Protein Family IF07237

Metagenome Isolate
251 Members
163 Samples
153 Scaffolds
317.36 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_456115|Ga0466705_456115_809_1927
Length
372 aa
Sequence
MYSLSVCFYKYKRSLIFGVVNWAPRSMDSGRERGYLFTVNEDGILKRIAGRAEAAGGRARMEKNARIYVAGHRGLVGSALVRALVAQGYENLLLRTRAELDLCDQGAVETFFAAERPEYVFLAAAKVGGIHANSTYPADFIRENLLVQCNVIDAARRHGCVKLLFPGSSCIYPKLCPQPIREEYLLSGPLEPTNECYALAKIAGLKMCAAYRAQYGFNAVSVMPSNLYGPGDNFHPENSHVLPALIRRFHEAARQAAPYVVIWGTGTARREFLHVDDLASAAIFIMRKYDSAEHINIGFGGDLTVMELARAVARTVGYTGDIRCDPSKPDGTPQKLLDISRITALGWKPSIDLEQGLADTYAWFLQQEELRS

📊 Sample Types

Isolate 39.0%
Metagenome 61.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 35.3%
Unclassified 12.7%
Termitidae 12.0%
Kalotermitidae 8.0%
Culicidae 4.0%
Formicidae 3.3%
Armadillidiidae 3.3%
Rhinotermitidae 2.7%
Curculionidae 2.0%
Termopsidae 2.0%
Berytidae 1.3%
Tephritidae 1.3%
Largidae 1.3%
Apidae 1.3%
Alydidae 1.3%
Drosophilidae 0.7%
Nephropidae 0.7%
Aleyrodidae 0.7%
Thomisidae 0.7%
Hydrophilidae 0.7%
Passalidae 0.7%
Hodotermitidae 0.7%
Bombycidae 0.7%
Anthocoridae 0.7%
Daphniidae 0.7%
Siricidae 0.7%
Gryllidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 242
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
2 2820044805 Unclassified Proteobacteria Th196P4bin15 Isolate Unclassified
3 2820176377 Unclassified Planctomycetes Th196P3bin111 Isolate Unclassified
4 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
5 2896321640 Sphingobacterium sp. xlx-130 Isolate
6 2931430189 Tessaracoccus palaemonis J1M15 Isolate
7 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
8 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
9 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
10 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
11 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
12 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
13 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
14 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
15 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
16 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
17 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
18 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
19 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
20 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
21 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
22 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
26 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
27 2912817845 Streptomyces griseus SID164 Isolate
28 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
29 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
30 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
31 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
32 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
33 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
34 8102109360 Caballeronia sp. INML2 Isolate Coreidae
35 8102145433 Caballeronia sp. LP006 Isolate Coreidae
36 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
37 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
38 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
39 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
43 2548876931 Candidatus Hamiltonella defensa MED (Bemisia tabaci) Isolate Aleyrodidae
44 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
45 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
46 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
47 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
48 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
49 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
50 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
51 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
52 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
53 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
54 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
