Protein Family IF07213
Metagenome
Isolate
501
Members
365
Samples
237
Scaffolds
335.5
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_391316|Ga0466705_391316_424_1593
- Length
- 389 aa
- Sequence
- MYTINRQEILIKLPVRKCGAKSSSMFAEDGKVTCNFNASRPAVNRSRPHGCGFADGRRRGELMKITVAGGGSWGTALAGMAAAKGFSATLLVRDPALARAVNERHENPRYFPGLPLDRRLRASASPVDALADADILVTAVPCQSMRSFLESIARFVPDSAVPVCVSKGIETSTLKRMSEVTAEVLPAQAGRYAVLSGPSFAAEVMREKPTAVVVGSTDAAVREHLREVFSCGFFRVYSGSDVTGVELGGAIKNVMAIAAGICDGLGFGHNARAALVARGLAEMIRLGEALGARAATFMGLSGLGDLVLTCTGDLSRNRRVGLKLAAGENAAEAGSAMTAEGIKTTAAVLRLAALHAVDTPIAGAVGRILNGELAPASARELMNRTLREE
Sample Types
Isolate
52.7%
Metagenome
47.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
31.9%
Coreidae
22.6%
Unclassified
8.8%
Termitidae
7.6%
Formicidae
5.6%
Drosophilidae
5.1%
Kalotermitidae
4.0%
Culicidae
2.8%
Armadillidiidae
2.0%
Rhinotermitidae
1.1%
Sarcophagidae
0.8%
Pteromalidae
0.8%
Elmidae
0.8%
Berytidae
0.6%
Ixodidae
0.6%
Largidae
0.6%
Termopsidae
0.6%
Curculionidae
0.6%
Reduviidae
0.3%
Hippoboscidae
0.3%
Lysianassidae
0.3%
Psyllidae
0.3%
Hydrophilidae
0.3%
Hodotermitidae
0.3%
Cixiidae
0.3%
Aphididae
0.3%
Calliphoridae
0.3%
Alydidae
0.3%
Aleyrodidae
0.3%
Taxonomy
Archaea
0
Bacteria
479
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 2 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 3 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 4 | 2820070515 | Unclassified Proteobacteria Nt197P3bin137 | Isolate | Unclassified |
| 5 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 6 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 7 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 8 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 9 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 10 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 11 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 12 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 13 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 14 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 15 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 16 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 17 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 18 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 19 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 20 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 21 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 22 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 23 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 24 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 25 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 26 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 27 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 28 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 29 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 30 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 31 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 32 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 33 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 34 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 35 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 37 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 38 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 39 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 40 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 41 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 42 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 47 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 48 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 49 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 50 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 51 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 52 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 53 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 54 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 55 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 56 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 57 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 58 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 59 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 60 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 61 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 62 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 63 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 64 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 65 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 66 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 67 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 68 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 69 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 70 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 71 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 72 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 73 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 74 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 75 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 76 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 77 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 78 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 79 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 80 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 81 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 82 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 83 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 84 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 85 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 86 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 87 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 88 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 89 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 90 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 91 | 2512047046 | Secondary Endosymbiont of Heteropsylla cubana | Isolate | Psyllidae |
| 92 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 93 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 94 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 95 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 96 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 97 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 98 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 99 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 100 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 101 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 102 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 103 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 104 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 105 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 106 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 107 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 108 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 109 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 110 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 111 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 112 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 113 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 114 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 115 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 116 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 117 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 118 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 119 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 120 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 121 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 122 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 123 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 124 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 125 | 3300000461 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-P17 | Metagenome | Apidae |
