275
49 3300000089 AustNasuHG_c1007244 AustNasuHG_10072444 276
50 3300009826 Ga0123355_10063903 Ga0123355_100639033 276
51 3300009826 Ga0123355_10137779 Ga0123355_101377792 276
52 3300010167 Ga0123353_10000193 Ga0123353_1000019337 276
53 3300042595 Ga0466695_379021 Ga0466695_379021_818_1648 276
54 iso_pr_bacteria 2820038975 2820039467 276
55 3300009826 Ga0123355_10411028 Ga0123355_104110282 277
56 3300010049 Ga0123356_10001529 Ga0123356_1000152929 277
57 3300010167 Ga0123353_10735003 Ga0123353_107350032 277
58 3300042590 Ga0466690_338852 Ga0466690_338852_1619_2452 277
59 3300042596 Ga0466696_286446 Ga0466696_286446_1513_2346 277
60 3300042601 Ga0466707_047554 Ga0466707_047554_52077_52910 277
61 3300042602 Ga0466713_137088 Ga0466713_137088_1125_1958 277
62 3300042618 Ga0466723_254467 Ga0466723_254467_1529_2362 277
63 3300042636 Ga0466703_040307 Ga0466703_040307_13203_14036 277
64 3300042643 Ga0466704_025649 Ga0466704_025649_1859_2692 277
65 3300042648 Ga0466709_058781 Ga0466709_058781_9387_10220 277
66 3300042655 Ga0466727_108208 Ga0466727_108208_1232_2065 277
67 iso_pr_bacteria 2772190975 2773721437 277
68 iso_pr_bacteria 2820176377 2820177872 277
69 2225789004 2227312465 2227761922 278
70 3300009784 Ga0123357_10364475 Ga0123357_103644752 278
71 3300010049 Ga0123356_10534780 Ga0123356_105347801 278
72 3300010167 Ga0123353_10044500 Ga0123353_100445006 278
73 3300056790 Ga0562379_1937 Ga0562379_1937_18450_19286 278
74 3300010049 Ga0123356_10044966 Ga0123356_100449662 279
75 3300042609 Ga0466722_184632 Ga0466722_184632_5748_6587 279
76 3300042612 Ga0466705_434363 Ga0466705_434363_934_1773 279
77 3300042616 Ga0466715_351736 Ga0466715_351736_14977_15816 279
78 3300042619 Ga0466726_267047 Ga0466726_267047_905_1744 279
79 3300042619 Ga0466726_452744 Ga0466726_452744_1862_2701 279
80 3300042636 Ga0466703_301969 Ga0466703_301969_351_1190 279
81 iso_pr_bacteria 2781125666 2781343719 279
82 iso_pr_bacteria 2781125688 2781424165 279
83 3300009784 Ga0123357_10000238 Ga0123357_1000023822 280
84 3300009784 Ga0123357_10043089 Ga0123357_100430893 280
85 3300010167 Ga0123353_10548429 Ga0123353_105484292 280
86 3300010882 Ga0123354_10110002 Ga0123354_101100022 280
87 3300042599 Ga0466706_128056 Ga0466706_128056_2666_3508 280
88 3300042602 Ga0466713_077177 Ga0466713_077177_977_1819 280
89 iso_pr_bacteria 2772190978 2773729938 280
90 3300042605 Ga0466716_246630 Ga0466716_246630_3301_4146 281
91 3300042606 Ga0466719_269883 Ga0466719_269883_1023_1868 281
92 3300042612 Ga0466705_449164 Ga0466705_449164_35_880 281
93 3300042618 Ga0466723_093420 Ga0466723_093420_781_1626 281
94 3300042618 Ga0466723_142062 Ga0466723_142062_182_1027 281
95 3300042643 Ga0466704_072057 Ga0466704_072057_2715_3560 281
96 3300042596 Ga0466696_358657 Ga0466696_358657_790_1638 282
97 3300042599 Ga0466706_121768 Ga0466706_121768_798_1646 282
98 3300042601 Ga0466707_393556 Ga0466707_393556_90857_91705 282
99 3300042605 Ga0466716_433218 Ga0466716_433218_179_1027 282
100 3300042612 Ga0466705_115121 Ga0466705_115121_977_1825 282
101 3300042615 Ga0466711_101269 Ga0466711_101269_13402_14250 282
102 3300042618 Ga0466723_264021 Ga0466723_264021_663_1511 282
103 3300042619 Ga0466726_104824 Ga0466726_104824_693_1541 282
104 3300042620 Ga0466728_324178 Ga0466728_324178_609_1457 282
105 3300042636 Ga0466703_138069 Ga0466703_138069_1840_2688 282
106 3300009826 Ga0123355_10162085 Ga0123355_101620852 283
107 3300010167 Ga0123353_10397144 Ga0123353_103971442 283
108 3300010167 Ga0123353_10705192 Ga0123353_107051922 283
109 3300042655 Ga0466727_133423 Ga0466727_133423_1089_1940 283
110 3300009826 Ga0123355_10093440 Ga0123355_100934404 285
111 3300042602 Ga0466713_036428 Ga0466713_036428_5338_6195 285
112 3300042612 Ga0466705_460621 Ga0466705_460621_1798_2655 285
113 3300042643 Ga0466704_467352 Ga0466704_467352_772_1629 285
114 3300042654 Ga0466725_303896 Ga0466725_303896_193_1050 285
115 iso_pr_bacteria 2820504582 2820505512 285
116 3300010167 Ga0123353_10492702 Ga0123353_104927022 286
117 3300042612 Ga0466705_050551 Ga0466705_050551_1519_2379 286
118 3300042636 Ga0466703_089301 Ga0466703_089301_4813_5679 288
119 3300042596 Ga0466696_342148 Ga0466696_342148_8248_9120 290
120 3300010167 Ga0123353_10735367 Ga0123353_107353672 291
121 3300042659 Ga0466733_059354 Ga0466733_059354_214_1089 291
122 3300042620 Ga0466728_432742 Ga0466728_432742_2931_3821 296
123 3300010167 Ga0123353_10118811 Ga0123353_101188114 297
124 3300042619 Ga0466726_040232 Ga0466726_040232_6282_7181 299
125 3300009826 Ga0123355_10361568 Ga0123355_103615683 300
126 3300042606 Ga0466719_566806 Ga0466719_566806_908_1843 311
127 3300042656 Ga0466732_018252 Ga0466732_018252_433_1377 314
128 3300042612 Ga0466705_487658 Ga0466705_487658_190_1173 327

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain 62 319 0.94
PF00676 E1_dh Dehydrogenase E1 component 162 277 0.92
PF09364 XFP_N XFP N-terminal domain 141 272 0.84
PF13292 DXP_synthase_N 1-deoxy-D-xylulose-5-phosphate synthase 56 230 0.75

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00676 GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.