55 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
56 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
57 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
58 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
59 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
60 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
61 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
62 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
63 2896330536 Sphingobacterium sp. xlx-96 Isolate
64 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
65 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
66 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
67 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
68 8023757577 Caballeronia peredens LP006 Isolate Coreidae
69 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
70 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
71 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
72 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
73 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
74 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
75 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
76 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
77 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
78 2820072841 Unclassified Proteobacteria Nt197P3bin127 Isolate Unclassified
79 2898741527 Sphingobacterium sp. xlx-73 Isolate
80 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
81 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
82 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
83 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
84 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
85 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
86 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
87 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
88 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
89 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
90 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
91 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
92 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
93 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
94 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
95 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
96 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
97 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
98 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
99 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
100 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
101 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
102 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
103 2820148564 Unclassified Proteobacteria Emb289P1bin36 Isolate Unclassified
104 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
105 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
106 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
107 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
108 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
109 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
110 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
111 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
112 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
113 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
114 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
115 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
116 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
117 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
118 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
119 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
120 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
121 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
122 2821312900 Unclassified Proteobacteria Lab288P4bin16 Isolate Unclassified
123 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
124 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
125 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
126 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
127 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
128 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
129 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
130 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
131 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
132 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
133 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
134 8102117041 Caballeronia sp. INML3 Isolate Coreidae
135 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
136 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
137 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
138 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
139 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
140 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
141 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
142 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
143 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
144 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
145 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
146 2896350215 Sphingobacterium sp. xlx-183 Isolate
147 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
148 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
149 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
150 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
151 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
152 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
153 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
154 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
155 8021546568 Klebsiella sp. Kps Isolate Tephritidae
156 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
157 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
158 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
159 8102124461 Caballeronia sp. INML3B Isolate Coreidae
160 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
161 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
162 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
163 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_113623 3300042612 Bacteria 2288
2 Ga0466705_269072 3300042612 Bacteria 3214
3 Ga0466705_382083 3300042612 Bacteria 8459
4 Ga0466711_032812 3300042615 Bacteria 1608
5 Ga0466711_258618 3300042615 Bacteria 6044
6 Ga0466715_209279 3300042616 Bacteria 9385
7 Ga0123356_10011431 3300010049 Bacteria 8653
8 Ga0123354_10007985 3300010882 Bacteria 16048
9 HBC_ctgsDRAFT_1000255 3300000333 Bacteria 12278
10 JGI24703J35330_11748872 3300002501 Bacteria 111701
11 Ga0072941_1050718 3300005201 Bacteria 6985
12 Ga0102738_1000070 3300007141 Bacteria 41068
13 Ga0160469_100071 3300012824 Bacteria 171968
14 Ga0160447_100013 3300012849 Bacteria 365997
15 Ga0160434_100006 3300012850 Bacteria 403207
16 Ga0160457_1000028 3300012858 Bacteria 284184
17 Ga0466696_429505 3300042596 Bacteria 1521
18 Ga0466703_183310 3300042636 Bacteria 17595
19 Ga0466703_366247 3300042636 Bacteria 1353
20 Ga0466704_080327 3300042643 Unclassified 28572
21 Ga0466722_088384 3300042609 Bacteria 12982
22 Ga0466705_173790 3300042612 Bacteria 7924
23 Ga0466705_247256 3300042612 Bacteria 10363
24 Ga0466711_218509 3300042615 Bacteria 19081
25 Ga0466715_161244 3300042616 Bacteria 10688
26 Ga0466715_163167 3300042616 Bacteria 1203
27 Ga0466715_163430 3300042616 Bacteria 12167
28 Ga0466729_088380 3300042621 Bacteria 2389
29 Ga0123356_10239407 3300010049 Bacteria 1885
30 Ga0123356_10259800 3300010049 Bacteria 1820
31 Ga0160464_100009 3300012805 Bacteria 325341
32 FGTW_contig31084 2065487013 Bacteria 6380
33 JGI24705J35276_12149818 3300002504 Bacteria 1178