| 126 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 127 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 128 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 129 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 130 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 131 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 132 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 133 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 134 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 135 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 136 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 137 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 138 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 139 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 140 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 141 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 142 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 143 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 144 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 145 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 146 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 147 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 148 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 149 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 150 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 151 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 152 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 153 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 154 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 155 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 156 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 157 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 158 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 159 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 160 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 161 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 162 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 163 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 164 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 165 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 166 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 167 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 168 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 169 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 170 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 171 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 172 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 173 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 174 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 175 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 176 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 177 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 178 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 179 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 180 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 181 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 182 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 183 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 184 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 185 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 186 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 187 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 188 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 189 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 190 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 191 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 192 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 193 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 194 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 195 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 196 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 197 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 198 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 199 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 200 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 201 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 202 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 203 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 204 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 205 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 206 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 207 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 208 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 209 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 210 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 211 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 212 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 213 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 214 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 215 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 216 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 217 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 218 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 219 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 220 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 221 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 222 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 223 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 224 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 225 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 226 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 227 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 228 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 229 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 230 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 231 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 232 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 233 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 234 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 235 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 236 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 237 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 238 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 239 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 240 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 241 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 242 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 243 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 244 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 245 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 246 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 247 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 248 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 249 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 250 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 251 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 252 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 253 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 254 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 255 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 256 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 257 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 258 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 259 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 260 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 261 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 262 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 263 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 264 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 265 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 266 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 267 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 268 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 269 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 270 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 271 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 272 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 273 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 274 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 275 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 276 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 277 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 278 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 279 