Protein Family IF07222

Metagenome Isolate
111 Members
38 Samples
105 Scaffolds
522.06 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_414425|Ga0466705_414425_2438_4006
Length
508 aa
Sequence
MFLLFALALPLFAGQTGPTAIELWYGPAVTEAGPPPADWKALQLIRDRVNVNLTLSALPSNEGDQDVKINAAAAANNLPDLFMVRRPVLMNIIKVGLIAPVDSLYPLMPNRTKQHYDADATGYTTFNGQSYGLATPGAIIKNEGLLIRKDWLDNLGLKVPTTTDELFEVMRAFTTRDPDGNGRADTYGYGAFLEITPPWEEGLGRRLDPIFGAFGVAGTFNLTKAGAGLNIKKPAYFEALTYIKRMVDEKVIDPNWTSYGKDDFRAAWKQGRFGIMREQNAAFAAESNYAPFDKNFPKGEWLLIDPPKGPRGEQSVGVYTASYRIYAVSKKALDAGKGPAIARLLEWMSSDEGYFLLAFGEKGVNYLPDANGVPTVEGLPDPSRGYTRPEMQPLTQLRNMVYYNSEVELLARYPTYQAPTSGRTMSALTVLFDMQKRAWTPNIGSDTLPNPNADLKRFYEQGVIEFALGQRQLTQANWNAWVQEFGRMGGDQWEKDCLEAAEASGYIK

📊 Sample Types

Isolate 3.6%
Metagenome 96.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.5%
Termitidae 35.1%
Unclassified 10.8%
Termopsidae 5.4%
Rhinotermitidae 5.4%
Blaberidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
2 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
3 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
4 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
5 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
6 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
13 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
21 2772190975 Treponema sp. RmG30 Isolate Blaberidae
22 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
31 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_001436 3300042612 Bacteria 17855
2 Ga0466705_086011 3300042612 Bacteria 10166
3 Ga0466705_112086 3300042612 Bacteria 12461
4 Ga0466705_414425 3300042612 Bacteria 11317
5 Ga0466722_189076 3300042609 Bacteria 2861
6 Ga0415639_010394 3300038395 Bacteria 11605
7 Ga0466690_214071 3300042590 Bacteria 16418
8 Ga0466692_066278 3300042591 Bacteria 3508
9 Ga0466692_143855 3300042591 Bacteria 4958
10 Ga0466705_222187 3300042612 Bacteria 16736
11 Ga0466715_460929 3300042616 Bacteria 18133
12 Ga0466718_097298 3300042617 Bacteria 24857
13 Ga0466718_168964 3300042617 Bacteria 6403
14 Ga0466723_099606 3300042618 Bacteria 3290
15 AustNasuHG_c1001273 3300000089 Bacteria 9064
16 Ga0466704_263674 3300042643 Bacteria 3889
17 Ga0466704_387584 3300042643 Bacteria 5497
18 Ga0466704_480542 3300042643 Bacteria 2091
19 Ga0466708_177031 3300042652 Bacteria 25545
20 Ga0466713_075485 3300042602 Bacteria 3716
21 Ga0466716_238710 3300042605 Bacteria 8964
22 Ga0466716_335733 3300042605 Bacteria 3377
23 Ga0466719_561168 3300042606 Bacteria 2432
24 Ga0466720_018543 3300042607 Bacteria 131979
25 Ga0466722_063621 3300042609 Bacteria 6435
26 Ga0466722_166522 3300042609 Bacteria 7319
27 Ga0466690_186795 3300042590 Unclassified 2930
28 Ga0466690_390620 3300042590 Bacteria 26148
29 Ga0466696_090401 3300042596 Bacteria 10101
30 Ga0466705_126222 3300042612 Bacteria 8501
31 Ga0466705_321928 3300042612 Bacteria 28342
32 Ga0466711_325890 3300042615 Bacteria 8844
33 Ga0466726_287535 3300042619 Bacteria 15444
34 Ga0072941_1059593 3300005201 Bacteria 24866
35 Ga0072941_1141946 3300005201 Bacteria 3052
36 Ga0466731_350908 3300042622 Bacteria 3084
37 Ga0466704_033321 3300042643 Bacteria 22698
38 Ga0466709_216249 3300042648 Bacteria 16336
39 Ga0466690_012256 3300042590 Bacteria 3296
40 Ga0466691_079092 3300042593 Bacteria 17061
41 Ga0466712_178547 3300042614 Bacteria 12495
42 Ga0466715_238123 3300042616 Bacteria 9038
43 Ga0466723_013566 3300042618 Bacteria 7029
44 Ga0466723_168978 3300042618 Bacteria 11427
45 Ga0466728_244014 3300042620 Bacteria 12713
46 Ga0466703_155900 3300042636 Bacteria 4539
47 Ga0466704_171804 3300042643 Bacteria 7129
48 Ga0466704_479716 3300042643 Bacteria 8080
49 Ga0466708_330003 3300042652 Bacteria 2671
50 Ga0466727_168863 3300042655 Bacteria 13700
51 Ga0123356_10021945 3300010049 Bacteria 6029
52 Ga0466722_175899 3300042609 Bacteria 3869
53 Ga0466722_197142 3300042609 Bacteria 8548
54 Ga0466690_073261 3300042590 Bacteria 5050
55 Ga0466696_307974 3300042596 Bacteria 34055
56 Ga0466723_120222 3300042618 Bacteria 4260
57 Ga0466726_097959 3300042619 Bacteria 16779
58 Ga0072941_1021846 3300005201 Bacteria 9925
59 Ga0466703_152308 3300042636 Bacteria 7410
60 Ga0466703_191810 3300042636 Bacteria 6920
61 Ga0466704_119498 3300042643 Bacteria 6175
62 Ga0466704_295827 3300042643 Unclassified 5131
63 Ga0466709_018963 3300042648 Bacteria 10441
64 Ga0466708_145218 3300042652 Bacteria 21009
65 Ga0123356_10102484 3300010049 Bacteria 2748
66 Ga0466707_045710 3300042601 Bacteria 10942
67 Ga0466716_179575 3300042605 Bacteria 8078
68 Ga0466720_084737 3300042607 Bacteria 18029
69 Ga0466722_157764 3300042609 Bacteria 7540
70 Ga0466690_021839 3300042590 Bacteria 3785
71 Ga0466692_096783 3300042591 Bacteria 19299
72 Ga0466691_043739 3300042593 Bacteria 24323
73 Ga0466705_201292 3300042612 Bacteria 5199
74 Ga0466732_118680 3300042656 Bacteria 9111
75 Ga0466711_126039 3300042615 Bacteria 5250
76 Ga0466711_422352 3300042615 Bacteria 2434
77 Ga0466728_418472 3300042620 Bacteria 9456
78 Ga0072941_1048408 3300005201 Bacteria 3468
79 Ga0466704_302047 3300042643 Unclassified 4006
80 Ga0466722_051815 3300042609 Bacteria 15391
81 Ga0466690_124516 3300042590 Bacteria 9683
82 Ga0466691_127732 3300042593 Bacteria 11614
83 Ga0466694_244312 3300042594 Bacteria 37974
84 Ga0466733_208167 3300042659 Bacteria 31218
85 Ga0466718_016240 3300042617 Bacteria 3701
86 Ga0466723_293823 3300042618 Bacteria 10602
87 Ga0466704_095845 3300042643 Bacteria 89284
88 Ga0466709_178541 3300042648 Bacteria 10415
89 Ga0466708_038980 3300042652 Bacteria 16274
90 Ga0466727_030848 3300042655 Bacteria 2698
91 Ga0123356_10010623 3300010049 Bacteria 9021
92 Ga0466719_121316 3300042606 Unclassified 3043
93 Ga0466696_154301 3300042596 Bacteria 2829
94 Ga0466699_005997 3300042597 Bacteria 4766
95 Ga0466699_203058 3300042597 Bacteria 2531
96 Ga0466733_111851 3300042659 Bacteria 82439
97 Ga0466711_032414 3300042615 Bacteria 20943
98 Ga0466718_116758 3300042617 Bacteria 14641
99 JGI24698J34947_10012555 3300002449 Bacteria 4642
100 Ga0466704_042627 3300042643 Unclassified 6284
101 Ga0466709_179084 3300042648 Bacteria 4387
102 Ga0466708_147328 3300042652 Bacteria 8131
103 Ga0123354_10018989 3300010882 Bacteria 10795
104 Ga0466713_063109 3300042602 Bacteria 3833
105 Ga0466720_081487 3300042607 Bacteria 31706

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_005997 Ga0466699_005997_749_2296 494
2 3300042615 Ga0466711_325890 Ga0466711_325890_3693_5285 495
3 3300042612 Ga0466705_321928 Ga0466705_321928_13605_15179 498
4 3300042602 Ga0466713_075485 Ga0466713_075485_1316_2890 500
5 3300042643 Ga0466704_302047 Ga0466704_302047_1374_2936 500