34 Ga0103261_1000033 3300007083 Bacteria 87612
35 Ga0102734_1006011 3300007129 Bacteria 3470
36 Ga0103264_1000182 3300007188 Bacteria 37428
37 Ga0160469_100015 3300012824 Bacteria 373407
38 Ga0160448_101819 3300012854 Bacteria 6808
39 Ga0466695_219101 3300042595 Bacteria 1175
40 Ga0466696_330098 3300042596 Bacteria 3410
41 Ga0466729_246293 3300042621 Bacteria 182374
42 Ga0466731_305906 3300042622 Bacteria 1613
43 Ga0466703_071340 3300042636 Bacteria 2918
44 Ga0466708_232353 3300042652 Bacteria 129711
45 Ga0466708_323940 3300042652 Bacteria 18001
46 Ga0466727_181029 3300042655 Bacteria 14375
47 Ga0466722_044060 3300042609 Bacteria 3413
48 Ga0466698_360064 3300042610 Bacteria 2752
49 Ga0466698_498766 3300042610 Bacteria 6058
50 Ga0466705_316131 3300042612 Bacteria 1419
51 Ga0466705_456115 3300042612 Bacteria 3470
52 Ga0466711_110923 3300042615 Bacteria 9092
53 Ga0466711_213989 3300042615 Bacteria 10135
54 Ga0466715_570949 3300042616 Bacteria 10244
55 Ga0466723_315871 3300042618 Bacteria 31895
56 Ga0466726_079589 3300042619 Bacteria 35525
57 Ga0160465_100058 3300012803 Bacteria 124472
58 Ga0103260_1000178 3300007139 Bacteria 14123
59 Ga0160459_100019 3300012831 Bacteria 370950
60 Ga0466696_266952 3300042596 Bacteria 1601
61 Ga0466704_057833 3300042643 Unclassified 2038
62 Ga0466704_155932 3300042643 Bacteria 15582
63 Ga0466724_25680 3300042649 Bacteria 9309
64 Ga0466707_329962 3300042601 Bacteria 2878
65 Ga0466705_114791 3300042612 Bacteria 1158
66 Ga0466705_300996 3300042612 Bacteria 3423
67 Ga0466715_500910 3300042616 Bacteria 5251
68 Ga0466718_019767 3300042617 Bacteria 7184
69 Ga0466723_044505 3300042618 Bacteria 2686
70 Ga0466723_253640 3300042618 Bacteria 1538
71 Ga0466726_351877 3300042619 Bacteria 2136
72 Ga0123355_10193811 3300009826 Bacteria 2985
73 Ga0123355_10313629 3300009826 Bacteria 2122
74 Ga0123354_10000004 3300010882 Bacteria 302459
75 Ga0123354_10000072 3300010882 Bacteria 76600
76 SPBB_contig03540 2044078006 Bacteria 63375
77 Ga0123357_10002413 3300009784 Bacteria 20836
78 Ga0160458_105817 3300012832 Bacteria 1454
79 Ga0160444_100012 3300012841 Bacteria 428907
80 Ga0466735_017579 3300042624 Bacteria 10094
81 Ga0466735_164364 3300042624 Bacteria 1050
82 Ga0466703_016393 3300042636 Bacteria 3761
83 Ga0466704_561017 3300042643 Bacteria 4735
84 Ga0466709_296945 3300042648 Bacteria 1202
85 Ga0466708_258031 3300042652 Bacteria 97414
86 Ga0466725_403184 3300042654 Bacteria 4177
87 Ga0466721_105247 3300042608 Unclassified 1515
88 Ga0466705_154153 3300042612 Bacteria 12226
89 Ga0466705_190283 3300042612 Bacteria 1905
90 Ga0466715_391519 3300042616 Bacteria 2282
91 Ga0466723_014596 3300042618 Bacteria 2337
92 Ga0123356_10105601 3300010049 Bacteria 2710
93 Ga0104045_1006477 3300007085 Bacteria 3642
94 Ga0160434_100142 3300012850 Bacteria 38364
95 Ga0160457_1004082 3300012858 Unclassified 2405
96 Ga0466703_293193 3300042636 Bacteria 1252
97 Ga0466703_341015 3300042636 Bacteria 11925
98 Ga0466704_372172 3300042643 Bacteria 33142
99 Ga0466708_135327 3300042652 Bacteria 12406
100 Ga0466725_128830 3300042654 Bacteria 24699
101 Ga0466707_066689 3300042601 Bacteria 1757
102 Ga0466719_327244 3300042606 Bacteria 11780
103 Ga0466711_303380 3300042615 Bacteria 2211
104 Ga0466726_359862 3300042619 Bacteria 36577
105 Ga0466726_442039 3300042619 Bacteria 3543
106 Ga0123357_10090685 3300009784 Bacteria 3985
107 Ga0123355_10026728 3300009826 Bacteria 9313
108 Ga0123355_10120192 3300009826 Unclassified 4078
109 Ga0123355_10467972 3300009826 Bacteria 1577
110 Ga0415639_006384 3300038395 Bacteria 18820
111 Ga0466692_108272 3300042591 Bacteria 5844
112 Ga0466696_495612 3300042596 Bacteria 12760
113 Ga0466703_061840 3300042636 Bacteria 2782
114 Ga0466703_411701 3300042636 Bacteria 7729
115 Ga0466708_252247 3300042652 Bacteria 13096
116 Ga0466716_228390 3300042605 Bacteria 4409
117 Ga0466698_071743 3300042610 Bacteria 8935
118 Ga0466733_200059 3300042659 Bacteria 44789
