Protein Family IF07244

Metagenome Isolate
136 Members
37 Samples
134 Scaffolds
241.11 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_474887|Ga0466705_474887_4270_4995
Length
241 aa
Sequence
MVYEFEGRTEKEAIDQAAEALGLGKDDFDVEILEVQRSGLFKKGYVKIRVHLNQPASGALEHTHTEEADELRAVSEGSSQTRFNDPEAKNDFEQKIIDFTEGIVQRMGYEGKVSVLFREDRKIGFKIDSAYSSILIGKKGKNLDALQLLINIYAGRLGQEDVRVILDTENYRIRREESLVRLAYTVADRVRENRGSVLLEPMNPFDRRLIHTTLNDIADVETKSEGDGLYKQVRVYYRGAH

📊 Sample Types

Isolate 1.5%
Metagenome 98.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 37.8%
Termitidae 35.1%
Unclassified 10.8%
Rhinotermitidae 8.1%
Termopsidae 8.1%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
2 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
3 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
20 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
23 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
26 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
30 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
35 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_103885 3300042590 Unclassified 2798
2 Ga0466691_078886 3300042593 Bacteria 14766
3 Ga0466718_116948 3300042617 Bacteria 1633
4 Ga0466723_332331 3300042618 Bacteria 12376
5 Ga0466728_025478 3300042620 Bacteria 4717
6 Ga0466728_311119 3300042620 Bacteria 2921
7 Ga0466704_502888 3300042643 Bacteria 2116
8 Ga0466708_390230 3300042652 Bacteria 2159
9 Ga0466720_064341 3300042607 Unclassified 2488
10 Ga0466722_073828 3300042609 Bacteria 5448
11 Ga0466705_006106 3300042612 Bacteria 6416
12 Ga0466732_324658 3300042656 Bacteria 6422
13 Ga0466692_067310 3300042591 Bacteria 26519
14 Ga0466691_113013 3300042593 Bacteria 9337
15 Ga0466712_052395 3300042614 Bacteria 28135
16 Ga0466711_030716 3300042615 Bacteria 19173
17 Ga0466711_095252 3300042615 Bacteria 15909
18 Ga0466711_239063 3300042615 Bacteria 11313
19 Ga0466723_263126 3300042618 Bacteria 4010
20 Ga0466726_386317 3300042619 Bacteria 2426
21 Ga0123353_10031830 3300010167 Bacteria 8180
22 Ga0466735_163019 3300042624 Bacteria 8123
23 Ga0466700_191976 3300042600 Bacteria 1325
24 Ga0466717_118979 3300042604 Bacteria 1045
25 Ga0466716_023953 3300042605 Bacteria 9778
26 Ga0466719_171793 3300042606 Bacteria 23489
27 Ga0466720_116644 3300042607 Bacteria 39029
28 Ga0466720_163599 3300042607 Bacteria 8568
29 Ga0466732_053014 3300042656 Bacteria 12774
30 Ga0466690_119417 3300042590 Bacteria 7022
31 Ga0466691_199482 3300042593 Bacteria 2187
32 Ga0466694_194730 3300042594 Bacteria 19746
33 Ga0466705_474887 3300042612 Bacteria 10000
34 Ga0466712_063503 3300042614 Bacteria 1368
35 Ga0466712_145256 3300042614 Bacteria 6111
36 Ga0466711_364358 3300042615 Bacteria 5729
37 Ga0466718_020336 3300042617 Bacteria 1566
38 Ga0466718_086242 3300042617 Bacteria 67871
39 Ga0466723_203165 3300042618 Bacteria 40822
40 Ga0466723_243581 3300042618 Bacteria 11996
41 Ga0466726_392187 3300042619 Bacteria 30982
42 Ga0466709_092971 3300042648 Bacteria 8108
43 Ga0466709_177148 3300042648 Bacteria 37354
44 Ga0466708_061435 3300042652 Bacteria 15050
45 Ga0466708_134592 3300042652 Bacteria 3904
46 Ga0466708_389577 3300042652 Bacteria 54586
47 Ga0466716_472827 3300042605 Bacteria 2674