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 280 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 281 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 282 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 283 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 284 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 285 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 286 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 287 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 288 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 289 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 290 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 291 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 292 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 293 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 294 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 295 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 296 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 297 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 298 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 299 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 300 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 301 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 302 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 303 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 304 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 305 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 306 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 307 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 308 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 309 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 310 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 311 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 312 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 313 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 314 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 315 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 316 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 317 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 318 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 319 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 320 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 321 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 322 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 323 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 324 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 325 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 326 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 327 | 2820137450 | Unclassified Proteobacteria Emb289P3bin120 | Isolate | Unclassified |
| 328 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 329 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 330 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 331 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 332 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 333 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 334 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 335 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 336 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 337 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 338 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 339 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 340 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 341 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 342 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 343 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 344 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 345 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 346 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 347 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 348 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 349 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 350 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 351 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 352 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 353 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 354 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 355 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 356 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 357 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 358 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 359 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 360 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 361 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 362 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 363 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 364 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 365 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_122577 | 3300042612 | Bacteria | 3425 |
| 2 | Ga0466705_204928 | 3300042612 | Unclassified | 6417 |
| 3 | gam1t_NODE_668966_length=9231_GC=35_7_Contigs=6 | 2189573031 | Unclassified | 9281 |
| 4 | Ga0102735_1002454 | 3300007080 | Bacteria | 2808 |
| 5 | Ga0103267_1054568 | 3300007190 | Bacteria | 2597 |
| 6 | Ga0123357_10034017 | 3300009784 | Bacteria | 6925 |
| 7 | Ga0123356_10036645 | 3300010049 | Bacteria | 4580 |
| 8 | Ga0123353_10057430 | 3300010167 | Unclassified | 6234 |
| 9 | Ga0466707_413653 | 3300042601 | Bacteria | 4972 |
| 10 | Ga0466717_011008 | 3300042604 | Bacteria | 2015 |
| 11 | Ga0466711_352641 | 3300042615 | Bacteria | 2375 |
| 12 | Ga0466715_492705 | 3300042616 | Bacteria | 3245 |
| 13 | Ga0160446_100107 | 3300012835 | Bacteria | 76250 |
| 14 | Ga0160460_100128 | 3300012845 | Bacteria | 91139 |
| 15 | Ga0160436_1005501 | 3300012861 | Bacteria | 2977 |
| 16 | Ga0160436_1006400 | 3300012861 | Unclassified | 2733 |
| 17 | Ga0466657_045296 | 3300042582 | Bacteria | 3416 |
| 18 | Ga0466690_002060 | 3300042590 | Bacteria | 1653 |
| 19 | Ga0466690_105411 | 3300042590 | Bacteria | 24234 |
| 20 | Ga0466690_340290 | 3300042590 | Bacteria | 31321 |
| 21 | Ga0466701_006187 | 3300042598 | Bacteria | 96523 |
| 22 | Ga0466730_013512 | 3300042625 | Bacteria | 1835 |
| 23 | Ga0466704_556028 | 3300042643 | Unclassified | 7954 |
| 24 | Ga0466704_596754 | 3300042643 | Bacteria | 22176 |
| 25 | Ga0466709_023308 | 3300042648 | Bacteria | 10603 |
| 26 | Ga0466724_33421 | 3300042649 | Bacteria | 3131 |
| 27 | Ga0466697_224456 | 3300042611 | Bacteria | 1913 |
| 28 | SCG598I22_11165 | 3300000462 | Bacteria | 45656 |
| 29 | CVPL010W_10021105 | 3300002931 | Bacteria | 3660 |
| 30 | CVPL005W_1001637 | 3300002934 | Bacteria | 6091 |
| 31 | CVPL005L_10011288 | 3300002938 | Bacteria | 8835 |
| 32 | Ga0063521_1000009 | 3300003973 | Bacteria | 190208 |
| 33 | Ga0102739_1006498 | 3300007095 | Bacteria | 1570 |
| 34 | Ga0102734_1002608 | 3300007129 | Bacteria | 4475 |
| 35 | Ga0102740_1000281 | 3300007140 | Bacteria | 14480 |
| 36 | Ga0102738_1000053 | 3300007141 | Bacteria | 48646 |
| 37 | Ga0102738_1001855 | 3300007141 | Bacteria | 3223 |
| 38 | Ga0102737_1000013 | 3300007142 | Bacteria | 54146 |
| 39 | Ga0103268_1021267 | 3300007192 | Bacteria | 1470 |
| 40 | Ga0123355_10125761 | 3300009826 | Bacteria | 3962 |
| 41 | Ga0466706_050992 | 3300042599 | Bacteria | 9334 |
| 42 | Ga0466707_360682 | 3300042601 | Bacteria | 24713 |
| 43 | Ga0466716_212663 | 3300042605 | Bacteria | 18159 |
| 44 | Ga0466719_235576 | 3300042606 | Bacteria | 2537 |
| 45 | Ga0466719_502196 | 3300042606 | Bacteria | 19826 |
| 46 | Ga0466722_036985 | 3300042609 | Bacteria | 64137 |
| 47 | Ga0466705_511922 | 3300042612 | Bacteria | 1724 |
| 48 | Ga0466710_354410 | 3300042613 | Bacteria | 3466 |
| 49 | Ga0466715_023961 | 3300042616 | Bacteria | 4518 |
| 50 | Ga0466723_221711 | 3300042618 | Bacteria | 10388 |
| 51 | Ga0160432_100139 | 3300012818 | Bacteria | 68754 |
| 52 | Ga0160433_100098 | 3300012846 | Bacteria | 87666 |
| 53 | Ga0160443_100313 | 3300012848 | Bacteria | 45770 |
| 54 | Ga0160447_104409 | 3300012849 | Unclassified | 4171 |
| 55 | Ga0160430_105220 | 3300012852 | Bacteria | 3026 |
| 56 | Ga0466657_328796 | 3300042582 | Bacteria | 1631 |
| 57 | Ga0466694_387143 | 3300042594 | Bacteria | 27026 |
| 58 | Ga0466729_252102 | 3300042621 | Bacteria | 2781 |
| 59 | Ga0466704_204274 | 3300042643 | Bacteria | 3390 |