6 3300042659 Ga0466733_208167 Ga0466733_208167_17126_18712 500
7 3300042607 Ga0466720_018543 Ga0466720_018543_3384_4955 501
8 3300042606 Ga0466719_121316 Ga0466719_121316_872_2452 503
9 3300042593 Ga0466691_127732 Ga0466691_127732_3594_5165 507
10 3300042615 Ga0466711_422352 Ga0466711_422352_566_2176 507
11 3300042643 Ga0466704_263674 Ga0466704_263674_1203_2768 507
12 3300042594 Ga0466694_244312 Ga0466694_244312_9561_11105 508
13 3300042612 Ga0466705_414425 Ga0466705_414425_2438_4006 508
14 3300042643 Ga0466704_171804 Ga0466704_171804_2627_4189 510
15 3300042612 Ga0466705_201292 Ga0466705_201292_1488_3050 511
16 3300042656 Ga0466732_118680 Ga0466732_118680_7093_8676 512
17 3300042609 Ga0466722_197142 Ga0466722_197142_4536_6077 513
18 3300038395 Ga0415639_010394 Ga0415639_010394_1605_3152 515
19 3300042619 Ga0466726_287535 Ga0466726_287535_4222_5808 515
20 3300010049 Ga0123356_10021945 Ga0123356_100219454 516
21 3300042612 Ga0466705_222187 Ga0466705_222187_12718_14268 516
22 3300042614 Ga0466712_178547 Ga0466712_178547_8185_9735 516
23 3300042643 Ga0466704_119498 Ga0466704_119498_3223_4773 516
24 3300002449 JGI24698J34947_10012555 JGI24698J34947_100125554 517
25 3300005201 Ga0072941_1021846 Ga0072941_10218463 518
26 3300005201 Ga0072941_1048408 Ga0072941_10484082 518
27 3300005201 Ga0072941_1059593 Ga0072941_10595932 518
28 3300005201 Ga0072941_1141946 Ga0072941_11419463 518
29 3300042590 Ga0466690_186795 Ga0466690_186795_357_1943 518
30 3300042590 Ga0466690_214071 Ga0466690_214071_2109_3665 518
31 3300042591 Ga0466692_096783 Ga0466692_096783_14967_16523 518
32 3300042643 Ga0466704_042627 Ga0466704_042627_907_2463 518
33 3300042590 Ga0466690_012256 Ga0466690_012256_290_1849 519
34 3300042612 Ga0466705_126222 Ga0466705_126222_5423_6982 519
35 3300042617 Ga0466718_097298 Ga0466718_097298_5293_6852 519
36 3300042636 Ga0466703_152308 Ga0466703_152308_2623_4182 519
37 3300042648 Ga0466709_178541 Ga0466709_178541_4862_6421 519
38 3300000089 AustNasuHG_c1001273 AustNasuHG_10012736 520
39 3300042591 Ga0466692_143855 Ga0466692_143855_1834_3396 520
40 3300042596 Ga0466696_154301 Ga0466696_154301_25_1587 520
41 3300042602 Ga0466713_063109 Ga0466713_063109_265_1827 520
42 3300042606 Ga0466719_561168 Ga0466719_561168_689_2251 520
43 3300042607 Ga0466720_081487 Ga0466720_081487_10272_11834 520
44 3300042612 Ga0466705_112086 Ga0466705_112086_10654_12216 520
45 3300042616 Ga0466715_238123 Ga0466715_238123_5019_6581 520
46 3300042617 Ga0466718_168964 Ga0466718_168964_112_1674 520
47 3300042620 Ga0466728_418472 Ga0466728_418472_4877_6439 520
48 3300042622 Ga0466731_350908 Ga0466731_350908_1392_2954 520
49 iso_pr_bacteria 2781125659 2781328293 520
50 3300042617 Ga0466718_016240 Ga0466718_016240_1486_3051 521
51 3300042617 Ga0466718_116758 Ga0466718_116758_6148_7713 521
52 3300042618 Ga0466723_168978 Ga0466723_168978_3089_4654 521
53 3300042643 Ga0466704_295827 Ga0466704_295827_1676_3241 521
54 3300042643 Ga0466704_387584 Ga0466704_387584_2164_3729 521
55 iso_pr_bacteria 2781125687 2781419836 521
56 3300010882 Ga0123354_10018989 Ga0123354_100189895 522
57 3300042590 Ga0466690_021839 Ga0466690_021839_1410_2978 522
58 3300042593 Ga0466691_043739 Ga0466691_043739_14947_16515 522
59 3300042596 Ga0466696_307974 Ga0466696_307974_24742_26310 522
60 3300042605 Ga0466716_179575 Ga0466716_179575_2173_3741 522
61 3300042609 Ga0466722_157764 Ga0466722_157764_285_1853 522
62 3300042609 Ga0466722_175899 Ga0466722_175899_1201_2769 522
63 3300042618 Ga0466723_120222 Ga0466723_120222_276_1844 522
64 3300042636 Ga0466703_155900 Ga0466703_155900_41_1609 522
65 3300042636 Ga0466703_191810 Ga0466703_191810_41_1609 522
66 3300042590 Ga0466690_124516 Ga0466690_124516_7285_8856 523
67 3300042607 Ga0466720_084737 Ga0466720_084737_12146_13717 523
68 3300042615 Ga0466711_126039 Ga0466711_126039_23_1639 523
69 3300042652 Ga0466708_038980 Ga0466708_038980_12722_14293 523
70 iso_pr_bacteria 2503904012 2503956322 523
71 3300042596 Ga0466696_090401 Ga0466696_090401_7616_9190 524
72 3300042609 Ga0466722_189076 Ga0466722_189076_702_2276 524
73 3300042616 Ga0466715_460929 Ga0466715_460929_12971_14545 524
74 3300042619 Ga0466726_097959 Ga0466726_097959_3269_4843 524
75 3300042620 Ga0466728_244014 Ga0466728_244014_3224_4798 524
76 3300042652 Ga0466708_330003 Ga0466708_330003_429_2003 524
77 iso_pr_bacteria 2772190975 2773724267 524
78 3300042591 Ga0466692_066278 Ga0466692_066278_603_2180 525
79 3300042597 Ga0466699_203058 Ga0466699_203058_242_1819 525
80 3300042612 Ga0466705_001436 Ga0466705_001436_3050_4627 525
81 3300042612 Ga0466705_086011 Ga0466705_086011_5364_6941 525
82 3300042643 Ga0466704_033321 Ga0466704_033321_3731_5308 525
83 3300042648 Ga0466709_018963 Ga0466709_018963_5456_7033 525
84 3300042648 Ga0466709_216249 Ga0466709_216249_9169_10746 525
85 3300042590 Ga0466690_073261 Ga0466690_073261_2003_3583 526
86 3300042593 Ga0466691_079092 Ga0466691_079092_4651_6231 526
87 3300042601 Ga0466707_045710 Ga0466707_045710_9324_10904 526
88 3300042605 Ga0466716_335733 Ga0466716_335733_610_2190 526
89 3300042615 Ga0466711_032414 Ga0466711_032414_4365_5945 526
90 3300042618 Ga0466723_293823 Ga0466723_293823_7749_9329 526
91 3300042643 Ga0466704_095845 Ga0466704_095845_3112_4692 526
92 3300042643 Ga0466704_480542 Ga0466704_480542_441_2021 526
93 3300042652 Ga0466708_147328 Ga0466708_147328_6026_7606 526
94 3300042609 Ga0466722_063621 Ga0466722_063621_4838_6421 527
95 3300042643 Ga0466704_479716 Ga0466704_479716_983_2566 527
96 3300042655 Ga0466727_168863 Ga0466727_168863_301_1917 527
97 3300042618 Ga0466723_099606 Ga0466723_099606_1573_3159 528
98 3300010049 Ga0123356_10102484 Ga0123356_101024842 529
99 3300042609 Ga0466722_051815 Ga0466722_051815_10827_12416 529
100 3300010049 Ga0123356_10010623 Ga0123356_100106232 532
101 3300042648 Ga0466709_179084 Ga0466709_179084_1445_3043 532
102 3300042652 Ga0466708_145218 Ga0466708_145218_12676_14277 533
103 3300042659 Ga0466733_111851 Ga0466733_111851_47425_49059 534
104 3300042605 Ga0466716_238710 Ga0466716_238710_2404_4011 535
105 3300042655 Ga0466727_030848 Ga0466727_030848_539_2149 536
106 3300042609 Ga0466722_166522 Ga0466722_166522_3213_4826 537
107 3300042652 Ga0466708_177031 Ga0466708_177031_12334_13965 543
108 3300042590 Ga0466690_390620 Ga0466690_390620_5481_7160 559
109 3300042593 Ga0466691_127732 Ga0466691_127732_6311_8005 564
110 3300042618 Ga0466723_013566 Ga0466723_013566_3486_5189 567
111 3300042652 Ga0466708_147328 Ga0466708_147328_4161_5987 608

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein 52 353 0.69

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.