48 JGI24698J34947_10044404 3300002449 Unclassified 2275
49 Ga0466732_103500 3300042656 Bacteria 2524
50 Ga0466692_096759 3300042591 Unclassified 11139
51 Ga0466712_199973 3300042614 Bacteria 9634
52 Ga0466715_052295 3300042616 Bacteria 6307
53 Ga0466715_188040 3300042616 Bacteria 2278
54 Ga0466723_048028 3300042618 Bacteria 2960
55 Ga0466728_030518 3300042620 Bacteria 12433
56 Ga0123353_10229492 3300010167 Bacteria 2896
57 Ga0466703_034952 3300042636 Bacteria 5469
58 Ga0466704_592399 3300042643 Bacteria 9948
59 Ga0466700_240290 3300042600 Bacteria 2242
60 Ga0466716_014847 3300042605 Bacteria 17267
61 Ga0466716_405324 3300042605 Bacteria 6204
62 Ga0466720_030532 3300042607 Bacteria 8184
63 Ga0466720_043757 3300042607 Bacteria 6358
64 Ga0466720_074880 3300042607 Bacteria 9763
65 Ga0466720_078393 3300042607 Bacteria 7021
66 AustNasuHG_c1009848 3300000089 Bacteria 3344
67 JGI24698J34947_10053151 3300002449 Bacteria 2029
68 JGI24702J35022_10020052 3300002462 Bacteria 3633
69 Ga0466732_015610 3300042656 Bacteria 1026
70 Ga0466732_240513 3300042656 Bacteria 1629
71 Ga0456237_0001122 3300041968 Bacteria 4227
72 Ga0466691_164822 3300042593 Bacteria 10794
73 Ga0466691_216629 3300042593 Bacteria 7663
74 Ga0466694_331422 3300042594 Bacteria 2024
75 Ga0466696_173607 3300042596 Bacteria 4658
76 Ga0466696_348464 3300042596 Bacteria 4833
77 Ga0466696_473033 3300042596 Bacteria 1440
78 Ga0466712_145163 3300042614 Bacteria 1715
79 Ga0466711_100257 3300042615 Bacteria 3138
80 Ga0466718_050159 3300042617 Bacteria 12154
81 Ga0466718_152669 3300042617 Unclassified 2630
82 Ga0466723_128836 3300042618 Bacteria 1484
83 Ga0466703_113881 3300042636 Unclassified 35758
84 Ga0466704_499925 3300042643 Bacteria 6027
85 Ga0466708_025250 3300042652 Bacteria 9150
86 Ga0466708_046682 3300042652 Bacteria 25817
87 Ga0466717_177897 3300042604 Bacteria 1378
88 Ga0466720_062622 3300042607 Unclassified 2096
89 Ga0466720_069052 3300042607 Bacteria 5305
90 Ga0466720_098651 3300042607 Bacteria 30361
91 Ga0466720_101410 3300042607 Bacteria 24290
92 Ga0466720_135143 3300042607 Bacteria 1619
93 JGI24695J34938_10009299 3300002450 Bacteria 5477
94 Ga0074263_104634 3300005485 Unclassified 2107
95 Ga0466732_082030 3300042656 Bacteria 3241
96 Ga0466732_159712 3300042656 Bacteria 1254
97 Ga0466690_227918 3300042590 Bacteria 7338
98 Ga0466691_044091 3300042593 Bacteria 8339
99 Ga0466691_208717 3300042593 Bacteria 1365
100 Ga0466711_443171 3300042615 Bacteria 4566
101 Ga0466715_181733 3300042616 Bacteria 18508
102 Ga0466726_465463 3300042619 Bacteria 1218
103 Ga0466703_031739 3300042636 Bacteria 1012
104 Ga0466703_059483 3300042636 Bacteria 4202
105 Ga0466704_514167 3300042643 Bacteria 27255
106 Ga0466708_038163 3300042652 Bacteria 5560
107 Ga0466708_286264 3300042652 Bacteria 107074
108 Ga0466716_503141 3300042605 Unclassified 11887
109 Ga0466720_125366 3300042607 Bacteria 14214
110 Ga0466720_162968 3300042607 Unclassified 2537
111 Ga0466720_229034 3300042607 Unclassified 1155
112 Ga0466722_149770 3300042609 Bacteria 4974
113 JGI24698J34947_10003159 3300002449 Bacteria 8914
114 Ga0466690_145240 3300042590 Bacteria 3997
115 Ga0466694_069556 3300042594 Bacteria 2332
116 Ga0466704_431036 3300042643 Bacteria 2845
