Protein Family IF07220

Metagenome Isolate
134 Members
62 Samples
112 Scaffolds
305.47 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_411798|Ga0466705_411798_1413_2492
Length
359 aa
Sequence
VALAGTTLGRNARRRGERRFGFVATFFGVPASIRAWPAAGEKNKSIKTAEFIMRTIKLGQSELQVPVVAVGCMRLHRLGAGGEAERFVQTALDQGANFFDHADIYGGGTCEEIFAGAVRSLGIAREKLILQSKCGIVRGRLVDFSREHILDSVDGSLRRLRTDYLDVLLLHRPDALVEPEEVAGAFDVLHASGKVRHFGVSNQNPMQIRLLQKSLRQPVVANQLQLSITNATMISAGIHVNMLEDSSVDRDGGALDFCRLENITVQPWSPFQYGFFEGVFLDNEKFPKLNAKINELAAKYQVSNTTIAIAWLLRHPANMQPVTGTMNIGRLRDCIKAADVRITREEWYAIYLAAGNTLP

📊 Sample Types

Isolate 16.4%
Metagenome 83.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.4%
Unclassified 23.7%
Kalotermitidae 22.0%
Anthocoridae 15.3%
Termopsidae 5.1%
Passalidae 3.4%
Tenebrionidae 1.7%
Rhinotermitidae 1.7%
Culicidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
2 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
7 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
8 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
20 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
21 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
22 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
23 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
24 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
25 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
33 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
34 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
35 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
36 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
40 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
41 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
42 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
43 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
44 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
45 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
46 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
47 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
48 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
49 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
54 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
55 2820556368 Unclassified Firmicutes Emb289P3bin92 Isolate Unclassified
56 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
57 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
58 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
59 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
60 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
61 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
62 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_089492 3300042659 Bacteria 4164
2 Ga0466733_217788 3300042659 Bacteria 53499
3 Ga0466700_370882 3300042600 Bacteria 1275
4 Ga0466705_414056 3300042612 Bacteria 3533
5 Ga0466726_092176 3300042619 Bacteria 2392
6 Ga0123354_10000089 3300010882 Bacteria 67418
7 Ga0466735_229830 3300042624 Unclassified 1272
8 Ga0466704_512941 3300042643 Bacteria 93161
9 JGI24702J35022_10015917 3300002462 Bacteria 4129
10 Ga0466707_204692 3300042601 Bacteria 8011
11 Ga0466713_133521 3300042602 Bacteria 7812