| 60 | Ga0466704_350815 | 3300042643 | Unclassified | 7356 |
| 61 | Ga0466704_370196 | 3300042643 | Unclassified | 7093 |
| 62 | Ga0466709_180344 | 3300042648 | Bacteria | 52700 |
| 63 | Ga0466709_333206 | 3300042648 | Bacteria | 12214 |
| 64 | Ga0466708_197678 | 3300042652 | Unclassified | 8496 |
| 65 | Ga0466705_075585 | 3300042612 | Bacteria | 2421 |
| 66 | Ga0466732_310786 | 3300042656 | Bacteria | 3749 |
| 67 | Ga0466733_025503 | 3300042659 | Bacteria | 7283 |
| 68 | DPOL_contig01005 | 2035918003 | Unclassified | 3843 |
| 69 | SCG598P17_12889 | 3300000461 | Bacteria | 102048 |
| 70 | Ga0074278_117976 | 3300005721 | Bacteria | 1342 |
| 71 | Ga0103263_100243 | 3300007042 | Bacteria | 8099 |
| 72 | Ga0102736_1000058 | 3300007052 | Unclassified | 28916 |
| 73 | Ga0102734_1002946 | 3300007129 | Bacteria | 6506 |
| 74 | Ga0102738_1000253 | 3300007141 | Bacteria | 12264 |
| 75 | Ga0103268_1001892 | 3300007192 | Bacteria | 4878 |
| 76 | Ga0123357_10000869 | 3300009784 | Bacteria | 30813 |
| 77 | Ga0123354_10000048 | 3300010882 | Bacteria | 91660 |
| 78 | Ga0466706_091212 | 3300042599 | Bacteria | 2107 |
| 79 | Ga0466713_072810 | 3300042602 | Bacteria | 4348 |
| 80 | Ga0466717_257098 | 3300042604 | Bacteria | 1047 |
| 81 | Ga0466716_538507 | 3300042605 | Bacteria | 3136 |
| 82 | Ga0466705_425873 | 3300042612 | Bacteria | 39314 |
| 83 | Ga0466705_518078 | 3300042612 | Bacteria | 1975 |
| 84 | Ga0466715_042530 | 3300042616 | Bacteria | 11739 |
| 85 | Ga0466715_200302 | 3300042616 | Bacteria | 3796 |
| 86 | Ga0466728_151858 | 3300042620 | Bacteria | 8528 |
| 87 | Ga0160452_100095 | 3300012834 | Unclassified | 117643 |
| 88 | Ga0466734_071296 | 3300042623 | Bacteria | 19945 |
| 89 | Ga0466708_108901 | 3300042652 | Bacteria | 52993 |
| 90 | Ga0466733_115242 | 3300042659 | Bacteria | 220013 |
| 91 | SCG598B02_13034 | 3300000472 | Bacteria | 53304 |
| 92 | JGI24705J35276_12237817 | 3300002504 | Bacteria | 13336 |
| 93 | CVPL010W_10011352 | 3300002931 | Bacteria | 7433 |
| 94 | CVPL010W_10025234 | 3300002931 | Bacteria | 2862 |
| 95 | Ga0068302_10214749 | 3300005071 | Bacteria | 1267 |
| 96 | Ga0074278_131570 | 3300005721 | Unclassified | 8052 |
| 97 | Ga0103266_1000596 | 3300007067 | Bacteria | 7167 |
| 98 | Ga0103261_1000048 | 3300007083 | Bacteria | 38400 |
| 99 | Ga0123354_10033324 | 3300010882 | Bacteria | 8066 |
| 100 | Ga0466719_446123 | 3300042606 | Bacteria | 2678 |
| 101 | Ga0466705_391635 | 3300042612 | Unclassified | 6109 |
| 102 | Ga0466718_148532 | 3300042617 | Bacteria | 2332 |
| 103 | Ga0466723_281216 | 3300042618 | Bacteria | 3012 |
| 104 | Ga0466728_402123 | 3300042620 | Bacteria | 9171 |
| 105 | Ga0160456_100022 | 3300012820 | Bacteria | 269020 |
| 106 | Ga0160436_1000007 | 3300012861 | Bacteria | 161775 |
| 107 | Ga0415639_021139 | 3300038395 | Bacteria | 4072 |
| 108 | Ga0415639_034868 | 3300038395 | Bacteria | 3729 |
| 109 | Ga0466656_294034 | 3300042550 | Bacteria | 2201 |
| 110 | Ga0466692_097692 | 3300042591 | Bacteria | 14014 |
| 111 | Ga0466729_281628 | 3300042621 | Bacteria | 225559 |
| 112 | Ga0466734_024434 | 3300042623 | Bacteria | 2018 |
| 113 | Ga0466734_161418 | 3300042623 | Bacteria | 29362 |
| 114 | Ga0466730_009661 | 3300042625 | Bacteria | 21517 |
| 115 | Ga0466703_180206 | 3300042636 | Bacteria | 2099 |
| 116 | Ga0466724_08874 | 3300042649 | Bacteria | 14343 |
| 117 | Ga0466724_59786 | 3300042649 | Bacteria | 44500 |
| 118 | Ga0466733_171037 | 3300042659 | Bacteria | 6257 |
| 119 | JGI24705J35276_12236287 | 3300002504 | Bacteria | 7774 |
| 120 | CVPL010W_10006624 | 3300002931 | Bacteria | 11772 |
| 121 | Ga0072940_1177306 | 3300005200 | Bacteria | 3039 |
| 122 | Ga0072941_1072695 | 3300005201 | Bacteria | 3103 |
| 123 | Ga0102740_1005500 | 3300007140 | Bacteria | 2373 |
| 124 | Ga0102737_1005365 | 3300007142 | Bacteria | 2563 |
| 125 | Ga0103264_1006659 | 3300007188 | Bacteria | 5548 |
| 126 | Ga0127645_146556 | 3300009461 | Unclassified | 2723 |
| 127 | Ga0123357_10089434 | 3300009784 | Bacteria | 4020 |
| 128 | Ga0123357_10187373 | 3300009784 | Bacteria | 2396 |
| 129 | Ga0123356_10076935 | 3300010049 | Bacteria | 3146 |
| 130 | Ga0123353_10024721 | 3300010167 | Bacteria | 9127 |
| 131 | Ga0123354_10049251 | 3300010882 | Bacteria | 6393 |
| 132 | Ga0466706_009931 | 3300042599 | Bacteria | 2506 |
| 133 | Ga0466707_006559 | 3300042601 | Bacteria | 1206 |
| 134 | Ga0466713_027261 | 3300042602 | Bacteria | 28095 |
| 135 | Ga0466698_274189 | 3300042610 | Bacteria | 2008 |
| 136 | Ga0466715_276542 | 3300042616 | Bacteria | 18301 |
| 137 | Ga0466718_136890 | 3300042617 | Bacteria | 1299 |
| 138 | Ga0160440_100020 | 3300012815 | Bacteria | 297910 |
| 139 | Ga0160444_100343 | 3300012841 | Bacteria | 27779 |
| 140 | Ga0160447_101916 | 3300012849 | Bacteria | 7690 |
| 141 | Ga0160434_100964 | 3300012850 | Bacteria | 5956 |
| 142 | Ga0316159_10003 | 3300030930 | Bacteria | 422460 |
| 143 | Ga0466657_114499 | 3300042582 | Bacteria | 1338 |
| 144 | Ga0466657_258557 | 3300042582 | Bacteria | 2656 |
| 145 | Ga0466734_001100 | 3300042623 | Bacteria | 15559 |
| 146 | Ga0466734_093934 | 3300042623 | Bacteria | 17242 |
| 147 | Ga0466735_085821 | 3300042624 | Bacteria | 15332 |
| 148 | Ga0466703_179064 | 3300042636 | Bacteria | 1881 |
| 149 | Ga0466704_335275 | 3300042643 | Bacteria | 16018 |
| 150 | Ga0466725_343034 | 3300042654 | Bacteria | 8145 |
| 151 | Ga0466705_256870 | 3300042612 | Bacteria | 4755 |
| 152 | gam1t_NODE_10840_length=100971_GC=34_2_Contigs=1 | 2189573031 | Bacteria | 100971 |
| 153 | gam1t_NODE_600063_length=49977_GC=36_2_Contigs=3 | 2189573031 | Bacteria | 49997 |
| 154 | HBC_ctgsDRAFT_1003971 | 3300000333 | Unclassified | 3399 |
| 155 | CVPL005W_1000998 | 3300002934 | Bacteria | 8684 |
| 156 | Ga0074278_146800 | 3300005721 | Unclassified | 9281 |
| 157 | Ga0102736_1000317 | 3300007052 | Bacteria | 10418 |
| 158 | Ga0103266_1004899 | 3300007067 | Bacteria | 1769 |
| 159 | Ga0102739_1000045 | 3300007095 | Bacteria | 35022 |
| 160 | Ga0104019_1193207 | 3300007150 | Bacteria | 1488 |
| 161 | Ga0466700_187485 | 3300042600 | Bacteria | 6331 |
| 162 | Ga0466698_373043 | 3300042610 | Bacteria | 2354 |
| 163 | Ga0466711_082470 | 3300042615 | Bacteria | 1531 |
| 164 | Ga0466711_332132 | 3300042615 | Unclassified | 4136 |
| 165 | Ga0466715_225474 | 3300042616 | Bacteria | 21836 |
| 166 | Ga0466715_437149 | 3300042616 | Bacteria | 22616 |
| 167 | Ga0160467_100092 | 3300012829 | Bacteria | 130870 |
| 168 | Ga0160444_100124 | 3300012841 | Bacteria | 82291 |
| 169 | Ga0160445_100199 | 3300012847 | Bacteria | 46065 |
| 170 | Ga0160457_1000058 | 3300012858 | Bacteria | 178891 |
| 171 | Ga0466657_019628 | 3300042582 | Bacteria | 3430 |
| 172 | Ga0466657_048119 | 3300042582 | Bacteria | 2400 |
| 173 | Ga0466693_001823 | 3300042592 | Bacteria | 2022 |
| 174 | Ga0466691_056478 | 3300042593 | Bacteria | 53505 |
| 175 | Ga0466694_288791 | 3300042594 | Bacteria | 3667 |
| 176 | Ga0466701_007583 | 3300042598 | Bacteria | 11497 |
| 177 | Ga0466725_220900 | 3300042654 | Bacteria | 23606 |
| 178 | Ga0466733_065275 | 3300042659 | Bacteria | 86472 |
| 179 | SCG598I20_12770 | 3300000473 | Bacteria | 55316 |
| 180 | JGI24702J35022_10001333 | 3300002462 | Bacteria | 15340 |
| 181 | JGI24705J35276_12237881 | 3300002504 | Bacteria | 13815 |
| 182 | WW0001_100248 | 3300002732 | Bacteria | 167261 |
| 183 | JGI24696J40584_12957324 | 3300002834 | Bacteria | 3456 |
| 184 | CVPL010W_10008965 | 3300002931 | Bacteria | 10687 |
| 185 | Ga0074278_129590 | 3300005721 | Bacteria | 100971 |
| 186 | Ga0102735_1000622 | 3300007080 | Bacteria | 7548 |
| 187 | Ga0102734_1000081 | 3300007129 | Bacteria | 29333 |
| 188 | Ga0103260_1000422 | 3300007139 | Bacteria | 8137 |
| 189 | Ga0103260_1000519 | 3300007139 | Bacteria | 7385 |
| 190 | Ga0102737_1000476 | 3300007142 | Bacteria | 13073 |
| 191 | Ga0103267_1000001 | 3300007190 | Bacteria | 112220 |
| 192 | Ga0123357_10067475 | 3300009784 | Bacteria | 4765 |
| 193 | Ga0123356_10030709 | 3300010049 | Bacteria | 5027 |
| 194 | Ga0123353_10010582 | 3300010167 | Bacteria | 12876 |
| 195 | Ga0123353_10228965 | 3300010167 | Bacteria | 2900 |
| 196 | Ga0123354_10000607 | 3300010882 | Bacteria | 37348 |
| 197 | Ga0123354_10043665 | 3300010882 | Bacteria | 6888 |
| 198 | Ga0160471_100214 | 3300012812 | Unclassified | 20316 |
| 199 | Ga0160470_100064 | 3300012813 | Bacteria | 153495 |
| 200 | Ga0466701_068458 | 3300042598 | Bacteria | 165759 |
| 201 | Ga0466719_067139 | 3300042606 | Bacteria | 7598 |
| 202 | Ga0466705_391316 | 3300042612 | Bacteria | 1631 |
