Protein Family IF07215

Metagenome Isolate
169 Members
78 Samples
137 Scaffolds
479.33 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_392662|Ga0466705_392662_779_2458
Length
547 aa
Sequence
MKKPLPGKKVFYREIQLGIKKRADREVCLFCMSGMSSTCICPGNYLLTAASSVFIMYLCGDKSSMEGWDILIIWLTGGKNSNNTAFFSGNKRSPWYIISIGMIGTSLSGVTFVSVPGLVRQMDMTYMQVVFGFFFGYILIARILLPLYYRLNLTSIYSWLDDRIGPRGYRTGACFFLLSKLVGAAARLYLVVWILQTCVFDRWHIPFAVTATASVFLVWLYTFRGGIRTIIWTDTLQALCLLAMLGGILWQVKHSLALDMAGMVQTVTASEHFRIFEFKDWASTQHFVKQFLSGIFIPVVMTGLDQDMMQKNLACRNLRDAQRNMYTYGIAFIPVNFLFLCLGILLLTLAAQQQIALPDVNDDILPMFCTSGILGYSTLIFFTVGIIAAAFSSADSALTALTTSFCVDILGLEKDKTEKARRTRMRVHLLVALVFXXXIILFRLFSSRSLIDAIYMIASFTYGPLLGLFAFGLFTRRKPLNRPVPYICIAAPLICYALDYFVFKYAGYKFGYEILLLNGALTFAGLWFRSEKKAFCPYRRAKAFRPY

📊 Sample Types

Isolate 18.9%
Metagenome 81.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 25.6%
Termitidae 25.6%
Kalotermitidae 16.7%
Unclassified 14.1%
Rhinotermitidae 6.4%
Termopsidae 5.1%
Hydrophilidae 2.6%
Passalidae 2.6%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 165
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
2 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
3 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
4 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
5 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
14 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
15 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
19 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
20 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
21 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
22 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
23 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
24 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
25 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
26 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
27 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
31 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
32 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
33 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
34 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
37 2923982719 Parabacteroides sp. 52 Isolate Blattidae
38 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
39 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
40 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
43 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
44 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
45 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
46 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
47 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
48 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
51 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
52 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
53 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
54 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
55 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
56 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
57 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
58 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
59 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
60 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
61 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
62 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
63 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