12 Ga0466717_000565 3300042604 Unclassified 1563
13 Ga0415639_075976 3300038395 Bacteria 1289
14 Ga0466690_034409 3300042590 Bacteria 24502
15 Ga0466691_056657 3300042593 Bacteria 6726
16 Ga0466710_210447 3300042613 Bacteria 1328
17 Ga0466711_310514 3300042615 Bacteria 10649
18 Ga0466723_265899 3300042618 Bacteria 8925
19 Ga0466728_084080 3300042620 Bacteria 4069
20 Ga0466729_081032 3300042621 Bacteria 2498
21 Ga0123354_10002881 3300010882 Bacteria 23311
22 Ga0466704_187939 3300042643 Unclassified 1956
23 IMNBL1DRAFT_c0004495 3300000062 Bacteria 8350
24 Ga0466713_013068 3300042602 Bacteria 13302
25 Ga0466714_157828 3300042603 Bacteria 2152
26 Ga0160470_100273 3300012813 Bacteria 35361
27 Ga0466715_219705 3300042616 Bacteria 26050
28 Ga0466726_021787 3300042619 Bacteria 1004
29 Ga0466729_144646 3300042621 Bacteria 18990
30 Ga0123357_10005946 3300009784 Bacteria 14738
31 Ga0123355_10009896 3300009826 Bacteria 14556
32 Ga0123355_10016012 3300009826 Bacteria 11799
33 Ga0123353_10001237 3300010167 Bacteria 31283
34 Ga0123353_10196216 3300010167 Bacteria 3182
35 Ga0160465_101248 3300012803 Bacteria 7837
36 Ga0466735_067340 3300042624 Bacteria 6522
37 Ga0466703_420045 3300042636 Bacteria 5673
38 Ga0466704_149824 3300042643 Bacteria 2827
39 Ga0466708_388378 3300042652 Bacteria 8641
40 Ga0466727_232950 3300042655 Bacteria 25553
41 2227630185 2225789004 Bacteria 11374
42 IMNBL1DRAFT_c0007526 3300000062 Bacteria 5708
43 Ga0466701_095307 3300042598 Bacteria 1505
44 Ga0466707_121071 3300042601 Unclassified 1848
45 Ga0466707_144148 3300042601 Bacteria 33317
46 Ga0466707_382073 3300042601 Bacteria 7865
47 Ga0466714_141499 3300042603 Bacteria 2236
48 Ga0466716_420165 3300042605 Bacteria 3861
49 Ga0466696_307254 3300042596 Bacteria 3102
50 Ga0123355_10137290 3300009826 Bacteria 3752
51 Ga0123356_10132607 3300010049 Bacteria 2444
52 Ga0466703_097620 3300042636 Bacteria 80316
53 Ga0466727_286714 3300042655 Bacteria 5705
54 IMNBL1DRAFT_c0022339 3300000062 Bacteria 2506
55 JGI24702J35022_10002706 3300002462 Bacteria 10755
56 Ga0466713_115830 3300042602 Bacteria 19919
57 Ga0466719_112689 3300042606 Bacteria 18447
58 Ga0123357_10202971 3300009784 Bacteria 2250
59 Ga0123355_10242223 3300009826 Bacteria 2553
60 Ga0123356_10050677 3300010049 Bacteria 3863
61 Ga0123353_10104372 3300010167 Bacteria 4567
62 Ga0123353_10618749 3300010167 Bacteria 1542
63 Ga0123353_10778576 3300010167 Bacteria 1326
64 Ga0123354_10027923 3300010882 Bacteria 8890
65 Ga0466735_153658 3300042624 Bacteria 1710
66 JGI24702J35022_10030902 3300002462 Bacteria 2873
67 Ga0466707_156026 3300042601 Bacteria 1093
68 Ga0466707_401781 3300042601 Bacteria 1864
69 Ga0466711_064583 3300042615 Bacteria 2503
70 Ga0466726_360662 3300042619 Bacteria 3599
71 Ga0123355_10083182 3300009826 Bacteria 5103
72 Ga0123356_10007503 3300010049 Bacteria 10876
73 Ga0123356_10778833 3300010049 Bacteria 1127
74 Ga0123353_10034176 3300010167 Bacteria 7930
75 2227128039 2225789004 Unclassified 8996
76 Ga0072941_1152815 3300005201 Bacteria 6055
77 Ga0466733_187234 3300042659 Bacteria 23555
78 Ga0466700_163077 3300042600 Unclassified 1347
79 Ga0466713_021973 3300042602 Bacteria 19002