| 203 | Ga0466715_163671 | 3300042616 | Bacteria | 20103 |
| 204 | Ga0466723_123689 | 3300042618 | Bacteria | 19530 |
| 205 | Ga0466728_132354 | 3300042620 | Bacteria | 3038 |
| 206 | Ga0160460_100129 | 3300012845 | Bacteria | 90952 |
| 207 | Ga0160460_105710 | 3300012845 | Bacteria | 1758 |
| 208 | Ga0160448_100185 | 3300012854 | Bacteria | 26347 |
| 209 | Ga0466730_086542 | 3300042625 | Bacteria | 1634 |
| 210 | Ga0466724_62208 | 3300042649 | Unclassified | 9961 |
| 211 | Ga0466708_074047 | 3300042652 | Bacteria | 28825 |
| 212 | Ga0466708_096890 | 3300042652 | Bacteria | 20475 |
| 213 | Ga0466725_088086 | 3300042654 | Bacteria | 4927 |
| 214 | Ga0466733_031990 | 3300042659 | Bacteria | 21694 |
| 215 | CVPL010W_10036303 | 3300002931 | Bacteria | 1650 |
| 216 | Ga0103260_1000473 | 3300007139 | Bacteria | 8211 |
| 217 | Ga0102740_1000080 | 3300007140 | Bacteria | 23416 |
| 218 | Ga0123357_10013687 | 3300009784 | Bacteria | 10548 |
| 219 | Ga0160454_100047 | 3300012798 | Unclassified | 197474 |
| 220 | Ga0466717_007140 | 3300042604 | Bacteria | 6609 |
| 221 | Ga0466717_159377 | 3300042604 | Bacteria | 10175 |
| 222 | Ga0466717_230118 | 3300042604 | Bacteria | 3280 |
| 223 | Ga0466698_024981 | 3300042610 | Bacteria | 1849 |
| 224 | Ga0466710_155008 | 3300042613 | Bacteria | 19269 |
| 225 | Ga0466710_262153 | 3300042613 | Bacteria | 1992 |
| 226 | Ga0466710_449998 | 3300042613 | Bacteria | 1572 |
| 227 | Ga0466728_039683 | 3300042620 | Bacteria | 17092 |
| 228 | Ga0160458_100011 | 3300012832 | Bacteria | 403207 |
| 229 | Ga0160434_104350 | 3300012850 | Unclassified | 2362 |
| 230 | Ga0160435_1000043 | 3300012857 | Bacteria | 95813 |
| 231 | Ga0466692_125691 | 3300042591 | Bacteria | 4648 |
| 232 | Ga0466696_346646 | 3300042596 | Bacteria | 8612 |
| 233 | Ga0466734_037851 | 3300042623 | Bacteria | 2408 |
| 234 | Ga0466734_147047 | 3300042623 | Bacteria | 2121 |
| 235 | Ga0466735_167274 | 3300042624 | Bacteria | 1222 |
| 236 | Ga0466703_091769 | 3300042636 | Bacteria | 2982 |
| 237 | Ga0466708_204728 | 3300042652 | Bacteria | 3855 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042582 | Ga0466657_328796 | Ga0466657_328796_20_865 | 281 |
| 2 | 3300042604 | Ga0466717_257098 | Ga0466717_257098_140_1015 | 291 |
| 3 | 3300012812 | Ga0160471_100214 | Ga0160471_1002144 | 304 |
| 4 | 3300012845 | Ga0160460_100128 | Ga0160460_10012890 | 304 |
| 5 | 3300042606 | Ga0466719_067139 | Ga0466719_067139_4047_5033 | 305 |
| 6 | 3300042620 | Ga0466728_039683 | Ga0466728_039683_9747_10733 | 305 |
| 7 | 3300042654 | Ga0466725_220900 | Ga0466725_220900_13727_14719 | 307 |
| 8 | 3300042590 | Ga0466690_105411 | Ga0466690_105411_4175_5161 | 308 |
| 9 | 3300042593 | Ga0466691_056478 | Ga0466691_056478_23004_23990 | 308 |
| 10 | 3300042615 | Ga0466711_332132 | Ga0466711_332132_931_1857 | 308 |
| 11 | 3300007080 | Ga0102735_1002454 | Ga0102735_10024543 | 309 |
| 12 | 3300042594 | Ga0466694_288791 | Ga0466694_288791_1545_2480 | 311 |
| 13 | 2035918003 | DPOL_contig01005 | DPOLB_2335810 | 312 |
| 14 | 3300005200 | Ga0072940_1177306 | Ga0072940_11773061 | 314 |
| 15 | 3300012835 | Ga0160446_100107 | Ga0160446_10010741 | 315 |
| 16 | 3300042605 | Ga0466716_538507 | Ga0466716_538507_670_1620 | 316 |
| 17 | 3300042613 | Ga0466710_155008 | Ga0466710_155008_8718_9716 | 316 |
| 18 | 3300042613 | Ga0466710_354410 | Ga0466710_354410_1293_2291 | 316 |
| 19 | 3300042613 | Ga0466710_449998 | Ga0466710_449998_347_1345 | 316 |
| 20 | 3300012861 | Ga0160436_1000007 | Ga0160436_1000007130 | 318 |
| 21 | 3300042612 | Ga0466705_256870 | Ga0466705_256870_3265_4299 | 318 |
| 22 | iso_pr_bacteria | 2858102877 | 2858103710 | 318 |
| 23 | iso_pr_bacteria | 2858129007 | 2858129971 | 318 |
| 24 | iso_pr_bacteria | 2868677537 | 2868679529 | 318 |
| 25 | 3300007190 | Ga0103267_1054568 | Ga0103267_10545681 | 321 |
| 26 | iso_pr_bacteria | 2791354941 | 2792066634 | 323 |
| 27 | iso_pr_bacteria | 2920413932 | 2920414331 | 323 |
| 28 | 3300012852 | Ga0160430_105220 | Ga0160430_1052205 | 326 |
| 29 | 3300042604 | Ga0466717_011008 | Ga0466717_011008_504_1484 | 326 |
| 30 | 3300042611 | Ga0466697_224456 | Ga0466697_224456_327_1307 | 326 |
| 31 | 3300042624 | Ga0466735_167274 | Ga0466735_167274_77_1057 | 326 |
| 32 | 3300042654 | Ga0466725_088086 | Ga0466725_088086_3461_4459 | 326 |
| 33 | 3300002504 | JGI24705J35276_12236287 | JGI24705J35276_122362875 | 327 |
| 34 | 3300002504 | JGI24705J35276_12237817 | JGI24705J35276_122378172 | 327 |
| 35 | 3300042598 | Ga0466701_006187 | Ga0466701_006187_8175_9200 | 327 |
| 36 | 3300042616 | Ga0466715_225474 | Ga0466715_225474_20800_21783 | 327 |
| 37 | 3300042623 | Ga0466734_024434 | Ga0466734_024434_635_1633 | 327 |
| 38 | 3300042636 | Ga0466703_091769 | Ga0466703_091769_242_1225 | 327 |
| 39 | 3300042636 | Ga0466703_180206 | Ga0466703_180206_867_1850 | 327 |
| 40 | 3300042643 | Ga0466704_370196 | Ga0466704_370196_364_1347 | 327 |
| 41 | 3300042652 | Ga0466708_108901 | Ga0466708_108901_15197_16180 | 327 |
| 42 | iso_pr_bacteria | 2891720358 | 2891724123 | 327 |
| 43 | 3300042590 | Ga0466690_002060 | Ga0466690_002060_594_1580 | 328 |
| 44 | 3300042594 | Ga0466694_387143 | Ga0466694_387143_23345_24331 | 328 |
| 45 | 3300042601 | Ga0466707_413653 | Ga0466707_413653_2760_3746 | 328 |
| 46 | 3300042604 | Ga0466717_159377 | Ga0466717_159377_4574_5593 | 328 |
| 47 | 3300042612 | Ga0466705_425873 | Ga0466705_425873_38005_39006 | 328 |
| 48 | 3300042618 | Ga0466723_123689 | Ga0466723_123689_2243_3229 | 328 |
| 49 | 3300042618 | Ga0466723_281216 | Ga0466723_281216_891_1877 | 328 |
| 50 | 3300042623 | Ga0466734_037851 | Ga0466734_037851_196_1197 | 328 |
| 51 | 3300042624 | Ga0466735_085821 | Ga0466735_085821_11415_12401 | 328 |
| 52 | 3300042643 | Ga0466704_335275 | Ga0466704_335275_10739_11725 | 328 |
| 53 | 3300042652 | Ga0466708_096890 | Ga0466708_096890_6275_7261 | 328 |
| 54 | 3300042659 | Ga0466733_115242 | Ga0466733_115242_215083_216069 | 328 |
| 55 | 3300038395 | Ga0415639_021139 | Ga0415639_021139_554_1543 | 329 |
| 56 | 3300038395 | Ga0415639_034868 | Ga0415639_034868_375_1364 | 329 |
| 57 | 3300042550 | Ga0466656_294034 | Ga0466656_294034_234_1223 | 329 |
| 58 | 3300042604 | Ga0466717_230118 | Ga0466717_230118_1742_2731 | 329 |
| 59 | 3300042606 | Ga0466719_235576 | Ga0466719_235576_205_1194 | 329 |
| 60 | 3300042606 | Ga0466719_502196 | Ga0466719_502196_8259_9248 | 329 |
| 61 | 3300042610 | Ga0466698_024981 | Ga0466698_024981_391_1380 | 329 |
| 62 | 3300042610 | Ga0466698_373043 | Ga0466698_373043_928_1917 | 329 |
| 63 | 3300042615 | Ga0466711_352641 | Ga0466711_352641_859_1848 | 329 |
| 64 | 3300042616 | Ga0466715_276542 | Ga0466715_276542_6160_7149 | 329 |
| 65 | 3300042648 | Ga0466709_333206 | Ga0466709_333206_4600_5589 | 329 |
| 66 | 3300042652 | Ga0466708_074047 | Ga0466708_074047_7686_8675 | 329 |
| 67 | iso_pr_bacteria | 2820070515 | 2820070853 | 329 |
| 68 | iso_pr_bacteria | 2864808494 | 2864811789 | 329 |
| 69 | iso_pr_bacteria | 2864812326 | 2864815391 | 329 |
| 70 | 3300010167 | Ga0123353_10057430 | Ga0123353_100574303 | 330 |
| 71 | 3300010167 | Ga0123353_10228965 | Ga0123353_102289652 | 330 |
| 72 | 3300012841 | Ga0160444_100124 | Ga0160444_10012456 | 330 |
| 73 | 3300042591 | Ga0466692_097692 | Ga0466692_097692_11121_12113 | 330 |
| 74 | 3300042596 | Ga0466696_346646 | Ga0466696_346646_3837_4829 | 330 |
| 75 | 3300042599 | Ga0466706_091212 | Ga0466706_091212_894_1886 | 330 |
| 76 | 3300042609 | Ga0466722_036985 | Ga0466722_036985_39888_40880 | 330 |
| 77 | 3300042612 | Ga0466705_075585 | Ga0466705_075585_524_1516 | 330 |
| 78 | 3300042612 | Ga0466705_518078 | Ga0466705_518078_734_1726 | 330 |
| 79 | 3300042615 | Ga0466711_082470 | Ga0466711_082470_178_1170 | 330 |
| 80 | 3300042620 | Ga0466728_402123 | Ga0466728_402123_6375_7367 | 330 |
| 81 | 3300042649 | Ga0466724_59786 | Ga0466724_59786_861_1886 | 330 |
| 82 | 3300042649 | Ga0466724_62208 | Ga0466724_62208_862_1887 | 330 |
| 83 | 3300042652 | Ga0466708_204728 | Ga0466708_204728_194_1186 | 330 |
| 84 | 3300042659 | Ga0466733_171037 | Ga0466733_171037_267_1259 | 330 |
| 85 | iso_pr_bacteria | 2832037495 | 2832039375 | 330 |
| 86 | iso_pr_bacteria | 2832039703 | 2832040494 | 330 |
| 87 | iso_pr_bacteria | 8065338428 | 8065340318 | 330 |
| 88 | 3300009784 | Ga0123357_10034017 | Ga0123357_100340178 | 331 |
| 89 | 3300010882 | Ga0123354_10043665 | Ga0123354_100436652 | 331 |
| 90 | 3300010882 | Ga0123354_10049251 | Ga0123354_100492511 | 331 |
| 91 | 3300012798 | Ga0160454_100047 | Ga0160454_100047166 | 331 |