64 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
65 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
66 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
67 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
68 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
69 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
70 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
71 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
72 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
73 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
74 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
75 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
76 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
77 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
78 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_285384 3300042612 Bacteria 16739
2 Ga0466705_302081 3300042612 Bacteria 8183
3 Ga0123356_10103346 3300010049 Bacteria 2737
4 Ga0466729_307898 3300042621 Bacteria 17594
5 Ga0466735_066377 3300042624 Bacteria 4897
6 Ga0466703_263547 3300042636 Bacteria 19799
7 Ga0466704_395685 3300042643 Bacteria 5430
8 Ga0466709_138567 3300042648 Bacteria 14536
9 Ga0466727_080215 3300042655 Bacteria 8461
10 Ga0466727_217290 3300042655 Bacteria 10505
11 Ga0466696_154379 3300042596 Bacteria 2122
12 Ga0466707_210624 3300042601 Bacteria 5312
13 Ga0466713_011183 3300042602 Bacteria 6139
14 Ga0466719_019865 3300042606 Bacteria 6113
15 Ga0466722_228094 3300042609 Bacteria 6275
16 IMNBL1DRAFT_c0000935 3300000062 Bacteria 22566
17 JGI24699J35502_11134056 3300002509 Bacteria 27277
18 Ga0123354_10011453 3300010882 Bacteria 13707
19 Ga0466735_065370 3300042624 Bacteria 13419
20 Ga0466735_087178 3300042624 Bacteria 4194
21 Ga0466703_186156 3300042636 Bacteria 12803
22 Ga0466709_393874 3300042648 Bacteria 3843
23 Ga0466696_291331 3300042596 Bacteria 6734
24 Ga0466711_217078 3300042615 Bacteria 7411
25 Ga0466711_280901 3300042615 Bacteria 19639
26 Ga0466715_026465 3300042616 Bacteria 99999
27 Ga0466715_380145 3300042616 Bacteria 11285
28 Ga0466707_105393 3300042601 Bacteria 9495
29 Ga0466707_169356 3300042601 Bacteria 5977
30 Ga0466707_184627 3300042601 Bacteria 3718
31 Ga0466722_011067 3300042609 Bacteria 2637
32 Ga0068305_10360953 3300005083 Unclassified 5744
33 Ga0123357_10000612 3300009784 Bacteria 35430
34 Ga0466725_225545 3300042654 Bacteria 19445
35 Ga0466656_218669 3300042550 Bacteria 33170
36 Ga0466692_007567 3300042591 Bacteria 4316
37 Ga0466692_029223 3300042591 Bacteria 8166
38 Ga0466691_215870 3300042593 Bacteria 28022
39 Ga0466711_409636 3300042615 Bacteria 2714
40 Ga0466715_255231 3300042616 Bacteria 16098
41 Ga0466723_026213 3300042618 Bacteria 14458
42 Ga0466719_221864 3300042606 Bacteria 2740
43 IMNBL1DRAFT_c0007870 3300000062 Bacteria 5524
44 IMNBL1DRAFT_c0021583 3300000062 Bacteria 2573
45 Ga0068305_10194288 3300005083 Bacteria 4561
46 Ga0466705_086385 3300042612 Bacteria 6441
47 Ga0123357_10010214 3300009784 Bacteria 11922
48 Ga0466704_117322 3300042643 Bacteria 8093
49 Ga0466704_234531 3300042643 Bacteria 25098
50 Ga0466708_145890 3300042652 Bacteria 28616
51 Ga0466705_392662 3300042612 Bacteria 3093
52 Ga0466715_182963 3300042616 Bacteria 8539
53 Ga0466717_178946 3300042604 Bacteria 3065
54 Ga0466698_229449 3300042610 Bacteria 2013
55 2227503798 2225789004 Unclassified 3736
56 Ga0466697_250686 3300042611 Bacteria 3839
57 Ga0466733_121822 3300042659 Bacteria 48145
58 Ga0123357_10011589 3300009784 Bacteria 11318
59 Ga0123357_10021889 3300009784 Bacteria 8563
60 Ga0123353_10407738 3300010167 Bacteria 2020
61 Ga0466734_040793 3300042623 Bacteria 2199
62 Ga0466735_116785 3300042624 Bacteria 3719
63 Ga0466703_115996 3300042636 Bacteria 4974
64 Ga0466703_282565 3300042636 Bacteria 9306
65 Ga0466704_235911 3300042643 Bacteria 3813
66 Ga0466725_083753 3300042654 Bacteria 27078
67 Ga0466727_078549 3300042655 Bacteria 18273
68 Ga0466727_167815 3300042655 Bacteria 9812
69 Ga0466727_313462 3300042655 Bacteria 28907
70 Ga0466707_099704 3300042601 Bacteria 14474
71 Ga0466713_011249 3300042602 Bacteria 73032
72 Ga0466713_091714 3300042602 Bacteria 189911
73 Ga0466716_362126 3300042605 Bacteria 14616
74 Ga0466716_476877 3300042605 Bacteria 11922
75 2227641281 2225789004 Bacteria 11050
76 JGI24699J35502_11133642 3300002509 Bacteria 12864
77 JGI24699J35502_11134047 3300002509 Bacteria 26850
78 JGI24696J40584_12954025 3300002834 Bacteria 2570
79 Ga0068305_10020972 3300005083 Bacteria 3959
80 Ga0123357_10000105 3300009784 Bacteria 69766
81 Ga0466697_174790 3300042611 Bacteria 1686
82 Ga0466733_002151 3300042659 Bacteria 71476
83 Ga0123354_10002823 3300010882 Bacteria 23443
84 Ga0466735_113150 3300042624 Bacteria 4169
85 Ga0466703_258794 3300042636 Bacteria 7278
86 Ga0466704_592967 3300042643 Bacteria 4540
87 Ga0466727_192706 3300042655 Bacteria 6250
88 Ga0466727_315449 3300042655 Bacteria 7913
89 Ga0415639_223062 3300038395 Bacteria 1395
90 Ga0466694_068038 3300042594 Bacteria 2362
91 Ga0466696_124654 3300042596 Bacteria 8786
92 Ga0466723_273875 3300042618 Bacteria 3811
93 Ga0466713_107644 3300042602 Bacteria 8490
94 Ga0466719_058599 3300042606 Unclassified 3444
95 Ga0466719_378735 3300042606 Bacteria 28336
96 Ga0466719_520065 3300042606 Bacteria 11153
97 Ga0466722_084309 3300042609 Bacteria 46740
98 Ga0466722_105168 3300042609 Bacteria 17047
99 JGI24702J35022_10000503 3300002462 Bacteria 23633
100 Ga0068302_10073055 3300005071 Bacteria 2248
101 Ga0466705_017759 3300042612 Bacteria 4562
102 Ga0466733_013278 3300042659 Bacteria 16437
103 Ga0123354_10009067 3300010882 Bacteria 15188
104 Ga0466703_431524 3300042636 Bacteria 2188
105 Ga0466704_200046 3300042643 Bacteria 8189
106 Ga0466708_056189 3300042652 Bacteria 10244
107 Ga0466690_001973 3300042590 Bacteria 16119
108 Ga0466692_029964 3300042591 Bacteria 2610
109 Ga0466691_214266 3300042593 Bacteria 3621
110 Ga0466711_337599 3300042615 Bacteria 7802
111 Ga0466715_109224 3300042616 Bacteria 75833
112 Ga0466718_016528 3300042617 Bacteria 3148
113 Ga0466726_016918 3300042619 Bacteria 8175
114 Ga0466726_074420 3300042619 Bacteria 3340
115 Ga0466701_088409 3300042598 Bacteria 49099
116 Ga0466706_143380 3300042599 Bacteria 33599
117 Ga0466700_402067 3300042600 Unclassified 2845
118 Ga0466707_416587 3300042601 Bacteria 30414
119 IMNBL1DRAFT_c0001689 3300000062 Bacteria 16277
120 Ga0068302_10055686 3300005071 Bacteria 2844
121 Ga0466705_120499 3300042612 Bacteria 7279
122 Ga0466733_066373 3300042659 Bacteria 26399
123 Ga0123357_10065276 3300009784 Bacteria 4860
124 Ga0123356_10107488 3300010049 Bacteria 2688
125 Ga0466735_086920 3300042624 Bacteria 5165
126 Ga0466704_531319 3300042643 Bacteria 12457
127 Ga0466696_454722 3300042596 Bacteria 41485
128 Ga0466711_093162 3300042615 Bacteria 19638
129 Ga0466715_012002 3300042616 Bacteria 9704
130 Ga0466701_038865 3300042598 Bacteria 42316
131 Ga0466716_406042 3300042605 Bacteria 10247
132 Ga0466722_048054 3300042609 Bacteria 48867
133 Ga0466722_056895 3300042609 Bacteria 32920
134 Ga0466698_447568 3300042610 Bacteria 5023
135 IMNBL1DRAFT_c0005099 3300000062 Bacteria 7636
136 JGI24705J35276_12236296 3300002504 Bacteria 7790
137 Ga0123357_10000887 3300009784 Bacteria 30512

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042611 Ga0466697_174790 Ga0466697_174790_41_1276 411
2 3300038395 Ga0415639_223062 Ga0415639_223062_12_1262 416
3 3300009784 Ga0123357_10000105 Ga0123357_1000010534 425
4 3300042612 Ga0466705_120499 Ga0466705_120499_3145_4461 438
5 3300042606 Ga0466719_221864 Ga0466719_221864_588_2054 439
6 3300042604 Ga0466717_178946 Ga0466717_178946_1577_3001 447
7 3300042609 Ga0466722_011067 Ga0466722_011067_50_1468 456
8 3300002504 JGI24705J35276_12236296 JGI24705J35276_122362962 458
9 3300042601 Ga0466707_169356 Ga0466707_169356_496_1962 458
10 3300042605 Ga0466716_406042 Ga0466716_406042_8080_9537 458
11 3300010049 Ga0123356_10103346 Ga0123356_101033462 460
12 3300042643 Ga0466704_592967 Ga0466704_592967_197_1663 460
13 3300000062 IMNBL1DRAFT_c0000935 IMNBL1DRAFT_00009357 462
14 3300042636 Ga0466703_282565 Ga0466703_282565_7672_9138 462
15 3300042602 Ga0466713_091714 Ga0466713_091714_147438_148895 463
16 3300042636 Ga0466703_258794 Ga0466703_258794_3968_5422 463
17 iso_pr_bacteria 2820776227 2820776262 463
18 2225789004 2227503798 2227989305 464
19 3300042648 Ga0466709_393874 Ga0466709_393874_2275_3723 464
20 3300009784 Ga0123357_10000612 Ga0123357_1000061220 467
21 3300042591 Ga0466692_029964 Ga0466692_029964_395_1843 467
22 3300042596 Ga0466696_454722 Ga0466696_454722_10429_11874 467
23 3300042643 Ga0466704_531319 Ga0466704_531319_9542_11008 467
24 3300000062 IMNBL1DRAFT_c0021583 IMNBL1DRAFT_00215832 468
25 3300042596 Ga0466696_291331 Ga0466696_291331_3158_4612 468
26 3300042609 Ga0466722_228094 Ga0466722_228094_4754_6229 468
27 3300042615 Ga0466711_409636 Ga0466711_409636_66_1532 468
28 3300042621 Ga0466729_307898 Ga0466729_307898_11577_12983 468
29 3300042624 Ga0466735_065370 Ga0466735_065370_6274_7719 468
30 3300042616 Ga0466715_255231 Ga0466715_255231_14290_15735 469
31 3300000062 IMNBL1DRAFT_c0005099 IMNBL1DRAFT_00050992 470
32 3300042609 Ga0466722_056895 Ga0466722_056895_14887_16353 470
33 3300042615 Ga0466711_337599 Ga0466711_337599_5543_6955 470
34 3300042652 Ga0466708_056189 Ga0466708_056189_7887_9383 471
35 3300042655 Ga0466727_080215 Ga0466727_080215_2355_3809 471
36 3300042624 Ga0466735_087178 Ga0466735_087178_1384_2844 472
37 3300005071 Ga0068302_10055686 Ga0068302_100556862 473
38 3300010882 Ga0123354_10011453 Ga0123354_100114531 474
39 3300042601 Ga0466707_210624 Ga0466707_210624_2700_4169 474
40 3300042612 Ga0466705_285384 Ga0466705_285384_10573_12075 474
41 3300042616 Ga0466715_026465 Ga0466715_026465_50309_51778 474
42 3300042624 Ga0466735_086920 Ga0466735_086920_958_2382 474
43 3300042612 Ga0466705_086385 Ga0466705_086385_2139_3608 475
44 3300042618 Ga0466723_026213 Ga0466723_026213_12010_13455 475
45 3300042593 Ga0466691_214266 Ga0466691_214266_1363_2829 476
46 3300042648 Ga0466709_138567 Ga0466709_138567_11149_12606 476
47 3300042652 Ga0466708_145890 Ga0466708_145890_21549_23003 476
48 3300042609 Ga0466722_048054 Ga0466722_048054_2042_3475 477
49 3300042636 Ga0466703_186156 Ga0466703_186156_1556_3010 477
50 3300042596 Ga0466696_154379 Ga0466696_154379_557_2035 478
51 3300042611 Ga0466697_250686 Ga0466697_250686_2097_3599 478
52 3300042612 Ga0466705_302081 Ga0466705_302081_6477_7943 478
53 3300042615 Ga0466711_093162 Ga0466711_093162_363_1799 478
54 3300042616 Ga0466715_182963 Ga0466715_182963_3250_4716 478
55 3300042655 Ga0466727_313462 Ga0466727_313462_18802_20259 478
56 iso_pr_bacteria 2820741847 2820742932 478
57 3300000062 IMNBL1DRAFT_c0007870 IMNBL1DRAFT_00078705 479
58 3300010049 Ga0123356_10107488 Ga0123356_101074881 479
59 3300042609 Ga0466722_084309 Ga0466722_084309_38319_39758 479
60 3300042643 Ga0466704_200046 Ga0466704_200046_1309_2769 479
61 2225789004 2227641281 2228230979 480
62 3300000062 IMNBL1DRAFT_c0001689 IMNBL1DRAFT_00016892 480
63 3300002834 JGI24696J40584_12954025 JGI24696J40584_129540253 480
64 3300010882 Ga0123354_10009067 Ga0123354_1000906710 480
65 3300042617 Ga0466718_016528 Ga0466718_016528_1044_2486 480
66 3300042655 Ga0466727_315449 Ga0466727_315449_3249_4691 480
67 3300042550 Ga0466656_218669 Ga0466656_218669_30202_31647 481
68 3300042593 Ga0466691_215870 Ga0466691_215870_6550_7995 481
69 3300042601 Ga0466707_416587 Ga0466707_416587_27701_29146 481
70 3300042606 Ga0466719_378735 Ga0466719_378735_13528_14973 481
71 3300042609 Ga0466722_105168 Ga0466722_105168_14170_15615 481
72 3300042623 Ga0466734_040793 Ga0466734_040793_650_2095 481
73 3300042643 Ga0466704_117322 Ga0466704_117322_2880_4355 481
74 iso_pr_bacteria 2940205530 2940208121 481
75 iso_pr_bacteria 2940212447 2940214949 481
76 iso_pr_bacteria 2940298504 2940301003 481
77 iso_pr_bacteria 2940302308 2940304892 481
78 iso_pr_bacteria 2940306115 2940308594 481
79 iso_pr_bacteria 2940309933 2940312346 481
80 iso_pr_bacteria 2940313741 2940316158 481
81 iso_pr_bacteria 2940317558 2940319974 481
82 iso_pr_bacteria 2940321370 2940323729 481
83 iso_pr_bacteria 2940325180 2940327676 481
84 iso_pr_bacteria 2940328985 2940331568 481
85 iso_pr_bacteria 2940332795 2940335210 481
86 iso_pr_bacteria 2967483437 2967487078 481
87 3300009784 Ga0123357_10011589 Ga0123357_100115897 482
88 3300042598 Ga0466701_038865 Ga0466701_038865_9846_11294 482
89 3300042598 Ga0466701_088409 Ga0466701_088409_27063_28511 482
90 3300042602 Ga0466713_011183 Ga0466713_011183_1116_2564 482
91 3300042615 Ga0466711_217078 Ga0466711_217078_3998_5446 482
92 3300042615 Ga0466711_280901 Ga0466711_280901_15176_16624 482
93 3300042655 Ga0466727_167815 Ga0466727_167815_178_1626 482
94 iso_pr_bacteria 2820762746 2820763910 482
95 3300002509 JGI24699J35502_11134056 JGI24699J35502_1113405625 483
96 3300005083 Ga0068305_10020972 Ga0068305_100209722 483
97 3300009784 Ga0123357_10010214 Ga0123357_100102144 483
98 3300042602 Ga0466713_107644 Ga0466713_107644_4417_5868 483
99 3300042624 Ga0466735_066377 Ga0466735_066377_1300_2751 483
100 3300005071 Ga0068302_10073055 Ga0068302_100730552 484
101 3300009784 Ga0123357_10021889 Ga0123357_100218893 484
102 3300042599 Ga0466706_143380 Ga0466706_143380_5660_7141 484
103 3300042601 Ga0466707_105393 Ga0466707_105393_3162_4616 484
104 3300042601 Ga0466707_184627 Ga0466707_184627_1706_3178 484
105 3300042605 Ga0466716_476877 Ga0466716_476877_9852_11306 484
106 3300042616 Ga0466715_012002 Ga0466715_012002_6102_7556 484
107 3300042616 Ga0466715_380145 Ga0466715_380145_5429_6883 484
108 3300042643 Ga0466704_234531 Ga0466704_234531_5123_6577 484
109 3300042643 Ga0466704_235911 Ga0466704_235911_2076_3545 484
110 3300042659 Ga0466733_121822 Ga0466733_121822_42347_43801 484
111 3300042594 Ga0466694_068038 Ga0466694_068038_314_1771 485
112 3300042601 Ga0466707_099704 Ga0466707_099704_3132_4607 485
113 3300042606 Ga0466719_520065 Ga0466719_520065_5433_6890 485
114 3300042619 Ga0466726_074420 Ga0466726_074420_1664_3121 485
115 3300042636 Ga0466703_263547 Ga0466703_263547_851_2308 485
116 3300042655 Ga0466727_192706 Ga0466727_192706_414_1871 485
117 iso_pr_bacteria 2695420317 2695485233 485
118 iso_pr_bacteria 2873600114 2873602934 485
119 iso_pr_bacteria 2873610414 2873613298 485
120 iso_pr_bacteria 8100157865 8100158513 485
121 3300010167 Ga0123353_10407738 Ga0123353_104077382 486
122 3300042636 Ga0466703_115996 Ga0466703_115996_1147_2607 486
123 iso_pr_bacteria 2695420931 2698111941 486
124 iso_pr_bacteria 2820751898 2820753204 486
125 3300009784 Ga0123357_10000887 Ga0123357_100008875 487
126 3300009784 Ga0123357_10065276 Ga0123357_100652762 487
127 3300042596 Ga0466696_124654 Ga0466696_124654_950_2413 487
128 3300042606 Ga0466719_058599 Ga0466719_058599_1171_2634 487
129 3300042610 Ga0466698_447568 Ga0466698_447568_2863_4326 487
130 3300042619 Ga0466726_016918 Ga0466726_016918_976_2439 487
131 3300042655 Ga0466727_078549 Ga0466727_078549_7017_8480 487
132 iso_pr_bacteria 2940193328 2940194452 487
133 iso_pr_bacteria 2940336608 2940337728 487
134 iso_pr_bacteria 8100166142 8100170805 487
135 3300002509 JGI24699J35502_11133642 JGI24699J35502_111336422 488
136 3300005083 Ga0068305_10360953 Ga0068305_103609534 488
137 3300042606 Ga0466719_019865 Ga0466719_019865_2691_4181 488
138 3300042616 Ga0466715_109224 Ga0466715_109224_33236_34702 488
139 3300042618 Ga0466723_273875 Ga0466723_273875_785_2251 488
140 3300042643 Ga0466704_395685 Ga0466704_395685_169_1683 488
141 3300042654 Ga0466725_225545 Ga0466725_225545_13856_15322 488
142 iso_pr_bacteria 2820759988 2820761627 488
143 iso_pr_bacteria 2940216256 2940216832 488
144 3300002509 JGI24699J35502_11134047 JGI24699J35502_1113404721 489
145 3300042610 Ga0466698_229449 Ga0466698_229449_239_1708 489
146 3300042612 Ga0466705_017759 Ga0466705_017759_1885_3354 489
147 3300042624 Ga0466735_113150 Ga0466735_113150_271_1740 489
148 3300042655 Ga0466727_217290 Ga0466727_217290_1891_3360 489
149 3300042591 Ga0466692_029223 Ga0466692_029223_3182_4654 490
150 3300042605 Ga0466716_362126 Ga0466716_362126_10951_12423 490
151 3300042624 Ga0466735_116785 Ga0466735_116785_1978_3450 490
152 3300042659 Ga0466733_066373 Ga0466733_066373_22728_24200 490
153 iso_pr_bacteria 2923982719 2923985111 490
154 3300010882 Ga0123354_10002823 Ga0123354_100028232 491
155 3300042654 Ga0466725_083753 Ga0466725_083753_5549_7024 491
156 iso_pr_bacteria 2940199050 2940201683 491
157 iso_pr_bacteria 2940346213 2940348589 491
158 3300005083 Ga0068305_10194288 Ga0068305_101942882 493
159 3300042590 Ga0466690_001973 Ga0466690_001973_5146_6627 493
160 3300042591 Ga0466692_007567 Ga0466692_007567_1428_2912 494
161 3300042659 Ga0466733_002151 Ga0466733_002151_4759_6252 497
162 3300042659 Ga0466733_013278 Ga0466733_013278_754_2301 497
163 iso_pr_bacteria 2940195863 2940198287 497
164 iso_pr_bacteria 2940209341 2940211851 497
165 3300002462 JGI24702J35022_10000503 JGI24702J35022_100005038 499
166 3300042636 Ga0466703_431524 Ga0466703_431524_234_1736 500
167 3300042600 Ga0466700_402067 Ga0466700_402067_895_2442 503
168 3300042602 Ga0466713_011249 Ga0466713_011249_36758_38281 507
169 3300042612 Ga0466705_392662 Ga0466705_392662_779_2458 547

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00474 SSF Sodium:solute symporter family 86 477 0.8

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.