80 Ga0466719_048722 3300042606 Bacteria 8475
81 Ga0466696_203914 3300042596 Bacteria 6860
82 Ga0466705_411798 3300042612 Bacteria 4402
83 Ga0466705_467270 3300042612 Bacteria 38150
84 Ga0466711_218698 3300042615 Bacteria 13180
85 Ga0466726_246333 3300042619 Bacteria 15538
86 Ga0160454_100055 3300012798 Bacteria 164033
87 Ga0466729_267568 3300042621 Bacteria 2040
88 Ga0466703_074899 3300042636 Bacteria 6411
89 Ga0466704_283786 3300042643 Bacteria 5356
90 Ga0466704_556737 3300042643 Bacteria 16378
91 IMNBL1DRAFT_c0000199 3300000062 Bacteria 52581
92 IMNBL1DRAFT_c0002016 3300000062 Bacteria 14554
93 Ga0072940_1024467 3300005200 Bacteria 7006
94 Ga0123357_10001009 3300009784 Bacteria 28826
95 Ga0466733_084573 3300042659 Bacteria 2196
96 Ga0466733_122029 3300042659 Bacteria 1155
97 Ga0562377_0109 3300056842 Bacteria 264470
98 Ga0466707_072993 3300042601 Bacteria 64242
99 Ga0466691_069138 3300042593 Bacteria 2093
100 Ga0466715_075740 3300042616 Bacteria 18220
101 Ga0466726_212704 3300042619 Bacteria 14720
102 Ga0123357_10278570 3300009784 Bacteria 1733
103 Ga0123355_10000220 3300009826 Bacteria 71950
104 Ga0123353_10055934 3300010167 Bacteria 6314
105 Ga0123353_10270144 3300010167 Bacteria 2620
106 Ga0123354_10041805 3300010882 Bacteria 7077
107 Ga0123354_10199947 3300010882 Bacteria 2201
108 Ga0466703_244015 3300042636 Bacteria 9365
109 Ga0466704_581797 3300042643 Bacteria 50311
110 Ga0466708_102890 3300042652 Bacteria 21227
111 Ga0466708_115966 3300042652 Bacteria 17010
112 Ga0466727_142222 3300042655 Bacteria 6346

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_000565 Ga0466717_000565_760_1512 250
2 3300005200 Ga0072940_1024467 Ga0072940_10244676 278
3 3300042596 Ga0466696_307254 Ga0466696_307254_1993_2850 285
4 3300042655 Ga0466727_232950 Ga0466727_232950_17407_18264 285
5 3300009784 Ga0123357_10278570 Ga0123357_102785702 287
6 3300042636 Ga0466703_244015 Ga0466703_244015_7727_8647 288
7 iso_pr_bacteria 2894897082 2894897473 291
8 iso_pr_bacteria 2894929448 2894931608 291
9 iso_pr_bacteria 2894935787 2894938635 291
10 iso_pr_bacteria 2894944011 2894946221 291
11 iso_pr_bacteria 2894974975 2894977887 291
12 iso_pr_bacteria 2894981435 2894982902 291
13 3300010049 Ga0123356_10007503 Ga0123356_1000750310 294
14 iso_pr_bacteria 2894900265 2894902922 296
15 iso_pr_bacteria 2894932631 2894932685 296
16 iso_pr_bacteria 2894966443 2894968926 296
17 3300042593 Ga0466691_069138 Ga0466691_069138_357_1277 297
18 3300042643 Ga0466704_149824 Ga0466704_149824_553_1446 297
19 3300042636 Ga0466703_420045 Ga0466703_420045_1910_2815 301
20 3300002462 JGI24702J35022_10015917 JGI24702J35022_100159172 303
21 3300010049 Ga0123356_10778833 Ga0123356_107788331 303
22 3300010167 Ga0123353_10001237 Ga0123353_100012374 303
23 3300010167 Ga0123353_10778576 Ga0123353_107785762 303
24 3300042616 Ga0466715_075740 Ga0466715_075740_11777_12688 303
25 3300042616 Ga0466715_219705 Ga0466715_219705_9142_10053 303
26 3300042643 Ga0466704_283786 Ga0466704_283786_4017_4931 304
27 3300056842 Ga0562377_0109 Ga0562377_0109_104397_105311 304
28 iso_pr_bacteria 2529293168 2531455378 304
29 iso_pr_bacteria 2781125690 2781428096 304
30 iso_pr_bacteria 646311952 646427817 304
31 3300042596 Ga0466696_203914 Ga0466696_203914_471_1388 305
32 3300042601 Ga0466707_382073 Ga0466707_382073_1034_1951 305
33 3300042615 Ga0466711_218698 Ga0466711_218698_3473_4390 305
34 3300042619 Ga0466726_092176 Ga0466726_092176_1124_2041 305
35 3300042619 Ga0466726_360662 Ga0466726_360662_2654_3571 305
36 3300042659 Ga0466733_217788 Ga0466733_217788_30801_31718 305
37 2225789004 2227128039 2227523963 306
38 2225789004 2227630185 2228213979 306
39 3300009826 Ga0123355_10083182 Ga0123355_100831823 306
40 3300010049 Ga0123356_10050677 Ga0123356_100506772 306
41 3300010167 Ga0123353_10104372 Ga0123353_101043723 306
42 3300012798 Ga0160454_100055 Ga0160454_100055138 306
43 3300012803 Ga0160465_101248 Ga0160465_1012484 306
44 3300042590 Ga0466690_034409 Ga0466690_034409_10311_11231 306
45 3300042601 Ga0466707_156026 Ga0466707_156026_129_1049 306
46 3300042601 Ga0466707_204692 Ga0466707_204692_6771_7691 306
47 3300042605 Ga0466716_420165 Ga0466716_420165_1371_2291 306
48 3300042606 Ga0466719_048722 Ga0466719_048722_4621_5541 306
49 3300042612 Ga0466705_467270 Ga0466705_467270_2455_3375 306
50 3300042613 Ga0466710_210447 Ga0466710_210447_380_1300 306
51 3300042615 Ga0466711_064583 Ga0466711_064583_798_1718 306
52 3300042615 Ga0466711_310514 Ga0466711_310514_7446_8366 306
53 3300042619 Ga0466726_021787 Ga0466726_021787_36_956 306
54 3300042619 Ga0466726_212704 Ga0466726_212704_10043_10963 306
55 3300042620 Ga0466728_084080 Ga0466728_084080_1946_2866 306
56 3300042621 Ga0466729_081032 Ga0466729_081032_1344_2264 306
57 3300042621 Ga0466729_144646 Ga0466729_144646_13650_14570 306
58 3300042621 Ga0466729_267568 Ga0466729_267568_263_1183 306
59 3300042624 Ga0466735_067340 Ga0466735_067340_2319_3239 306
60 3300042624 Ga0466735_153658 Ga0466735_153658_179_1099 306
61 3300042624 Ga0466735_229830 Ga0466735_229830_199_1119 306
62 3300042636 Ga0466703_074899 Ga0466703_074899_1957_2877 306
63 3300042643 Ga0466704_512941 Ga0466704_512941_82534_83454 306
64 3300042652 Ga0466708_102890 Ga0466708_102890_17603_18523 306
65 3300042652 Ga0466708_115966 Ga0466708_115966_13388_14308 306
66 3300042655 Ga0466727_142222 Ga0466727_142222_752_1672 306
67 3300042659 Ga0466733_089492 Ga0466733_089492_685_1605 306
68 3300042659 Ga0466733_122029 Ga0466733_122029_128_1048 306
69 3300042659 Ga0466733_187234 Ga0466733_187234_11843_12763 306
70 iso_pr_bacteria 2781125697 2781444193 306
71 iso_pr_bacteria 2820332331 2820333057 306
72 iso_pr_bacteria 2820556368 2820557852 306
73 iso_pr_bacteria 2820617402 2820617992 306
74 3300000062 IMNBL1DRAFT_c0000199 IMNBL1DRAFT_000019941 307
75 3300000062 IMNBL1DRAFT_c0002016 IMNBL1DRAFT_000201614 307
76 3300000062 IMNBL1DRAFT_c0004495 IMNBL1DRAFT_00044953 307
77 3300000062 IMNBL1DRAFT_c0007526 IMNBL1DRAFT_00075263 307
78 3300000062 IMNBL1DRAFT_c0022339 IMNBL1DRAFT_00223393 307
79 3300002462 JGI24702J35022_10030902 JGI24702J35022_100309023 307
80 3300009784 Ga0123357_10202971 Ga0123357_102029712 307
81 3300009826 Ga0123355_10000220 Ga0123355_1000022030 307
82 3300009826 Ga0123355_10242223 Ga0123355_102422233 307
83 3300010167 Ga0123353_10034176 Ga0123353_100341766 307
84 3300010167 Ga0123353_10055934 Ga0123353_100559342 307
85 3300038395 Ga0415639_075976 Ga0415639_075976_296_1219 307
86 3300042606 Ga0466719_112689 Ga0466719_112689_7924_8847 307
87 3300042643 Ga0466704_187939 Ga0466704_187939_197_1120 307
88 3300042652 Ga0466708_388378 Ga0466708_388378_6409_7332 307
89 3300009826 Ga0123355_10137290 Ga0123355_101372903 308
90 3300010167 Ga0123353_10196216 Ga0123353_101962162 308
91 3300010167 Ga0123353_10270144 Ga0123353_102701443 308
92 3300012813 Ga0160470_100273 Ga0160470_10027329 308
93 3300042598 Ga0466701_095307 Ga0466701_095307_523_1449 308
94 3300042600 Ga0466700_163077 Ga0466700_163077_303_1229 308
95 3300042600 Ga0466700_370882 Ga0466700_370882_239_1165 308
96 3300042601 Ga0466707_144148 Ga0466707_144148_20330_21256 308
97 3300042601 Ga0466707_401781 Ga0466707_401781_268_1194 308
98 3300042603 Ga0466714_141499 Ga0466714_141499_768_1694 308
99 iso_pr_bacteria 2820336130 2820338285 308
100 iso_pr_bacteria 2820596822 2820598072 308
101 3300005201 Ga0072941_1152815 Ga0072941_11528151 309
102 3300009826 Ga0123355_10016012 Ga0123355_1001601212 309
103 3300042601 Ga0466707_121071 Ga0466707_121071_10_939 309
104 3300042619 Ga0466726_246333 Ga0466726_246333_11848_12777 309
105 iso_pr_bacteria 2820229114 2820229212 309
106 iso_pr_bacteria 2820362221 2820363042 309
107 iso_pr_bacteria 2820551407 2820552753 309
108 3300002462 JGI24702J35022_10002706 JGI24702J35022_100027066 310
109 3300009784 Ga0123357_10001009 Ga0123357_100010094 310
110 3300010167 Ga0123353_10618749 Ga0123353_106187492 310
111 3300042593 Ga0466691_056657 Ga0466691_056657_3018_3950 310
112 3300042602 Ga0466713_013068 Ga0466713_013068_1346_2278 310
113 3300042602 Ga0466713_133521 Ga0466713_133521_6172_7104 310
114 3300042643 Ga0466704_556737 Ga0466704_556737_4391_5323 310
115 iso_pr_bacteria 2820242869 2820243388 311
116 3300009784 Ga0123357_10005946 Ga0123357_100059467 312
117 3300010049 Ga0123356_10132607 Ga0123356_101326073 312
118 3300010882 Ga0123354_10000089 Ga0123354_1000008911 312
119 3300010882 Ga0123354_10002881 Ga0123354_100028816 312
120 3300010882 Ga0123354_10027923 Ga0123354_100279232 312
121 3300010882 Ga0123354_10041805 Ga0123354_100418059 312
122 3300010882 Ga0123354_10199947 Ga0123354_101999472 312
123 3300042601 Ga0466707_072993 Ga0466707_072993_26307_27245 312
124 3300042612 Ga0466705_414056 Ga0466705_414056_2431_3369 312
125 3300042636 Ga0466703_097620 Ga0466703_097620_31808_32746 312
126 3300042643 Ga0466704_581797 Ga0466704_581797_41106_42044 312
127 3300009826 Ga0123355_10009896 Ga0123355_1000989616 314
128 3300042655 Ga0466727_286714 Ga0466727_286714_1766_2710 314
129 3300042602 Ga0466713_021973 Ga0466713_021973_17760_18707 315
130 3300042602 Ga0466713_115830 Ga0466713_115830_6573_7520 315
131 3300042618 Ga0466723_265899 Ga0466723_265899_6351_7301 316
132 3300042659 Ga0466733_084573 Ga0466733_084573_540_1490 316
133 3300042603 Ga0466714_157828 Ga0466714_157828_1067_2032 321
134 3300042612 Ga0466705_411798 Ga0466705_411798_1413_2492 359

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00248 Aldo_ket_red Aldo/keto reductase family 83 350 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.