| 92 | 3300012818 | Ga0160432_100139 | Ga0160432_10013933 | 331 |
| 93 | 3300012847 | Ga0160445_100199 | Ga0160445_10019926 | 331 |
| 94 | 3300012848 | Ga0160443_100313 | Ga0160443_10031321 | 331 |
| 95 | 3300012861 | Ga0160436_1006400 | Ga0160436_10064003 | 331 |
| 96 | 3300042602 | Ga0466713_072810 | Ga0466713_072810_1863_2858 | 331 |
| 97 | 3300042648 | Ga0466709_180344 | Ga0466709_180344_38206_39201 | 331 |
| 98 | 3300007190 | Ga0103267_1000001 | Ga0103267_100000120 | 332 |
| 99 | 3300042598 | Ga0466701_068458 | Ga0466701_068458_17201_18199 | 332 |
| 100 | 3300042601 | Ga0466707_006559 | Ga0466707_006559_54_1052 | 332 |
| 101 | 3300042601 | Ga0466707_360682 | Ga0466707_360682_11794_12792 | 332 |
| 102 | 3300042605 | Ga0466716_212663 | Ga0466716_212663_10527_11525 | 332 |
| 103 | 3300042616 | Ga0466715_023961 | Ga0466715_023961_1358_2356 | 332 |
| 104 | 3300042616 | Ga0466715_492705 | Ga0466715_492705_960_1958 | 332 |
| 105 | 3300042623 | Ga0466734_161418 | Ga0466734_161418_20260_21276 | 332 |
| 106 | 3300042625 | Ga0466730_009661 | Ga0466730_009661_19753_20751 | 332 |
| 107 | 3300042625 | Ga0466730_013512 | Ga0466730_013512_505_1503 | 332 |
| 108 | 3300042652 | Ga0466708_197678 | Ga0466708_197678_180_1178 | 332 |
| 109 | 3300042659 | Ga0466733_031990 | Ga0466733_031990_20666_21664 | 332 |
| 110 | iso_pr_bacteria | 2597489944 | 2598056328 | 332 |
| 111 | iso_pr_bacteria | 3003869270 | 3003869576 | 332 |
| 112 | iso_pr_bacteria | 3003878002 | 3003878298 | 332 |
| 113 | iso_pr_bacteria | 8023724303 | 8023728323 | 332 |
| 114 | iso_pr_bacteria | 8023747282 | 8023751471 | 332 |
| 115 | iso_pr_bacteria | 8023752828 | 8023756241 | 332 |
| 116 | iso_pr_bacteria | 8023757577 | 8023761597 | 332 |
| 117 | iso_pr_bacteria | 8023764196 | 8023769336 | 332 |
| 118 | iso_pr_bacteria | 8024001094 | 8024001278 | 332 |
| 119 | iso_pr_bacteria | 8024014383 | 8024014563 | 332 |
| 120 | iso_pr_bacteria | 8024019580 | 8024022320 | 332 |
| 121 | iso_pr_bacteria | 8024025509 | 8024028085 | 332 |
| 122 | iso_pr_bacteria | 8024037630 | 8024037816 | 332 |
| 123 | iso_pr_bacteria | 8024044713 | 8024044908 | 332 |
| 124 | iso_pr_bacteria | 8025650824 | 8025651022 | 332 |
| 125 | iso_pr_bacteria | 8025658853 | 8025659374 | 332 |
| 126 | iso_pr_bacteria | 8025666332 | 8025666547 | 332 |
| 127 | iso_pr_bacteria | 8025671076 | 8025671248 | 332 |
| 128 | iso_pr_bacteria | 8025678175 | 8025678357 | 332 |
| 129 | iso_pr_bacteria | 8025685901 | 8025686419 | 332 |
| 130 | iso_pr_bacteria | 8025694439 | 8025694721 | 332 |
| 131 | iso_pr_bacteria | 8025701579 | 8025705696 | 332 |
| 132 | iso_pr_bacteria | 8025708040 | 8025708291 | 332 |
| 133 | iso_pr_bacteria | 8025716094 | 8025716592 | 332 |
| 134 | iso_pr_bacteria | 8025723035 | 8025723211 | 332 |
| 135 | iso_pr_bacteria | 8025728939 | 8025729199 | 332 |
| 136 | iso_pr_bacteria | 8025735396 | 8025735967 | 332 |
| 137 | iso_pr_bacteria | 8025740903 | 8025741081 | 332 |
| 138 | iso_pr_bacteria | 8025747911 | 8025748113 | 332 |
| 139 | iso_pr_bacteria | 8025756023 | 8025756225 | 332 |
| 140 | iso_pr_bacteria | 8069748016 | 8069748838 | 332 |
| 141 | iso_pr_bacteria | 8069755105 | 8069755307 | 332 |
| 142 | iso_pr_bacteria | 8069763219 | 8069763397 | 332 |
| 143 | iso_pr_bacteria | 8069770227 | 8069774416 | 332 |
| 144 | iso_pr_bacteria | 8069775773 | 8069779186 | 332 |
| 145 | iso_pr_bacteria | 8078130113 | 8078130293 | 332 |
| 146 | iso_pr_bacteria | 8101951471 | 8101951688 | 332 |
| 147 | iso_pr_bacteria | 8101960468 | 8101960685 | 332 |
| 148 | iso_pr_bacteria | 8101967387 | 8101967604 | 332 |
| 149 | iso_pr_bacteria | 8101974301 | 8101974518 | 332 |
| 150 | iso_pr_bacteria | 8101981714 | 8101981994 | 332 |
| 151 | iso_pr_bacteria | 8101988189 | 8101988494 | 332 |
| 152 | iso_pr_bacteria | 8101994502 | 8101994997 | 332 |
| 153 | iso_pr_bacteria | 8102001125 | 8102001259 | 332 |
| 154 | iso_pr_bacteria | 8102007614 | 8102007824 | 332 |
| 155 | iso_pr_bacteria | 8102014801 | 8102014975 | 332 |
| 156 | iso_pr_bacteria | 8102020860 | 8102021361 | 332 |
| 157 | iso_pr_bacteria | 8102026984 | 8102027304 | 332 |
| 158 | iso_pr_bacteria | 8102033761 | 8102034198 | 332 |
| 159 | iso_pr_bacteria | 8102041249 | 8102041426 | 332 |
| 160 | iso_pr_bacteria | 8102047609 | 8102047969 | 332 |
| 161 | iso_pr_bacteria | 8102054868 | 8102055092 | 332 |
| 162 | iso_pr_bacteria | 8102060671 | 8102060944 | 332 |
| 163 | iso_pr_bacteria | 8102067727 | 8102068029 | 332 |
| 164 | iso_pr_bacteria | 8102074813 | 8102075051 | 332 |
| 165 | iso_pr_bacteria | 8102081745 | 8102082111 | 332 |
| 166 | iso_pr_bacteria | 8102087471 | 8102087718 | 332 |
| 167 | iso_pr_bacteria | 8102094248 | 8102094742 | 332 |
| 168 | iso_pr_bacteria | 8102102351 | 8102102583 | 332 |
| 169 | iso_pr_bacteria | 8102109360 | 8102109576 | 332 |
| 170 | iso_pr_bacteria | 8102117041 | 8102117242 | 332 |
| 171 | iso_pr_bacteria | 8102124461 | 8102124865 | 332 |
| 172 | iso_pr_bacteria | 8102131453 | 8102132339 | 332 |
| 173 | iso_pr_bacteria | 8102138357 | 8102138550 | 332 |
| 174 | iso_pr_bacteria | 8102145433 | 8102149453 | 332 |
| 175 | iso_pr_bacteria | 8102152052 | 8102157192 | 332 |
| 176 | iso_pr_bacteria | 8102161003 | 8102165015 | 332 |
| 177 | iso_pr_bacteria | 8102169119 | 8102169690 | 332 |
| 178 | iso_pr_bacteria | 8102174626 | 8102174886 | 332 |
| 179 | iso_pr_bacteria | 8102181083 | 8102181259 | 332 |
| 180 | iso_pr_bacteria | 8102186987 | 8102187485 | 332 |
| 181 | iso_pr_bacteria | 8102193924 | 8102194175 | 332 |
| 182 | iso_pr_bacteria | 8102201977 | 8102206094 | 332 |
| 183 | iso_pr_bacteria | 8102208438 | 8102208636 | 332 |
| 184 | iso_pr_bacteria | 8102216467 | 8102216749 | 332 |
| 185 | iso_pr_bacteria | 8102223607 | 8102223779 | 332 |
| 186 | iso_pr_bacteria | 8102230706 | 8102231224 | 332 |
| 187 | iso_pr_bacteria | 8102239244 | 8102239426 | 332 |
| 188 | iso_pr_bacteria | 8102246966 | 8102247181 | 332 |
| 189 | iso_pr_bacteria | 8102251710 | 8102252231 | 332 |
| 190 | iso_pr_bacteria | 8102264549 | 8102264857 | 332 |
| 191 | iso_pr_bacteria | 8102271933 | 8102272320 | 332 |
| 192 | iso_pr_bacteria | 8102279326 | 8102279527 | 332 |
| 193 | iso_pr_bacteria | 8102286609 | 8102287048 | 332 |
| 194 | iso_pr_bacteria | 8102312426 | 8102312643 | 332 |
| 195 | 3300012834 | Ga0160452_100095 | Ga0160452_100095105 | 333 |
| 196 | 3300012849 | Ga0160447_101916 | Ga0160447_1019166 | 333 |
| 197 | 3300012849 | Ga0160447_104409 | Ga0160447_1044093 | 333 |
| 198 | 3300012850 | Ga0160434_104350 | Ga0160434_1043504 | 333 |
| 199 | 3300042613 | Ga0466710_262153 | Ga0466710_262153_211_1248 | 333 |
| 200 | 3300042621 | Ga0466729_252102 | Ga0466729_252102_1625_2626 | 333 |
| 201 | 3300042623 | Ga0466734_093934 | Ga0466734_093934_4014_5015 | 333 |
| 202 | 3300042643 | Ga0466704_204274 | Ga0466704_204274_1862_2863 | 333 |
| 203 | iso_pr_bacteria | 2718217749 | 2718706031 | 333 |
| 204 | 3300007067 | Ga0103266_1000596 | Ga0103266_10005966 | 334 |
| 205 | 3300042582 | Ga0466657_019628 | Ga0466657_019628_2225_3229 | 334 |
| 206 | 3300042582 | Ga0466657_114499 | Ga0466657_114499_195_1214 | 334 |
| 207 | 3300042582 | Ga0466657_258557 | Ga0466657_258557_711_1715 | 334 |
| 208 | 3300042612 | Ga0466705_122577 | Ga0466705_122577_2292_3296 | 334 |
| 209 | 3300042612 | Ga0466705_391635 | Ga0466705_391635_255_1259 | 334 |
| 210 | 3300042616 | Ga0466715_042530 | Ga0466715_042530_9745_10749 | 334 |
| 211 | 3300042636 | Ga0466703_179064 | Ga0466703_179064_582_1586 | 334 |
| 212 | 3300042656 | Ga0466732_310786 | Ga0466732_310786_592_1596 | 334 |
| 213 | iso_pr_bacteria | 2501651205 | 2501715446 | 334 |
| 214 | iso_pr_bacteria | 2585427605 | 2585889431 | 334 |
| 215 | iso_pr_bacteria | 2585428048 | 2587694132 | 334 |
| 216 | iso_pr_bacteria | 2775506951 | 2776479231 | 334 |
| 217 | iso_pr_bacteria | 2821312900 | 2821313408 | 334 |
| 218 | iso_pr_bacteria | 2900132049 | 2900132730 | 334 |
| 219 | iso_pr_bacteria | 3002773460 | 3002773553 | 334 |
| 220 | 3300002931 | CVPL010W_10021105 | CVPL010W_100211052 | 335 |
| 221 | 3300010882 | Ga0123354_10000048 | Ga0123354_1000004831 | 335 |
| 222 | 3300042598 | Ga0466701_007583 | Ga0466701_007583_10372_11379 | 335 |
| 223 | 3300042600 | Ga0466700_187485 | Ga0466700_187485_541_1548 | 335 |
| 224 | 3300042612 | Ga0466705_204928 | Ga0466705_204928_5013_6020 | 335 |
| 225 | 3300042612 | Ga0466705_511922 | Ga0466705_511922_393_1400 | 335 |
| 226 | 3300042617 | Ga0466718_136890 | Ga0466718_136890_126_1133 | 335 |
| 227 | 3300042617 | Ga0466718_148532 | Ga0466718_148532_881_1888 | 335 |