117 Ga0466708_310211 3300042652 Bacteria 8287
118 Ga0466727_222586 3300042655 Bacteria 2477
119 Ga0466713_112814 3300042602 Bacteria 4035
120 Ga0466716_344326 3300042605 Bacteria 3756
121 Ga0074263_114403 3300005485 Bacteria 3356
122 Ga0466692_013319 3300042591 Bacteria 4719
123 Ga0466711_394207 3300042615 Bacteria 10941
124 Ga0466715_009100 3300042616 Bacteria 1028
125 Ga0466723_041259 3300042618 Bacteria 4999
126 Ga0466703_024796 3300042636 Bacteria 23973
127 Ga0466704_508947 3300042643 Bacteria 7084
128 Ga0466709_384351 3300042648 Bacteria 6861
129 Ga0466727_001936 3300042655 Unclassified 1641
130 Ga0466707_130648 3300042601 Bacteria 2172
131 Ga0466716_457168 3300042605 Bacteria 4716
132 Ga0466719_191828 3300042606 Bacteria 47243
133 Ga0466720_196471 3300042607 Bacteria 1126
134 JGI24695J34938_10000762 3300002450 Bacteria 30258

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_031739 Ga0466703_031739_184_903 230
2 3300042636 Ga0466703_034952 Ga0466703_034952_2577_3323 230
3 3300042643 Ga0466704_499925 Ga0466704_499925_1131_1955 231
4 3300042596 Ga0466696_473033 Ga0466696_473033_397_1134 232
5 3300042648 Ga0466709_384351 Ga0466709_384351_2908_3642 232
6 3300042596 Ga0466696_348464 Ga0466696_348464_3213_3914 233
7 3300042607 Ga0466720_229034 Ga0466720_229034_374_1090 233
8 3300042620 Ga0466728_311119 Ga0466728_311119_1282_1986 234
9 3300042652 Ga0466708_389577 Ga0466708_389577_17719_18423 234
10 3300042593 Ga0466691_199482 Ga0466691_199482_1455_2162 235
11 3300042605 Ga0466716_472827 Ga0466716_472827_44_781 235
12 3300042605 Ga0466716_503141 Ga0466716_503141_8423_9130 235
13 3300042615 Ga0466711_239063 Ga0466711_239063_8594_9301 235
14 3300042616 Ga0466715_052295 Ga0466715_052295_2908_3615 235
15 3300042616 Ga0466715_188040 Ga0466715_188040_307_1014 235
16 3300042652 Ga0466708_286264 Ga0466708_286264_3413_4120 235
17 3300042594 Ga0466694_069556 Ga0466694_069556_851_1561 236
18 3300042594 Ga0466694_194730 Ga0466694_194730_15050_15760 236
19 3300042606 Ga0466719_191828 Ga0466719_191828_34342_35052 236
20 3300042615 Ga0466711_095252 Ga0466711_095252_14158_14868 236
21 3300042616 Ga0466715_009100 Ga0466715_009100_229_939 236
22 3300042618 Ga0466723_263126 Ga0466723_263126_2369_3079 236
23 3300042648 Ga0466709_092971 Ga0466709_092971_2338_3048 236
24 3300005485 Ga0074263_104634 Ga0074263_1046342 238
25 3300042591 Ga0466692_067310 Ga0466692_067310_22576_23292 238
26 3300042593 Ga0466691_044091 Ga0466691_044091_818_1534 238
27 3300042600 Ga0466700_191976 Ga0466700_191976_504_1220 238
28 3300042607 Ga0466720_043757 Ga0466720_043757_2675_3391 238
29 3300042607 Ga0466720_062622 Ga0466720_062622_304_1020 238
30 3300042607 Ga0466720_064341 Ga0466720_064341_193_909 238
31 3300042607 Ga0466720_069052 Ga0466720_069052_223_939 238
32 3300042607 Ga0466720_074880 Ga0466720_074880_8547_9263 238
33 3300042607 Ga0466720_078393 Ga0466720_078393_5698_6414 238
34 3300042607 Ga0466720_098651 Ga0466720_098651_13750_14466 238
35 3300042607 Ga0466720_101410 Ga0466720_101410_2779_3495 238
36 3300042607 Ga0466720_116644 Ga0466720_116644_5555_6271 238
37 3300042607 Ga0466720_125366 Ga0466720_125366_1702_2418 238
38 3300042607 Ga0466720_135143 Ga0466720_135143_351_1067 238
39 3300042607 Ga0466720_162968 Ga0466720_162968_1036_1752 238
40 3300042607 Ga0466720_196471 Ga0466720_196471_292_1008 238
41 3300042614 Ga0466712_145256 Ga0466712_145256_442_1206 238
42 3300042617 Ga0466718_050159 Ga0466718_050159_6721_7437 238
43 3300042617 Ga0466718_086242 Ga0466718_086242_53561_54277 238
44 3300042617 Ga0466718_116948 Ga0466718_116948_456_1172 238
45 3300042617 Ga0466718_152669 Ga0466718_152669_953_1669 238
46 3300042643 Ga0466704_508947 Ga0466704_508947_6261_6977 238
47 3300042656 Ga0466732_015610 Ga0466732_015610_152_868 238
48 3300042656 Ga0466732_053014 Ga0466732_053014_8301_9017 238
49 3300042656 Ga0466732_082030 Ga0466732_082030_13_729 238
50 3300042656 Ga0466732_103500 Ga0466732_103500_985_1701 238
51 3300042656 Ga0466732_159712 Ga0466732_159712_76_792 238
52 3300042656 Ga0466732_324658 Ga0466732_324658_882_1598 238
53 3300000089 AustNasuHG_c1009848 AustNasuHG_10098482 239
54 3300002462 JGI24702J35022_10020052 JGI24702J35022_100200522 239
55 3300005485 Ga0074263_114403 Ga0074263_1144032 239
56 3300042591 Ga0466692_013319 Ga0466692_013319_1161_1880 239
57 3300042600 Ga0466700_240290 Ga0466700_240290_116_835 239
58 3300042602 Ga0466713_112814 Ga0466713_112814_160_879 239
59 3300042607 Ga0466720_030532 Ga0466720_030532_913_1632 239
60 3300042636 Ga0466703_024796 Ga0466703_024796_6983_7702 239
61 3300042643 Ga0466704_514167 Ga0466704_514167_201_920 239
62 3300041968 Ga0456237_0001122 Ga0456237_0001122_2145_2867 240
63 3300042591 Ga0466692_096759 Ga0466692_096759_8712_9434 240
64 3300042593 Ga0466691_216629 Ga0466691_216629_4955_5677 240
65 3300042604 Ga0466717_118979 Ga0466717_118979_219_941 240
66 3300042609 Ga0466722_073828 Ga0466722_073828_702_1424 240
67 3300042609 Ga0466722_149770 Ga0466722_149770_3988_4710 240
68 3300042619 Ga0466726_465463 Ga0466726_465463_31_753 240
69 3300042620 Ga0466728_025478 Ga0466728_025478_2041_2763 240
70 3300042643 Ga0466704_502888 Ga0466704_502888_1070_1792 240
71 3300042652 Ga0466708_061435 Ga0466708_061435_9736_10458 240
72 3300010167 Ga0123353_10031830 Ga0123353_1003183010 241
73 3300010167 Ga0123353_10229492 Ga0123353_102294924 241
74 3300042590 Ga0466690_103885 Ga0466690_103885_1093_1818 241
75 3300042590 Ga0466690_145240 Ga0466690_145240_2586_3311 241
76 3300042593 Ga0466691_208717 Ga0466691_208717_349_1074 241
77 3300042605 Ga0466716_344326 Ga0466716_344326_70_795 241
78 3300042612 Ga0466705_006106 Ga0466705_006106_4086_4811 241
79 3300042612 Ga0466705_474887 Ga0466705_474887_4270_4995 241
80 3300042615 Ga0466711_030716 Ga0466711_030716_8047_8772 241
81 3300042615 Ga0466711_364358 Ga0466711_364358_2057_2782 241
82 3300042616 Ga0466715_181733 Ga0466715_181733_510_1235 241
83 3300042618 Ga0466723_332331 Ga0466723_332331_10946_11671 241
84 3300042643 Ga0466704_431036 Ga0466704_431036_1892_2617 241
85 3300042652 Ga0466708_025250 Ga0466708_025250_6225_6950 241
86 iso_pr_bacteria 2781125651 2781310272 241
87 3300002450 JGI24695J34938_10009299 JGI24695J34938_100092993 242
88 3300042590 Ga0466690_227918 Ga0466690_227918_264_992 242
89 3300042605 Ga0466716_014847 Ga0466716_014847_15581_16309 242
90 3300042605 Ga0466716_405324 Ga0466716_405324_989_1717 242
91 3300042606 Ga0466719_171793 Ga0466719_171793_16833_17561 242
92 3300042614 Ga0466712_052395 Ga0466712_052395_17309_18037 242
93 3300042618 Ga0466723_041259 Ga0466723_041259_1901_2629 242
94 3300042618 Ga0466723_048028 Ga0466723_048028_332_1060 242
95 3300042618 Ga0466723_128836 Ga0466723_128836_298_1026 242
96 3300042618 Ga0466723_243581 Ga0466723_243581_2822_3550 242
97 3300042619 Ga0466726_392187 Ga0466726_392187_10794_11522 242
98 3300042620 Ga0466728_030518 Ga0466728_030518_2706_3434 242
99 3300042643 Ga0466704_592399 Ga0466704_592399_6555_7283 242
100 3300042648 Ga0466709_177148 Ga0466709_177148_22382_23110 242
101 3300042652 Ga0466708_046682 Ga0466708_046682_1119_1847 242
102 3300042652 Ga0466708_134592 Ga0466708_134592_1536_2264 242
103 3300042593 Ga0466691_113013 Ga0466691_113013_4543_5274 243
104 3300042594 Ga0466694_331422 Ga0466694_331422_732_1463 243
105 3300042605 Ga0466716_023953 Ga0466716_023953_6163_6894 243
106 3300042652 Ga0466708_038163 Ga0466708_038163_265_996 243
107 3300042624 Ga0466735_163019 Ga0466735_163019_6841_7575 244
108 3300042636 Ga0466703_113881 Ga0466703_113881_9593_10327 244
109 3300042652 Ga0466708_390230 Ga0466708_390230_1074_1808 244
110 3300042596 Ga0466696_173607 Ga0466696_173607_3558_4295 245
111 3300042615 Ga0466711_394207 Ga0466711_394207_7910_8647 245
112 3300042652 Ga0466708_310211 Ga0466708_310211_2506_3243 245
113 3300042656 Ga0466732_240513 Ga0466732_240513_384_1121 245
114 iso_pr_bacteria 2781125631 2781269202 245
115 3300042607 Ga0466720_163599 Ga0466720_163599_2627_3367 246
116 3300042614 Ga0466712_145163 Ga0466712_145163_244_984 246
117 3300042614 Ga0466712_199973 Ga0466712_199973_5438_6178 246
118 3300042655 Ga0466727_001936 Ga0466727_001936_791_1549 246
119 3300002449 JGI24698J34947_10044404 JGI24698J34947_100444041 247
120 3300042590 Ga0466690_119417 Ga0466690_119417_5391_6134 247
121 3300042604 Ga0466717_177897 Ga0466717_177897_250_993 247
122 3300042619 Ga0466726_386317 Ga0466726_386317_1605_2348 247
123 3300002449 JGI24698J34947_10003159 JGI24698J34947_100031593 248
124 3300042615 Ga0466711_443171 Ga0466711_443171_3710_4456 248
125 3300042655 Ga0466727_222586 Ga0466727_222586_1630_2379 249
126 3300042614 Ga0466712_063503 Ga0466712_063503_355_1107 250
127 3300042617 Ga0466718_020336 Ga0466718_020336_585_1337 250
128 3300042636 Ga0466703_059483 Ga0466703_059483_1813_2568 251
129 3300002449 JGI24698J34947_10053151 JGI24698J34947_100531512 252
130 3300042593 Ga0466691_164822 Ga0466691_164822_6129_6887 252
131 3300002450 JGI24695J34938_10000762 JGI24695J34938_100007628 253
132 3300042605 Ga0466716_457168 Ga0466716_457168_2353_3120 255
133 3300042615 Ga0466711_100257 Ga0466711_100257_2066_2833 255
134 3300042618 Ga0466723_203165 Ga0466723_203165_16117_16890 257
135 3300042601 Ga0466707_130648 Ga0466707_130648_1104_1880 258
136 3300042593 Ga0466691_078886 Ga0466691_078886_439_1299 286

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01424 R3H R3H domain 177 236 0.96
PF14804 Jag_N Jag N-terminus 5 51 0.93
PF13083 KhpA-B_KH KhpA/KhpB, KH domain 99 165 0.74

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01424 GO:0003676 nucleic acid binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.56 0.63 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.