119 Ga0466723_015013 3300042618 Bacteria 3055
120 Ga0466723_118771 3300042618 Bacteria 4682
121 Ga0466726_279914 3300042619 Bacteria 4838
122 Ga0123355_10206795 3300009826 Bacteria 2854
123 Ga0123353_10262449 3300010167 Bacteria 2666
124 IMNBGM34_c000232 3300000036 Bacteria 16190
125 Ga0102734_1000339 3300007129 Bacteria 14438
126 Ga0160440_100166 3300012815 Unclassified 57137
127 Ga0160452_100568 3300012834 Bacteria 21252
128 Ga0160433_100273 3300012846 Bacteria 35562
129 Ga0160435_1000337 3300012857 Bacteria 19144
130 Ga0466657_330303 3300042582 Bacteria 2755
131 Ga0466703_103794 3300042636 Bacteria 6558
132 Ga0466709_071434 3300042648 Bacteria 7453
133 Ga0466708_434825 3300042652 Bacteria 19165
134 Ga0466725_021422 3300042654 Bacteria 27571
135 Ga0466706_234010 3300042599 Bacteria 1548
136 Ga0466716_463731 3300042605 Unclassified 32929
137 Ga0466711_175373 3300042615 Bacteria 43795
138 Ga0466711_198696 3300042615 Bacteria 6310
139 Ga0466715_107160 3300042616 Bacteria 28699
140 Ga0123355_10122990 3300009826 Bacteria 4020
141 Ga0123356_10595852 3300010049 Unclassified 1270
142 Ga0123353_10341172 3300010167 Bacteria 2263
143 FGTW_contig11832 2065487013 Bacteria 7679
144 WW0001_100134 3300002732 Bacteria 240561
145 Ga0160433_100441 3300012846 Unclassified 21505
146 Ga0160433_102732 3300012846 Bacteria 3580
147 Ga0160445_106525 3300012847 Bacteria 1898
148 Ga0160435_1000236 3300012857 Bacteria 26109
149 Ga0466690_043179 3300042590 Bacteria 4175
150 Ga0466734_036359 3300042623 Bacteria 13681
151 Ga0466703_000112 3300042636 Bacteria 13081
152 Ga0466703_162466 3300042636 Bacteria 21407
153 Ga0466713_087656 3300042602 Bacteria 20607

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002732 WW0001_100134 WW0001_100134117 285
2 3300007188 Ga0103264_1000182 Ga0103264_100018236 295
3 3300042605 Ga0466716_463731 Ga0466716_463731_14786_15685 299
4 3300042618 Ga0466723_253640 Ga0466723_253640_545_1447 300
5 3300012834 Ga0160452_100568 Ga0160452_1005685 301
6 3300042596 Ga0466696_330098 Ga0466696_330098_2025_2963 301
7 3300042606 Ga0466719_327244 Ga0466719_327244_10026_10931 301
8 3300010049 Ga0123356_10595852 Ga0123356_105958521 302
9 3300012832 Ga0160458_105817 Ga0160458_1058171 304
10 3300042612 Ga0466705_113623 Ga0466705_113623_1355_2269 304
11 3300042636 Ga0466703_000112 Ga0466703_000112_11542_12456 304
12 iso_pr_bacteria 2820148564 2820148753 306
13 2065487013 FGTW_contig31084 FGTW_01727990 308
14 3300042582 Ga0466657_330303 Ga0466657_330303_131_1057 308
15 3300042612 Ga0466705_300996 Ga0466705_300996_769_1695 308
16 3300012803 Ga0160465_100058 Ga0160465_100058100 309
17 3300012831 Ga0160459_100019 Ga0160459_10001945 309
18 3300012846 Ga0160433_100441 Ga0160433_10044117 309
19 3300012846 Ga0160433_102732 Ga0160433_1027323 309
20 3300012850 Ga0160434_100142 Ga0160434_10014227 309
21 3300042615 Ga0466711_213989 Ga0466711_213989_8709_9638 309
22 3300042615 Ga0466711_218509 Ga0466711_218509_15_944 309
23 3300042619 Ga0466726_279914 Ga0466726_279914_2884_3813 309
24 3300042652 Ga0466708_323940 Ga0466708_323940_16767_17696 309
25 iso_pr_bacteria 2579779088 2582237403 309
26 iso_pr_bacteria 2579779088 2582239964 309
27 iso_pr_bacteria 2590828803 2592927886 309
28 iso_pr_bacteria 2820072841 2820074354 309
29 iso_pr_bacteria 2820176377 2820177333 309
30 iso_pr_bacteria 2989309576 2989313212 309
31 3300012824 Ga0160469_100015 Ga0160469_100015268 310
32 3300012847 Ga0160445_106525 Ga0160445_1065253 310
33 3300012858 Ga0160457_1004082 Ga0160457_10040824 310
34 3300042610 Ga0466698_360064 Ga0466698_360064_624_1556 310
35 3300042621 Ga0466729_246293 Ga0466729_246293_64683_65615 310
36 3300042648 Ga0466709_071434 Ga0466709_071434_809_1741 310
37 3300042654 Ga0466725_403184 Ga0466725_403184_704_1636 310
38 3300007085 Ga0104045_1006477 Ga0104045_10064772 311
39 3300012841 Ga0160444_100012 Ga0160444_10001229 311
40 3300012849 Ga0160447_100013 Ga0160447_100013309 311
41 3300042596 Ga0466696_266952 Ga0466696_266952_435_1370 311
42 3300042601 Ga0466707_066689 Ga0466707_066689_279_1214 311
43 3300042601 Ga0466707_329962 Ga0466707_329962_997_1932 311
44 3300042612 Ga0466705_114791 Ga0466705_114791_197_1132 311
45 3300042612 Ga0466705_154153 Ga0466705_154153_10685_11620 311
46 3300042616 Ga0466715_209279 Ga0466715_209279_3723_4658 311
47 3300042616 Ga0466715_391519 Ga0466715_391519_1145_2080 311
48 3300042636 Ga0466703_411701 Ga0466703_411701_5570_6505 311
49 3300042643 Ga0466704_057833 Ga0466704_057833_596_1531 311
50 3300042643 Ga0466704_080327 Ga0466704_080327_23449_24384 311
51 3300042643 Ga0466704_561017 Ga0466704_561017_670_1605 311
52 3300042652 Ga0466708_135327 Ga0466708_135327_5347_6282 311
53 3300042654 Ga0466725_021422 Ga0466725_021422_14120_15055 311
54 iso_pr_bacteria 2706794701 2708046544 311
55 3300005201 Ga0072941_1050718 Ga0072941_10507182 312
56 3300010882 Ga0123354_10007985 Ga0123354_100079852 312
57 3300012858 Ga0160457_1000028 Ga0160457_1000028180 312
58 3300042609 Ga0466722_044060 Ga0466722_044060_504_1442 312
59 3300042609 Ga0466722_088384 Ga0466722_088384_347_1285 312
60 3300042615 Ga0466711_175373 Ga0466711_175373_29100_30038 312
61 3300042616 Ga0466715_161244 Ga0466715_161244_1481_2419 312
62 3300042616 Ga0466715_163430 Ga0466715_163430_4337_5275 312
63 3300042617 Ga0466718_019767 Ga0466718_019767_3141_4079 312
64 3300042622 Ga0466731_305906 Ga0466731_305906_474_1412 312
65 3300042636 Ga0466703_016393 Ga0466703_016393_1012_1950 312
66 3300042636 Ga0466703_071340 Ga0466703_071340_649_1587 312
67 3300042643 Ga0466704_155932 Ga0466704_155932_1870_2808 312
68 iso_pr_bacteria 2508501067 2508835254 312
69 iso_pr_bacteria 2517572100 2517757293 312
70 iso_pr_bacteria 2639763185 2642345986 312
71 iso_pr_bacteria 2639763186 2642352579 312
72 iso_pr_bacteria 2857493320 2857497117 312
73 iso_pr_bacteria 2857498920 2857503681 312
74 iso_pr_bacteria 2873562573 2873565030 312
75 3300038395 Ga0415639_006384 Ga0415639_006384_8640_9581 313
76 3300042596 Ga0466696_429505 Ga0466696_429505_292_1233 313
77 3300042616 Ga0466715_500910 Ga0466715_500910_2697_3638 313
78 3300042618 Ga0466723_315871 Ga0466723_315871_5634_6575 313
79 3300042636 Ga0466703_061840 Ga0466703_061840_1329_2270 313
80 3300042636 Ga0466703_293193 Ga0466703_293193_252_1193 313
81 3300042636 Ga0466703_366247 Ga0466703_366247_343_1284 313
82 3300042648 Ga0466709_296945 Ga0466709_296945_144_1085 313
83 3300042649 Ga0466724_25680 Ga0466724_25680_1298_2239 313
84 3300042652 Ga0466708_434825 Ga0466708_434825_13058_13999 313
85 iso_pr_bacteria 2820382897 2820385038 313
86 iso_pr_bacteria 8024031916 8024034333 313
87 3300002501 JGI24703J35330_11748872 JGI24703J35330_1174887264 314
88 3300042596 Ga0466696_495612 Ga0466696_495612_4007_4951 314
89 3300042608 Ga0466721_105247 Ga0466721_105247_304_1248 314
90 3300042610 Ga0466698_071743 Ga0466698_071743_5864_6808 314
91 3300042612 Ga0466705_382083 Ga0466705_382083_4426_5370 314
92 3300042615 Ga0466711_258618 Ga0466711_258618_3004_3948 314
93 3300042616 Ga0466715_107160 Ga0466715_107160_27128_28072 314
94 3300042618 Ga0466723_044505 Ga0466723_044505_545_1489 314
95 3300042624 Ga0466735_164364 Ga0466735_164364_66_1010 314
96 3300042652 Ga0466708_258031 Ga0466708_258031_79914_80858 314
97 iso_pr_bacteria 2820044805 2820046004 314
98 3300010882 Ga0123354_10000072 Ga0123354_1000007231 315
99 3300012805 Ga0160464_100009 Ga0160464_10000949 315
100 3300012824 Ga0160469_100071 Ga0160469_10007195 315
101 3300012850 Ga0160434_100006 Ga0160434_100006299 315
102 3300012854 Ga0160448_101819 Ga0160448_1018194 315
103 3300012857 Ga0160435_1000337 Ga0160435_100033712 315
104 3300042619 Ga0466726_359862 Ga0466726_359862_35381_36328 315
105 3300042624 Ga0466735_017579 Ga0466735_017579_1263_2210 315
106 3300042636 Ga0466703_162466 Ga0466703_162466_3360_4307 315
107 3300042636 Ga0466703_183310 Ga0466703_183310_1582_2529 315
108 iso_pr_bacteria 2821312900 2821313142 315
109 3300010882 Ga0123354_10000004 Ga0123354_10000004243 316
110 3300042590 Ga0466690_043179 Ga0466690_043179_500_1450 316
111 3300042612 Ga0466705_190283 Ga0466705_190283_250_1200 316
112 3300042615 Ga0466711_198696 Ga0466711_198696_3083_4033 316
113 3300042618 Ga0466723_118771 Ga0466723_118771_2175_3125 316
114 3300042636 Ga0466703_103794 Ga0466703_103794_3423_4373 316
115 3300042655 Ga0466727_181029 Ga0466727_181029_11305_12255 316
116 3300042659 Ga0466733_200059 Ga0466733_200059_9917_10867 316
117 iso_pr_bacteria 8025708040 8025711814 316
118 iso_pr_bacteria 8102109360 8102113894 316
119 iso_pr_bacteria 8102193924 8102197696 316
120 2044078006 SPBB_contig03540 SPBB_868350 317
121 3300000036 IMNBGM34_c000232 IMNBGM34_0002328 317
122 3300012815 Ga0160440_100166 Ga0160440_10016631 317
123 3300042619 Ga0466726_079589 Ga0466726_079589_28114_29067 317
124 3300042619 Ga0466726_442039 Ga0466726_442039_775_1728 317
125 iso_pr_bacteria 8023724303 8023730209 317
126 iso_pr_bacteria 8023757577 8023763483 317
127 iso_pr_bacteria 8023764196 8023770428 317
128 iso_pr_bacteria 8024001094 8024003208 317
129 iso_pr_bacteria 8025747911 8025750179 317
130 iso_pr_bacteria 8025756023 8025758290 317
131 iso_pr_bacteria 8069755105 8069757373 317
132 iso_pr_bacteria 8102041249 8102043351 317
133 iso_pr_bacteria 8102060671 8102062955 317
134 iso_pr_bacteria 8102074813 8102077028 317
135 iso_pr_bacteria 8102087471 8102089599 317
136 iso_pr_bacteria 8102145433 8102151339 317
137 iso_pr_bacteria 8102152052 8102158284 317
138 iso_pr_bacteria 8102161003 8102167080 317
139 3300042612 Ga0466705_173790 Ga0466705_173790_3036_3992 318
140 3300042654 Ga0466725_128830 Ga0466725_128830_21726_22682 318
141 iso_pr_bacteria 2597489944 2598058222 318
142 iso_pr_bacteria 8023747282 8023750469 318
143 iso_pr_bacteria 8023752828 8023754447 318
144 iso_pr_bacteria 8024014383 8024016373 318
145 iso_pr_bacteria 8024019580 8024020394 318
146 iso_pr_bacteria 8024025509 8024026205 318
147 iso_pr_bacteria 8024044713 8024046800 318
148 iso_pr_bacteria 8025650824 8025653141 318
149 iso_pr_bacteria 8025658853 8025661295 318
150 iso_pr_bacteria 8025666332 8025668343 318
151 iso_pr_bacteria 8025671076 8025673235 318
152 iso_pr_bacteria 8025678175 8025680171 318
153 iso_pr_bacteria 8025685901 8025688612 318
154 iso_pr_bacteria 8025694439 8025696885 318
155 iso_pr_bacteria 8025701579 8025706740 318
156 iso_pr_bacteria 8025723035 8025725016 318
157 iso_pr_bacteria 8025728939 8025731282 318
158 iso_pr_bacteria 8025735396 8025736903 318
159 iso_pr_bacteria 8069770227 8069773414 318
160 iso_pr_bacteria 8069775773 8069777392 318
161 iso_pr_bacteria 8102014801 8102016910 318
162 iso_pr_bacteria 8102020860 8102023312 318
163 iso_pr_bacteria 8102054868 8102056933 318
164 iso_pr_bacteria 8102081745 8102083916 318
165 iso_pr_bacteria 8102169119 8102170626 318
166 iso_pr_bacteria 8102174626 8102176969 318
167 iso_pr_bacteria 8102181083 8102183064 318
168 iso_pr_bacteria 8102201977 8102207138 318
169 iso_pr_bacteria 8102208438 8102210755 318
170 iso_pr_bacteria 8102216467 8102218913 318
171 iso_pr_bacteria 8102223607 8102225766 318
172 iso_pr_bacteria 8102230706 8102233417 318
173 iso_pr_bacteria 8102239244 8102241239 318
174 iso_pr_bacteria 8102246966 8102248977 318
175 iso_pr_bacteria 8102251710 8102254152 318
176 3300042595 Ga0466695_219101 Ga0466695_219101_137_1096 319
177 3300042599 Ga0466706_234010 Ga0466706_234010_386_1345 319
178 3300042610 Ga0466698_498766 Ga0466698_498766_2128_3087 319
179 3300042612 Ga0466705_247256 Ga0466705_247256_2508_3467 319
180 iso_pr_bacteria 2820110010 2820110611 319
181 iso_pr_bacteria 2839785767 2839786458 319
182 3300007129 Ga0102734_1000339 Ga0102734_10003399 320
183 3300007129 Ga0102734_1006011 Ga0102734_10060113 320
184 3300009784 Ga0123357_10002413 Ga0123357_1000241313 320
185 3300042612 Ga0466705_316131 Ga0466705_316131_258_1220 320
186 3300042618 Ga0466723_014596 Ga0466723_014596_1037_1999 320
187 iso_pr_bacteria 2898991528 2898993031 320
188 iso_pr_bacteria 8102094248 8102100382 320
189 3300009784 Ga0123357_10090685 Ga0123357_100906852 321
190 3300010049 Ga0123356_10259800 Ga0123356_102598002 321
191 3300042602 Ga0466713_087656 Ga0466713_087656_2521_3486 321
192 3300042621 Ga0466729_088380 Ga0466729_088380_1296_2261 321
193 3300042636 Ga0466703_341015 Ga0466703_341015_9508_10473 321
194 3300042643 Ga0466704_372172 Ga0466704_372172_10165_11130 321
195 iso_pr_bacteria 2630969010 2634123656 321
196 iso_pr_bacteria 2931430189 2931430743 321
197 3300007083 Ga0103261_1000033 Ga0103261_100003349 322
198 3300007141 Ga0102738_1000070 Ga0102738_100007029 322
199 3300009826 Ga0123355_10026728 Ga0123355_100267283 322
200 3300009826 Ga0123355_10467972 Ga0123355_104679722 322
201 3300042615 Ga0466711_032812 Ga0466711_032812_506_1474 322
202 3300042616 Ga0466715_163167 Ga0466715_163167_48_1016 322
203 iso_pr_bacteria 2820803007 2820804883 322
204 iso_pr_bacteria 8021540981 8021545715 322
205 iso_pr_bacteria 8021546568 8021549050 322
206 3300007139 Ga0103260_1000178 Ga0103260_100017811 323
207 3300009826 Ga0123355_10206795 Ga0123355_102067952 323
208 3300010167 Ga0123353_10341172 Ga0123353_103411722 323
209 3300012857 Ga0160435_1000236 Ga0160435_100023613 323
210 3300042605 Ga0466716_228390 Ga0466716_228390_3038_4009 323
211 3300042612 Ga0466705_269072 Ga0466705_269072_2123_3094 323
212 3300042619 Ga0466726_351877 Ga0466726_351877_654_1625 323
213 iso_pr_bacteria 2548876931 2550377640 323
214 iso_pr_bacteria 2870361953 2870363061 323
215 iso_pr_bacteria 2896321640 2896324859 323
216 iso_pr_bacteria 2896330536 2896333306 323
217 iso_pr_bacteria 2896350215 2896353365 323
218 iso_pr_bacteria 2898741527 2898744444 323
219 iso_pr_bacteria 3000478755 3000480448 323
220 2065487013 FGTW_contig11832 FGTW_02625810 324
221 3300000333 HBC_ctgsDRAFT_1000255 HBC_ctgsDRAFT_10002556 324
222 3300012846 Ga0160433_100273 Ga0160433_1002731 324
223 3300042615 Ga0466711_110923 Ga0466711_110923_3081_4055 324
224 3300042615 Ga0466711_303380 Ga0466711_303380_455_1429 324
225 iso_pr_bacteria 8069511479 8069512761 324
226 3300010167 Ga0123353_10262449 Ga0123353_102624492 325
227 3300042623 Ga0466734_036359 Ga0466734_036359_10453_11430 325
228 3300042652 Ga0466708_252247 Ga0466708_252247_9222_10199 325
229 iso_pr_bacteria 2918394494 2918395835 325
230 3300002504 JGI24705J35276_12149818 JGI24705J35276_121498181 327
231 3300009826 Ga0123355_10120192 Ga0123355_101201923 327
232 3300009826 Ga0123355_10122990 Ga0123355_101229902 327
233 3300009826 Ga0123355_10313629 Ga0123355_103136292 327
234 3300010049 Ga0123356_10105601 Ga0123356_101056012 327
235 iso_pr_bacteria 2523533511 2523593004 327
236 iso_pr_bacteria 2912817845 2912818068 327
237 iso_pr_bacteria 647000328 647330621 327
238 3300010049 Ga0123356_10011431 Ga0123356_100114319 328
239 3300042616 Ga0466715_570949 Ga0466715_570949_7624_8613 329
240 3300042618 Ga0466723_015013 Ga0466723_015013_1055_2044 329
241 3300009826 Ga0123355_10193811 Ga0123355_101938112 331
242 3300010049 Ga0123356_10239407 Ga0123356_102394072 331
243 3300042591 Ga0466692_108272 Ga0466692_108272_3639_4637 332
244 iso_pr_bacteria 3003869270 3003871986 335
245 iso_pr_bacteria 3003878002 3003881019 335
246 iso_pr_bacteria 2724678956 2724788892 337
247 iso_pr_bacteria 8102117041 8102123146 353
248 iso_pr_bacteria 8102124461 8102130564 353
249 iso_pr_bacteria 8102138357 8102144147 353
250 3300042612 Ga0466705_456115 Ga0466705_456115_809_1927 372
251 3300042652 Ga0466708_232353 Ga0466708_232353_97073_98395 440

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01370 Epimerase NAD dependent epimerase/dehydratase family 67 298 0.97
PF04321 RmlD_sub_bind RmlD substrate binding domain 66 210 0.84
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 99 359 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.