| 228 | 3300042618 | Ga0466723_221711 | Ga0466723_221711_5786_6793 | 335 |
| 229 | 3300042620 | Ga0466728_151858 | Ga0466728_151858_1797_2804 | 335 |
| 230 | 3300042621 | Ga0466729_281628 | Ga0466729_281628_173293_174300 | 335 |
| 231 | 3300042643 | Ga0466704_556028 | Ga0466704_556028_6594_7601 | 335 |
| 232 | 3300042643 | Ga0466704_596754 | Ga0466704_596754_608_1615 | 335 |
| 233 | iso_pr_bacteria | 2508501043 | 2508701709 | 335 |
| 234 | iso_pr_bacteria | 2889908211 | 2889908768 | 335 |
| 235 | iso_pr_bacteria | 2902896024 | 2902899415 | 335 |
| 236 | 3300009784 | Ga0123357_10067475 | Ga0123357_100674755 | 336 |
| 237 | 3300009784 | Ga0123357_10089434 | Ga0123357_100894343 | 336 |
| 238 | 3300010049 | Ga0123356_10030709 | Ga0123356_100307092 | 336 |
| 239 | 3300010167 | Ga0123353_10010582 | Ga0123353_100105824 | 336 |
| 240 | 3300010167 | Ga0123353_10024721 | Ga0123353_100247215 | 336 |
| 241 | iso_pr_bacteria | 2820089333 | 2820089846 | 336 |
| 242 | 3300012846 | Ga0160433_100098 | Ga0160433_10009882 | 337 |
| 243 | 3300042590 | Ga0466690_340290 | Ga0466690_340290_21597_22610 | 337 |
| 244 | iso_pr_bacteria | 2510065004 | 2510076400 | 337 |
| 245 | iso_pr_bacteria | 2515154047 | 2515332162 | 337 |
| 246 | iso_pr_bacteria | 2515154048 | 2515334005 | 337 |
| 247 | iso_pr_bacteria | 2515154049 | 2515336843 | 337 |
| 248 | iso_pr_bacteria | 2684622922 | 2686094368 | 337 |
| 249 | iso_pr_bacteria | 2684622923 | 2686096812 | 337 |
| 250 | iso_pr_bacteria | 2684622924 | 2686099627 | 337 |
| 251 | iso_pr_bacteria | 2684622925 | 2686100463 | 337 |
| 252 | iso_pr_bacteria | 2684622926 | 2686105318 | 337 |
| 253 | iso_pr_bacteria | 2756170265 | 2756751895 | 337 |
| 254 | iso_pr_bacteria | 2785510744 | 2785738958 | 337 |
| 255 | iso_pr_bacteria | 2785510745 | 2785741426 | 337 |
| 256 | iso_pr_bacteria | 2785510746 | 2785742279 | 337 |
| 257 | iso_pr_bacteria | 2834098943 | 2834099595 | 337 |
| 258 | iso_pr_bacteria | 2837615801 | 2837618297 | 337 |
| 259 | iso_pr_bacteria | 2837618715 | 2837620248 | 337 |
| 260 | iso_pr_bacteria | 2838840603 | 2838840608 | 337 |
| 261 | iso_pr_bacteria | 2840795165 | 2840795557 | 337 |
| 262 | iso_pr_bacteria | 2840797934 | 2840798399 | 337 |
| 263 | iso_pr_bacteria | 2841195917 | 2841197863 | 337 |
| 264 | iso_pr_bacteria | 2843334863 | 2843335753 | 337 |
| 265 | iso_pr_bacteria | 2843337836 | 2843338019 | 337 |
| 266 | iso_pr_bacteria | 2846472545 | 2846473228 | 337 |
| 267 | iso_pr_bacteria | 2846475167 | 2846475354 | 337 |
| 268 | iso_pr_bacteria | 2846477985 | 2846480267 | 337 |
| 269 | iso_pr_bacteria | 2846480698 | 2846482361 | 337 |
| 270 | iso_pr_bacteria | 2846483029 | 2846483166 | 337 |
| 271 | iso_pr_bacteria | 2846485327 | 2846486969 | 337 |
| 272 | iso_pr_bacteria | 2846488152 | 2846488944 | 337 |
| 273 | iso_pr_bacteria | 2846490831 | 2846492995 | 337 |
| 274 | iso_pr_bacteria | 2846493360 | 2846494323 | 337 |
| 275 | iso_pr_bacteria | 2846495668 | 2846496094 | 337 |
| 276 | iso_pr_bacteria | 2849446820 | 2849448493 | 337 |
| 277 | iso_pr_bacteria | 2849449383 | 2849450466 | 337 |
| 278 | iso_pr_bacteria | 2849452216 | 2849453095 | 337 |
| 279 | iso_pr_bacteria | 2849455045 | 2849455303 | 337 |
| 280 | iso_pr_bacteria | 2849458003 | 2849458339 | 337 |
| 281 | iso_pr_bacteria | 2849460838 | 2849462809 | 337 |
| 282 | iso_pr_bacteria | 2849463436 | 2849465057 | 337 |
| 283 | iso_pr_bacteria | 2849466174 | 2849467497 | 337 |
| 284 | iso_pr_bacteria | 2849468476 | 2849471297 | 337 |
| 285 | iso_pr_bacteria | 2849471304 | 2849472147 | 337 |
| 286 | iso_pr_bacteria | 2854127928 | 2854129920 | 337 |
| 287 | iso_pr_bacteria | 2854129949 | 2854130880 | 337 |
| 288 | iso_pr_bacteria | 2854132136 | 2854133038 | 337 |
| 289 | iso_pr_bacteria | 2854134697 | 2854135757 | 337 |
| 290 | iso_pr_bacteria | 2854137290 | 2854138384 | 337 |
| 291 | iso_pr_bacteria | 2854139540 | 2854141473 | 337 |
| 292 | iso_pr_bacteria | 2854141978 | 2854143184 | 337 |
| 293 | iso_pr_bacteria | 2854144746 | 2854144790 | 337 |
| 294 | iso_pr_bacteria | 2854149989 | 2854150628 | 337 |
| 295 | iso_pr_bacteria | 2857868033 | 2857868208 | 337 |
| 296 | iso_pr_bacteria | 2857870431 | 2857871732 | 337 |
| 297 | iso_pr_bacteria | 2857873190 | 2857875769 | 337 |
| 298 | iso_pr_bacteria | 2857876020 | 2857876883 | 337 |
| 299 | iso_pr_bacteria | 2857878760 | 2857880796 | 337 |
| 300 | iso_pr_bacteria | 2857881114 | 2857881717 | 337 |
| 301 | iso_pr_bacteria | 2857883421 | 2857883964 | 337 |
| 302 | iso_pr_bacteria | 2857886120 | 2857886463 | 337 |
| 303 | iso_pr_bacteria | 2857888719 | 2857890825 | 337 |
| 304 | iso_pr_bacteria | 2857891623 | 2857893351 | 337 |
| 305 | iso_pr_bacteria | 2868486652 | 2868486983 | 337 |
| 306 | iso_pr_bacteria | 2868489326 | 2868491095 | 337 |
| 307 | iso_pr_bacteria | 2868492035 | 2868492575 | 337 |
| 308 | iso_pr_bacteria | 2868494745 | 2868495816 | 337 |
| 309 | iso_pr_bacteria | 2868497104 | 2868497913 | 337 |
| 310 | iso_pr_bacteria | 2868499409 | 2868500858 | 337 |
| 311 | iso_pr_bacteria | 2868504459 | 2868506608 | 337 |
| 312 | iso_pr_bacteria | 2868506828 | 2868508950 | 337 |
| 313 | iso_pr_bacteria | 2870897478 | 2870897847 | 337 |
| 314 | iso_pr_bacteria | 2870900452 | 2870901177 | 337 |
| 315 | iso_pr_bacteria | 2870902796 | 2870904308 | 337 |
| 316 | iso_pr_bacteria | 2870905362 | 2870906683 | 337 |
| 317 | iso_pr_bacteria | 2870908367 | 2870909848 | 337 |
| 318 | iso_pr_bacteria | 2870910722 | 2870912660 | 337 |
| 319 | iso_pr_bacteria | 2870913170 | 2870914181 | 337 |
| 320 | iso_pr_bacteria | 2870915472 | 2870916475 | 337 |
| 321 | iso_pr_bacteria | 2870917785 | 2870918679 | 337 |
| 322 | iso_pr_bacteria | 2870920129 | 2870921106 | 337 |
| 323 | iso_pr_bacteria | 2873633977 | 2873636071 | 337 |
| 324 | iso_pr_bacteria | 2873636219 | 2873636870 | 337 |
| 325 | iso_pr_bacteria | 2873640908 | 2873643311 | 337 |
| 326 | iso_pr_bacteria | 2873643457 | 2873643934 | 337 |
| 327 | iso_pr_bacteria | 2873645950 | 2873647659 | 337 |
| 328 | iso_pr_bacteria | 2873648542 | 2873650624 | 337 |
| 329 | iso_pr_bacteria | 2873651485 | 2873653427 | 337 |
| 330 | iso_pr_bacteria | 2873653628 | 2873654156 | 337 |
| 331 | iso_pr_bacteria | 2873656248 | 2873657299 | 337 |
| 332 | iso_pr_bacteria | 2876011797 | 2876013703 | 337 |
| 333 | iso_pr_bacteria | 2876014139 | 2876014458 | 337 |
| 334 | iso_pr_bacteria | 2876016455 | 2876017004 | 337 |
| 335 | iso_pr_bacteria | 2876019154 | 2876021882 | 337 |
| 336 | iso_pr_bacteria | 2876022486 | 2876024032 | 337 |
| 337 | iso_pr_bacteria | 2876025319 | 2876026183 | 337 |
| 338 | iso_pr_bacteria | 2876027665 | 2876028827 | 337 |
| 339 | iso_pr_bacteria | 2876030618 | 2876032284 | 337 |
| 340 | iso_pr_bacteria | 2876033458 | 2876033749 | 337 |
| 341 | iso_pr_bacteria | 2876036378 | 2876036636 | 337 |
| 342 | iso_pr_bacteria | 2878462549 | 2878464702 | 337 |
| 343 | iso_pr_bacteria | 2878464769 | 2878466679 | 337 |
| 344 | iso_pr_bacteria | 8088486376 | 8088487087 | 337 |
| 345 | iso_pr_bacteria | 8088488961 | 8088489609 | 337 |
| 346 | iso_pr_bacteria | 8088491222 | 8088493721 | 337 |
| 347 | iso_pr_bacteria | 8088493931 | 8088494622 | 337 |
| 348 | 3300000461 | SCG598P17_12889 | SCG598P17_1288917 | 338 |
| 349 | 3300000472 | SCG598B02_13034 | SCG598B02_1303432 | 338 |
| 350 | 3300000473 | SCG598I20_12770 | SCG598I20_1277032 | 338 |
| 351 | 3300002732 | WW0001_100248 | WW0001_100248103 | 338 |
| 352 | 3300005721 | Ga0074278_117976 | Ga0074278_1179761 | 338 |
| 353 | 3300005721 | Ga0074278_131570 | Ga0074278_1315706 | 338 |
| 354 | 3300012829 | Ga0160467_100092 | Ga0160467_10009219 | 338 |
| 355 | 3300042602 | Ga0466713_027261 | Ga0466713_027261_178_1194 | 338 |
| 356 | 3300042659 | Ga0466733_025503 | Ga0466733_025503_1224_2240 | 338 |
| 357 | iso_pr_bacteria | 2512047046 | 2512398146 | 338 |
| 358 | iso_pr_bacteria | 2820131053 | 2820131978 | 338 |
| 359 | iso_pr_bacteria | 2843904799 | 2843908559 | 338 |
| 360 | 3300012845 | Ga0160460_100129 | Ga0160460_10012970 | 339 |
| 361 | 3300042599 | Ga0466706_050992 | Ga0466706_050992_4932_5951 | 339 |
| 362 | 3300042648 | Ga0466709_023308 | Ga0466709_023308_204_1223 | 339 |
| 363 | iso_pr_bacteria | 2505679062 | 2505925682 | 339 |
| 364 | iso_pr_bacteria | 2585427711 | 2586307486 | 339 |
| 365 | iso_pr_bacteria | 2785510747 | 2785744744 | 339 |
| 366 | iso_pr_bacteria | 2854147632 | 2854149862 | 339 |
| 367 | iso_pr_bacteria | 2873638493 | 2873640666 | 339 |
| 368 | iso_pr_bacteria | 3001459110 | 3001459528 | 339 |
| 369 | iso_pr_bacteria | 3001462594 | 3001463373 | 339 |
| 370 | iso_pr_bacteria | 8065462725 | 8065463257 | 339 |
| 371 | iso_pr_bacteria | 8065466226 | 8065466378 | 339 |
| 372 | iso_pr_bacteria | 8065469765 | 8065470459 | 339 |
| 373 | iso_pr_bacteria | 8074288691 | 8074289212 | 339 |
| 374 | iso_pr_bacteria | 8074292191 | 8074293039 | 339 |
| 375 | iso_pr_bacteria | 8076033509 | 8076033556 | 339 |
| 376 | 2189573031 | gam1t_NODE_668966_length=9231_GC=35_7_Contigs=6 | gam1t_00031340 | 340 |
| 377 | 3300007095 | Ga0102739_1006498 | Ga0102739_10064982 | 340 |
| 378 | 3300009826 | Ga0123355_10125761 | Ga0123355_101257612 | 340 |
| 379 | 3300042592 | Ga0466693_001823 | Ga0466693_001823_64_1086 | 340 |
| 380 | iso_pr_bacteria | 2510065002 | 2510072806 | 340 |
| 381 | iso_pr_bacteria | 2510065003 | 2510075552 | 340 |
| 382 | iso_pr_bacteria | 2524614872 | 2526111659 | 340 |
| 383 | iso_pr_bacteria | 2744054871 | 2745948098 | 340 |
| 384 | iso_pr_bacteria | 2820042117 | 2820043348 | 340 |
| 385 | iso_pr_bacteria | 2820062699 | 2820064257 | 340 |
| 386 | iso_pr_bacteria | 2820121232 | 2820122323 | 340 |
| 387 | iso_pr_bacteria | 2836755666 | 2836756472 | 340 |
| 388 | iso_pr_bacteria | 2848317263 | 2848322175 | 340 |
| 389 | 3300002931 | CVPL010W_10011352 | CVPL010W_100113524 | 341 |
| 390 | 3300005721 | Ga0074278_146800 | Ga0074278_1468006 | 341 |
| 391 | 3300007129 | Ga0102734_1000081 | Ga0102734_100008129 | 341 |
| 392 | 3300009461 | Ga0127645_146556 | Ga0127645_1465562 | 341 |
| 393 | 3300042599 | Ga0466706_009931 | Ga0466706_009931_813_1838 | 341 |
| 394 | 3300042610 | Ga0466698_274189 | Ga0466698_274189_713_1738 | 341 |
| 395 | 3300042659 | Ga0466733_065275 | Ga0466733_065275_71970_72995 | 341 |
| 396 | iso_pr_bacteria | 2548876789 | 2549846041 | 341 |
| 397 | iso_pr_bacteria | 2617270844 | 2617735452 | 341 |
| 398 | iso_pr_bacteria | 2864761044 | 2864763713 | 341 |
| 399 | 3300002931 | CVPL010W_10006624 | CVPL010W_100066244 | 342 |
| 400 | 3300002931 | CVPL010W_10036303 | CVPL010W_100363032 | 342 |
| 401 | 3300002934 | CVPL005W_1000998 | CVPL005W_10009982 | 342 |
| 402 | 3300007042 | Ga0103263_100243 | Ga0103263_1002433 | 342 |
| 403 | 3300007052 | Ga0102736_1000058 | Ga0102736_100005819 | 342 |
| 404 | 3300007052 | Ga0102736_1000317 | Ga0102736_10003179 | 342 |
| 405 | 3300007083 | Ga0103261_1000048 | Ga0103261_10000484 | 342 |
| 406 | 3300007095 | Ga0102739_1000045 | Ga0102739_10000453 | 342 |
| 407 | 3300007129 | Ga0102734_1002946 | Ga0102734_10029467 | 342 |
| 408 | 3300007139 | Ga0103260_1000473 | Ga0103260_10004736 | 342 |
| 409 | 3300007141 | Ga0102738_1000053 | Ga0102738_100005338 | 342 |
| 410 | 3300007142 | Ga0102737_1000013 | Ga0102737_10000134 | 342 |
| 411 | 3300007142 | Ga0102737_1005365 | Ga0102737_10053653 | 342 |
| 412 | 3300007192 | Ga0103268_1001892 | Ga0103268_10018925 | 342 |
| 413 | 3300010049 | Ga0123356_10036645 | Ga0123356_100366456 | 342 |
| 414 | 3300012813 | Ga0160470_100064 | Ga0160470_100064111 | 342 |
| 415 | 3300012820 | Ga0160456_100022 | Ga0160456_100022105 | 342 |
| 416 | 3300012850 | Ga0160434_100964 | Ga0160434_1009645 | 342 |
| 417 | 3300012857 | Ga0160435_1000043 | Ga0160435_100004381 | 342 |
| 418 | 3300042623 | Ga0466734_071296 | Ga0466734_071296_1562_2590 | 342 |
| 419 | 3300042625 | Ga0466730_086542 | Ga0466730_086542_554_1582 | 342 |
| 420 | 3300042649 | Ga0466724_08874 | Ga0466724_08874_11435_12463 | 342 |
| 421 | 3300042649 | Ga0466724_33421 | Ga0466724_33421_1433_2461 | 342 |
| 422 | iso_pr_bacteria | 2521172698 | 2521991004 | 342 |
| 423 | iso_pr_bacteria | 2597489902 | 2597923589 | 342 |
| 424 | iso_pr_bacteria | 2597489903 | 2597926938 | 342 |
| 425 | iso_pr_bacteria | 2841260384 | 2841263882 | 342 |
| 426 | iso_pr_bacteria | 2850131454 | 2850135566 | 342 |
| 427 | iso_pr_bacteria | 2896187957 | 2896192813 | 342 |
| 428 | iso_pr_bacteria | 8101676404 | 8101679437 | 342 |
| 429 | iso_pr_bacteria | 8101680043 | 8101682847 | 342 |
| 430 | iso_pr_bacteria | 8101683685 | 8101686387 | 342 |
| 431 | 3300002931 | CVPL010W_10025234 | CVPL010W_100252344 | 343 |
| 432 | 3300002934 | CVPL005W_1001637 | CVPL005W_10016376 | 343 |
| 433 | 3300003973 | Ga0063521_1000009 | Ga0063521_100000940 | 343 |
| 434 | 3300007067 | Ga0103266_1004899 | Ga0103266_10048992 | 343 |
| 435 | 3300007140 | Ga0102740_1000281 | Ga0102740_100028112 | 343 |
| 436 | 3300007141 | Ga0102738_1001855 | Ga0102738_10018552 | 343 |
| 437 | 3300007192 | Ga0103268_1021267 | Ga0103268_10212672 | 343 |
| 438 | 3300012815 | Ga0160440_100020 | Ga0160440_100020120 | 343 |
| 439 | 3300042591 | Ga0466692_125691 | Ga0466692_125691_155_1186 | 343 |
| 440 | 3300042604 | Ga0466717_007140 | Ga0466717_007140_239_1270 | 343 |
| 441 | iso_pr_bacteria | 2820065746 | 2820066185 | 343 |
| 442 | iso_pr_bacteria | 2873562573 | 2873562951 | 343 |
| 443 | 3300002462 | JGI24702J35022_10001333 | JGI24702J35022_1000133318 | 344 |
| 444 | 3300002504 | JGI24705J35276_12237881 | JGI24705J35276_1223788110 | 344 |
| 445 | 3300007150 | Ga0104019_1193207 | Ga0104019_11932072 | 344 |
| 446 | 3300009784 | Ga0123357_10000869 | Ga0123357_1000086914 | 344 |
| 447 | 3300012841 | Ga0160444_100343 | Ga0160444_10034317 | 344 |
| 448 | 3300012858 | Ga0160457_1000058 | Ga0160457_100005862 | 344 |
| 449 | 3300030930 | Ga0316159_10003 | Ga0316159_10003268 | 344 |
| 450 | 3300042623 | Ga0466734_001100 | Ga0466734_001100_11830_12864 | 344 |
| 451 | 3300042623 | Ga0466734_147047 | Ga0466734_147047_730_1764 | 344 |
| 452 | iso_pr_bacteria | 2529292851 | 2530236134 | 344 |
| 453 | iso_pr_bacteria | 637000057 | 637673059 | 344 |
| 454 | 3300002834 | JGI24696J40584_12957324 | JGI24696J40584_129573243 | 345 |
| 455 | 3300009784 | Ga0123357_10187373 | Ga0123357_101873732 | 345 |
| 456 | 3300012832 | Ga0160458_100011 | Ga0160458_10001195 | 345 |
| 457 | 3300012845 | Ga0160460_105710 | Ga0160460_1057102 | 345 |
| 458 | 3300012854 | Ga0160448_100185 | Ga0160448_1001854 | 345 |
| 459 | 3300042582 | Ga0466657_048119 | Ga0466657_048119_1007_2044 | 345 |
| 460 | iso_pr_bacteria | 649633028 | 649854890 | 345 |
| 461 | 3300005071 | Ga0068302_10214749 | Ga0068302_102147491 | 346 |
| 462 | 3300007080 | Ga0102735_1000622 | Ga0102735_10006225 | 346 |
| 463 | 3300007139 | Ga0103260_1000422 | Ga0103260_10004224 | 346 |
| 464 | 3300007140 | Ga0102740_1005500 | Ga0102740_10055001 | 346 |
| 465 | 3300007142 | Ga0102737_1000476 | Ga0102737_10004765 | 346 |
| 466 | iso_pr_bacteria | 2838140227 | 2838142025 | 346 |
| 467 | 2189573031 | gam1t_NODE_10840_length=100971_GC=34_2_Contigs=1 | gam1t_00124850 | 347 |
| 468 | 2189573031 | gam1t_NODE_600063_length=49977_GC=36_2_Contigs=3 | gam1t_00176080 | 347 |
| 469 | 3300005201 | Ga0072941_1072695 | Ga0072941_10726952 | 347 |
| 470 | 3300010882 | Ga0123354_10000607 | Ga0123354_1000060728 | 347 |
| 471 | 3300042582 | Ga0466657_045296 | Ga0466657_045296_637_1680 | 347 |
| 472 | 3300042606 | Ga0466719_446123 | Ga0466719_446123_1386_2429 | 347 |
| 473 | 3300042654 | Ga0466725_343034 | Ga0466725_343034_571_1614 | 347 |
| 474 | iso_pr_bacteria | 2515154034 | 2515298460 | 347 |
| 475 | iso_pr_bacteria | 2630968947 | 2633885491 | 347 |
| 476 | iso_pr_bacteria | 2684622921 | 2686092380 | 347 |
| 477 | iso_pr_bacteria | 2756170266 | 2756755116 | 347 |
| 478 | iso_pr_bacteria | 2833532623 | 2833534873 | 347 |
| 479 | iso_pr_bacteria | 8024019580 | 8024019601 | 347 |
| 480 | 3300000333 | HBC_ctgsDRAFT_1003971 | HBC_ctgsDRAFT_10039712 | 348 |
| 481 | 3300000462 | SCG598I22_11165 | SCG598I22_1116530 | 348 |
| 482 | 3300005721 | Ga0074278_129590 | Ga0074278_1295902 | 348 |
| 483 | 3300007140 | Ga0102740_1000080 | Ga0102740_100008024 | 348 |
| 484 | 3300042616 | Ga0466715_200302 | Ga0466715_200302_405_1451 | 348 |
| 485 | iso_pr_bacteria | 2820137450 | 2820140938 | 348 |
| 486 | 3300010049 | Ga0123356_10076935 | Ga0123356_100769353 | 349 |
| 487 | 3300012861 | Ga0160436_1005501 | Ga0160436_10055013 | 349 |
| 488 | 3300007141 | Ga0102738_1000253 | Ga0102738_100025310 | 352 |
| 489 | 3300042616 | Ga0466715_163671 | Ga0466715_163671_3521_4579 | 352 |
| 490 | 3300002931 | CVPL010W_10008965 | CVPL010W_100089657 | 353 |
| 491 | 3300009784 | Ga0123357_10013687 | Ga0123357_100136875 | 355 |
| 492 | 3300010882 | Ga0123354_10033324 | Ga0123354_100333242 | 356 |
| 493 | 3300002938 | CVPL005L_10011288 | CVPL005L_100112885 | 357 |
| 494 | 3300042616 | Ga0466715_437149 | Ga0466715_437149_7219_8298 | 359 |
| 495 | 3300042620 | Ga0466728_132354 | Ga0466728_132354_70_1149 | 359 |
| 496 | 3300007129 | Ga0102734_1002608 | Ga0102734_10026085 | 361 |
| 497 | 3300007139 | