Protein Family IF07230
Metagenome
Isolate
123
Members
68
Samples
104
Scaffolds
252.46
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_432912|Ga0466705_432912_741_1619
- Length
- 292 aa
- Sequence
- MSVRMIGFFRATLRIFRNVARAIPPCVRSDIHSIATLTTRRHDMLQGKTALVTGGSRGIGRAIARALYDSGARVYINSRSRDDLIRAAAEMDVRKTGDILPLPFDVAVPDACRRAVSQIEADGKGLHILVNCAGINLRGPLEAMPEQTWDQVLNVNLKSMFVLAQAAFPLLKAGGGKIINIASLMSELARPNIAAYAASKGGVRQLTRAMAVEWAQYNIQANAIAPGYIETELNAPLIQDKEFNRFVVNRTPAKKWGKPEDIAAMAVFLASPGSDFVTGQIIGVDGGILASL
Sample Types
Isolate
15.4%
Metagenome
84.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.8%
Unclassified
17.9%
Kalotermitidae
17.9%
Formicidae
10.4%
Rhinotermitidae
6.0%
Termopsidae
4.5%
Culicidae
3.0%
Armadillidiidae
1.5%
Blaberidae
1.5%
Tenebrionidae
1.5%
Hodotermitidae
1.5%
Passalidae
1.5%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 4 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 9 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 21 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 22 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 23 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 26 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 27 | 2802429587 | Spiroplasma eriocheiris CCTCC 'M 207170' | Isolate | Unclassified |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 32 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 33 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 34 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 45 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 47 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 48 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 49 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 50 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 53 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 58 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 59 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 60 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 61 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 62 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 63 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 64 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 65 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 66 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_311333 | 3300042612 | Bacteria | 3087 |
| 2 | Ga0466732_075537 | 3300042656 | Bacteria | 1576 |
| 3 | Ga0466703_339085 | 3300042636 | Bacteria | 1755 |
| 4 | Ga0466705_432912 | 3300042612 | Bacteria | 2809 |
| 5 | Ga0466718_041388 | 3300042617 | Bacteria | 8867 |
| 6 | Ga0466718_134482 | 3300042617 | Bacteria | 2113 |
| 7 | Ga0466726_030846 | 3300042619 | Bacteria | 19838 |
| 8 | Ga0466726_092246 | 3300042619 | Bacteria | 2417 |
| 9 | Ga0466729_018861 | 3300042621 | Bacteria | 1614 |
| 10 | Ga0123356_10194198 | 3300010049 | Bacteria | 2064 |
| 11 | Ga0466692_124923 | 3300042591 | Bacteria | 22210 |
| 12 | Ga0466696_160516 | 3300042596 | Bacteria | 7636 |
| 13 | Ga0466707_026131 | 3300042601 | Bacteria | 1499 |
| 14 | Ga0466722_091473 | 3300042609 | Bacteria | 4038 |
| 15 | Ga0466705_188708 | 3300042612 | Bacteria | 5808 |
| 16 | Ga0466730_043036 | 3300042625 | Bacteria | 1466 |
| 17 | Ga0466709_024772 | 3300042648 | Bacteria | 2739 |
| 18 | Ga0466724_50680 | 3300042649 | Bacteria | 10379 |
| 19 | Ga0466708_006559 | 3300042652 | Bacteria | 6806 |
| 20 | Ga0466708_154812 | 3300042652 | Bacteria | 3514 |
| 21 | Ga0466715_161619 | 3300042616 | Bacteria | 3204 |
| 22 | Ga0466715_365643 | 3300042616 | Bacteria | 45568 |
| 23 | Ga0072940_1123518 | 3300005200 | Bacteria | 5023 |
| 24 | Ga0456237_0007582 | 3300041968 | Bacteria | 1666 |
| 25 | Ga0466694_366110 | 3300042594 | Bacteria | 4931 |
| 26 | Ga0466696_114440 | 3300042596 | Bacteria | 1703 |
| 27 | Ga0466700_047995 | 3300042600 | Bacteria | 1009 |
| 28 | Ga0466703_052385 | 3300042636 | Bacteria | 263776 |
| 29 | Ga0466704_470527 | 3300042643 | Bacteria | 8685 |
| 30 | Ga0466723_033321 | 3300042618 | Bacteria | 11052 |
| 31 | Ga0466728_253246 | 3300042620 | Bacteria | 1738 |
| 32 | Ga0123356_10747579 | 3300010049 | Bacteria | 1148 |
| 33 | Ga0123353_10000737 | 3300010167 | Bacteria | 39925 |
| 34 | Ga0123353_10005439 | 3300010167 | Bacteria | 16718 |
| 35 | IMNBL1DRAFT_c0000794 | 3300000062 | Bacteria | 24891 |
| 36 | JGI24698J34947_10003689 | 3300002449 | Bacteria | 8328 |
| 37 | Ga0160469_101093 | 3300012824 | Bacteria | 8272 |
| 38 | Ga0415639_137111 | 3300038395 | Bacteria | 2361 |
| 39 | Ga0466692_037555 | 3300042591 | Bacteria | 1271 |
| 40 | Ga0466692_167958 | 3300042591 | Bacteria | 33739 |
| 41 | Ga0466691_053228 | 3300042593 | Bacteria | 1773 |
| 42 | Ga0466694_259557 | 3300042594 | Bacteria | 21609 |
| 43 | Ga0466706_091071 | 3300042599 | Bacteria | 23757 |
| 44 | Ga0466722_015862 | 3300042609 | Bacteria | 6004 |
| 45 | Ga0466722_023078 | 3300042609 | Bacteria | 2719 |
| 46 | Ga0466697_146450 | 3300042611 | Bacteria | 1095 |
| 47 | Ga0466703_415837 | 3300042636 | Bacteria | 3133 |
| 48 | Ga0466715_346322 | 3300042616 | Bacteria | 84028 |
| 49 | Ga0466729_179610 | 3300042621 | Bacteria | 2935 |
| 50 | 2212252106 | 2209111004 | Bacteria | 19946 |
| 51 | Ga0072941_1007622 | 3300005201 | Bacteria | 5832 |
| 52 | Ga0466696_256957 | 3300042596 | Bacteria | 3377 |
| 53 | Ga0466699_025122 | 3300042597 | Bacteria | 22075 |
| 54 | Ga0466713_035109 | 3300042602 | Bacteria | 33660 |
| 55 | Ga0466714_148181 | 3300042603 | Bacteria | 1847 |
| 56 | Ga0466716_290566 | 3300042605 | Bacteria | 7815 |
| 57 | Ga0466720_010076 | 3300042607 | Unclassified | 1001 |
| 58 | Ga0466704_424088 | 3300042643 | Bacteria | 4568 |
| 59 | Ga0123355_10094729 | 3300009826 | Bacteria | 4723 |
| 60 | Ga0123356_11426749 | 3300010049 | Bacteria | 852 |
| 61 | Ga0072941_1035102 | 3300005201 | Bacteria | 3788 |
| 62 | Ga0160448_100097 | 3300012854 | Bacteria | 46233 |
| 63 | Ga0466720_169314 | 3300042607 | Bacteria | 2138 |
| 64 | Ga0466722_188166 | 3300042609 | Bacteria | 3355 |
| 65 | Ga0466705_141906 | 3300042612 | Bacteria | 2912 |
| 66 | Ga0562378_1256 | 3300056814 | Bacteria | 29033 |
| 67 | Ga0466735_233897 | 3300042624 | Bacteria | 2128 |
| 68 | Ga0466704_314145 | 3300042643 | Bacteria | 10943 |
| 69 | Ga0466709_405415 | 3300042648 | Bacteria | 4545 |
| 70 | Ga0466723_307690 | 3300042618 | Bacteria | 4438 |
| 71 | Ga0123356_10182905 | 3300010049 | Bacteria | 2119 |
| 72 | Ga0123353_10014814 | 3300010167 | Bacteria | 11273 |
| 73 | Ga0123353_10200682 | 3300010167 | Bacteria | 3138 |
| 74 | Ga0072940_1169207 | 3300005200 | Bacteria | 2974 |
| 75 | Ga0074263_116817 | 3300005485 | Bacteria | 2045 |
| 76 | Ga0466694_144664 | 3300042594 | Bacteria | 6041 |
| 77 | Ga0466721_363580 | 3300042608 | Bacteria | 32780 |
| 78 | Ga0466727_324264 | 3300042655 | Bacteria | 11116 |
| 79 | Ga0466715_379758 | 3300042616 | Bacteria | 14286 |
| 80 | Ga0123353_10005639 | 3300010167 | Bacteria | 16483 |
| 81 | Ga0466694_094636 | 3300042594 | Bacteria | 14148 |
| 82 | Ga0466717_251171 | 3300042604 | Bacteria | 3708 |
| 83 | Ga0466716_373457 | 3300042605 | Unclassified | 1864 |
| 84 | Ga0466722_064775 | 3300042609 | Bacteria | 19926 |
| 85 | Ga0466705_157672 | 3300042612 | Unclassified | 1905 |
| 86 | Ga0466732_116124 | 3300042656 | Unclassified | 1349 |
| 87 | Ga0466731_074222 | 3300042622 | Bacteria | 2653 |
| 88 | Ga0466735_067537 | 3300042624 | Bacteria | 9351 |
| 89 | Ga0466735_214518 | 3300042624 | Bacteria | 24406 |
| 90 | Ga0466730_070343 | 3300042625 | Bacteria | 1097 |
| 91 | Ga0466702_436447 | 3300042635 | Bacteria | 1021 |
| 92 | Ga0466709_397468 | 3300042648 | Bacteria | 4489 |
| 93 | Ga0466711_093710 | 3300042615 | Bacteria | 38238 |
| 94 | Ga0466711_109307 | 3300042615 | Bacteria | 29995 |
| 95 | Ga0466718_015029 | 3300042617 | Bacteria | 1262 |
| 96 | Ga0466723_044368 | 3300042618 | Bacteria | 8713 |
| 97 | Ga0466729_169275 | 3300042621 | Bacteria | 18398 |
| 98 | Ga0123355_10127961 | 3300009826 | Bacteria | 3920 |
| 99 | Ga0123353_10581164 | 3300010167 | Bacteria | 1607 |
| 100 | Meta3P_1000352 | 3300002464 | Bacteria | 49629 |
| 101 | Ga0466694_023028 | 3300042594 | Bacteria | 61948 |
| 102 | Ga0466706_274245 | 3300042599 | Bacteria | 7668 |
| 103 | Ga0466721_260838 | 3300042608 | Bacteria | 1232 |
| 104 | Ga0466722_054963 | 3300042609 | Bacteria | 3156 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042618 | Ga0466723_307690 | Ga0466723_307690_578_1339 | 236 |
| 2 | 3300042616 | Ga0466715_379758 | Ga0466715_379758_6893_7654 | 237 |
| 3 | 2209111004 | 2212252106 | 2212298083 | 238 |
| 4 | 3300005485 | Ga0074263_116817 | Ga0074263_1168172 | 239 |
| 5 | 3300042608 | Ga0466721_363580 | Ga0466721_363580_12782_13549 | 239 |
| 6 | 3300009826 | Ga0123355_10127961 | Ga0123355_101279615 | 240 |
| 7 | 3300042602 | Ga0466713_035109 | Ga0466713_035109_20342_21064 | 240 |
| 8 | 3300042611 | Ga0466697_146450 | Ga0466697_146450_162_920 | 240 |
| 9 | 3300012854 | Ga0160448_100097 | Ga0160448_10009733 | 241 |
| 10 | 3300042603 | Ga0466714_148181 | Ga0466714_148181_360_1127 | 242 |
| 11 | 3300042609 | Ga0466722_064775 | Ga0466722_064775_9742_10512 | 242 |
| 12 | 3300042649 | Ga0466724_50680 | Ga0466724_50680_6777_7553 | 242 |
| 13 | 3300042594 | Ga0466694_094636 | Ga0466694_094636_9097_9864 | 243 |
| 14 | 3300042612 | Ga0466705_311333 | Ga0466705_311333_1347_2114 | 243 |
| 15 | 3300042643 | Ga0466704_470527 | Ga0466704_470527_5529_6296 | 243 |
| 16 | 3300042612 | Ga0466705_141906 | Ga0466705_141906_115_882 | 244 |
| 17 | 3300042616 | Ga0466715_365643 | Ga0466715_365643_36169_36930 | 244 |
| 18 | 3300042652 | Ga0466708_006559 | Ga0466708_006559_5074_5841 | 244 |
| 19 | 3300042621 | Ga0466729_179610 | Ga0466729_179610_809_1576 | 245 |
| 20 | 3300010167 | Ga0123353_10005439 | Ga0123353_100054397 | 246 |
| 21 | 3300005200 | Ga0072940_1169207 | Ga0072940_11692072 | 248 |
| 22 | 3300012824 | Ga0160469_101093 | Ga0160469_1010933 | 248 |
| 23 | 3300042604 | Ga0466717_251171 | Ga0466717_251171_2478_3224 | 248 |
| 24 | 3300042617 | Ga0466718_134482 | Ga0466718_134482_1344_2090 | 248 |
| 25 | 3300042625 | Ga0466730_043036 | Ga0466730_043036_410_1156 | 248 |
| 26 | 3300042625 | Ga0466730_070343 | Ga0466730_070343_266_1012 | 248 |
| 27 | 3300042612 | Ga0466705_157672 | Ga0466705_157672_569_1318 | 249 |
| 28 | 3300042619 | Ga0466726_092246 | Ga0466726_092246_65_814 | 249 |
| 29 | 3300010167 | Ga0123353_10005639 | Ga0123353_100056398 | 250 |
| 30 | 3300041968 | Ga0456237_0007582 | Ga0456237_0007582_805_1572 | 250 |
| 31 | 3300042596 | Ga0466696_160516 | Ga0466696_160516_6086_6838 | 250 |
| 32 | 3300042601 | Ga0466707_026131 | Ga0466707_026131_231_983 | 250 |
| 33 | 3300042609 | Ga0466722_015862 | Ga0466722_015862_3355_4107 | 250 |
| 34 | 3300042618 | Ga0466723_033321 | Ga0466723_033321_2669_3421 | 250 |
| 35 | 3300042648 | Ga0466709_024772 | Ga0466709_024772_1750_2502 | 250 |
| 36 | iso_pr_bacteria | 2820539610 | 2820539769 | 250 |
| 37 | 3300042591 | Ga0466692_124923 | Ga0466692_124923_14761_15516 | 251 |
| 38 | 3300042596 | Ga0466696_114440 | Ga0466696_114440_569_1324 | 251 |
| 39 | 3300042599 | Ga0466706_091071 | Ga0466706_091071_5517_6272 | 251 |
| 40 | 3300042599 | Ga0466706_274245 | Ga0466706_274245_3002_3757 | 251 |
| 41 | 3300042616 | Ga0466715_161619 | Ga0466715_161619_752_1507 | 251 |
| 42 | 3300042616 | Ga0466715_346322 | Ga0466715_346322_75713_76468 | 251 |
| 43 | 3300042620 | Ga0466728_253246 | Ga0466728_253246_820_1575 | 251 |
| 44 | 3300042621 | Ga0466729_018861 | Ga0466729_018861_97_852 | 251 |
| 45 | 3300042624 | Ga0466735_233897 | Ga0466735_233897_480_1235 | 251 |
| 46 | 3300042643 | Ga0466704_314145 | Ga0466704_314145_9722_10477 | 251 |
| 47 | 3300042643 | Ga0466704_424088 | Ga0466704_424088_1218_1973 | 251 |
| 48 | 3300042648 | Ga0466709_405415 | Ga0466709_405415_3675_4430 | 251 |
| 49 | iso_pr_bacteria | 2820429680 | 2820430572 | 251 |
| 50 | 3300010167 | Ga0123353_10000737 | Ga0123353_1000073725 | 252 |
| 51 | 3300010167 | Ga0123353_10014814 | Ga0123353_1001481411 | 252 |
| 52 | 3300042636 | Ga0466703_052385 | Ga0466703_052385_160526_161284 | 252 |
| 53 | iso_pr_bacteria | 2820267566 | 2820270802 | 252 |
| 54 | 3300042596 | Ga0466696_256957 | Ga0466696_256957_1698_2459 | 253 |
| 55 | iso_pr_bacteria | 2820267566 | 2820271055 | 253 |
| 56 | iso_pr_bacteria | 2820525019 | 2820525874 | 253 |
| 57 | iso_pr_bacteria | 2912636047 | 2912639273 | 253 |
| 58 | 3300002464 | Meta3P_1000352 | Meta3P_100035215 | 254 |
| 59 | 3300009826 | Ga0123355_10094729 | Ga0123355_100947294 | 254 |
| 60 | 3300010049 | Ga0123356_10194198 | Ga0123356_101941982 | 254 |
| 61 | 3300010167 | Ga0123353_10581164 | Ga0123353_105811642 | 254 |
| 62 | 3300042600 | Ga0466700_047995 | Ga0466700_047995_104_868 | 254 |
| 63 | 3300042615 | Ga0466711_093710 | Ga0466711_093710_2222_2986 | 254 |
| 64 | 3300042636 | Ga0466703_415837 | Ga0466703_415837_132_896 | 254 |
| 65 | iso_pr_bacteria | 2574180310 | 2576358716 | 254 |
| 66 | 3300005200 | Ga0072940_1123518 | Ga0072940_11235184 | 255 |
| 67 | 3300038395 | Ga0415639_137111 | Ga0415639_137111_64_831 | 255 |
| 68 | 3300042591 | Ga0466692_037555 | Ga0466692_037555_451_1218 | 255 |
| 69 | 3300042594 | Ga0466694_023028 | Ga0466694_023028_34866_35633 | 255 |
| 70 | 3300042594 | Ga0466694_144664 | Ga0466694_144664_3889_4656 | 255 |
| 71 | 3300042594 | Ga0466694_259557 | Ga0466694_259557_4831_5598 | 255 |
| 72 | 3300042594 | Ga0466694_366110 | Ga0466694_366110_1236_2003 | 255 |
| 73 | 3300042597 | Ga0466699_025122 | Ga0466699_025122_255_1022 | 255 |
| 74 | 3300042607 | Ga0466720_010076 | Ga0466720_010076_153_920 | 255 |
| 75 | 3300042607 | Ga0466720_169314 | Ga0466720_169314_1184_1951 | 255 |
| 76 | 3300042608 | Ga0466721_260838 | Ga0466721_260838_48_815 | 255 |
| 77 | 3300042609 | Ga0466722_091473 | Ga0466722_091473_3113_3880 | 255 |
| 78 | 3300042609 | Ga0466722_188166 | Ga0466722_188166_1204_1971 | 255 |
| 79 | 3300042617 | Ga0466718_015029 | Ga0466718_015029_165_932 | 255 |
| 80 | 3300042617 | Ga0466718_041388 | Ga0466718_041388_3876_4643 | 255 |
| 81 | 3300042618 | Ga0466723_044368 | Ga0466723_044368_1160_1927 | 255 |
| 82 | 3300042619 | Ga0466726_030846 | Ga0466726_030846_13068_13835 | 255 |
| 83 | 3300042624 | Ga0466735_214518 | Ga0466735_214518_6976_7743 | 255 |
| 84 | 3300042635 | Ga0466702_436447 | Ga0466702_436447_68_835 | 255 |
| 85 | 3300042655 | Ga0466727_324264 | Ga0466727_324264_5791_6558 | 255 |
| 86 | 3300042656 | Ga0466732_075537 | Ga0466732_075537_335_1102 | 255 |
| 87 | 3300042656 | Ga0466732_116124 | Ga0466732_116124_475_1242 | 255 |
| 88 | iso_pr_bacteria | 2772190975 | 2773724220 | 255 |
| 89 | iso_pr_bacteria | 2781125656 | 2781321816 | 255 |
| 90 | iso_pr_bacteria | 2781125687 | 2781422451 | 255 |
| 91 | 3300002449 | JGI24698J34947_10003689 | JGI24698J34947_100036898 | 256 |
| 92 | 3300005201 | Ga0072941_1007622 | Ga0072941_10076222 | 256 |
| 93 | 3300005201 | Ga0072941_1035102 | Ga0072941_10351023 | 256 |
| 94 | 3300010049 | Ga0123356_10182905 | Ga0123356_101829052 | 256 |
| 95 | 3300010049 | Ga0123356_10747579 | Ga0123356_107475792 | 256 |
| 96 | 3300010049 | Ga0123356_11426749 | Ga0123356_114267491 | 256 |
| 97 | 3300010167 | Ga0123353_10200682 | Ga0123353_102006824 | 256 |
| 98 | 3300042591 | Ga0466692_167958 | Ga0466692_167958_863_1633 | 256 |
| 99 | 3300042593 | Ga0466691_053228 | Ga0466691_053228_87_857 | 256 |
| 100 | 3300042605 | Ga0466716_373457 | Ga0466716_373457_891_1661 | 256 |
| 101 | 3300042609 | Ga0466722_023078 | Ga0466722_023078_673_1443 | 256 |
| 102 | 3300042612 | Ga0466705_188708 | Ga0466705_188708_2560_3330 | 256 |
| 103 | 3300042615 | Ga0466711_109307 | Ga0466711_109307_21706_22476 | 256 |
| 104 | 3300042621 | Ga0466729_169275 | Ga0466729_169275_303_1073 | 256 |
| 105 | 3300042624 | Ga0466735_067537 | Ga0466735_067537_6310_7080 | 256 |
| 106 | 3300042648 | Ga0466709_397468 | Ga0466709_397468_369_1139 | 256 |
| 107 | 3300042652 | Ga0466708_154812 | Ga0466708_154812_2347_3117 | 256 |
| 108 | iso_pr_bacteria | 2671180625 | 2673531708 | 258 |
| 109 | iso_pr_bacteria | 2675903497 | 2678194257 | 258 |
| 110 | iso_pr_bacteria | 2856671350 | 2856671799 | 258 |
| 111 | iso_pr_bacteria | 2856947901 | 2856952750 | 258 |
| 112 | iso_pr_bacteria | 2856966858 | 2856967312 | 258 |
| 113 | iso_pr_bacteria | 2859977607 | 2859977783 | 258 |
| 114 | iso_pr_bacteria | 649989992 | 650095777 | 258 |
| 115 | 3300042636 | Ga0466703_339085 | Ga0466703_339085_632_1411 | 259 |
| 116 | iso_pr_bacteria | 646311952 | 646427710 | 259 |
| 117 | 3300000062 | IMNBL1DRAFT_c0000794 | IMNBL1DRAFT_000079421 | 260 |
| 118 | 3300042609 | Ga0466722_054963 | Ga0466722_054963_1665_2450 | 261 |
| 119 | 3300056814 | Ga0562378_1256 | Ga0562378_1256_11094_11888 | 264 |
| 120 | 3300042605 | Ga0466716_290566 | Ga0466716_290566_2424_3221 | 265 |
| 121 | 3300042622 | Ga0466731_074222 | Ga0466731_074222_1234_2031 | 265 |
| 122 | iso_pr_bacteria | 2802429587 | 2805847706 | 266 |
| 123 | 3300042612 | Ga0466705_432912 | Ga0466705_432912_741_1619 | 292 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.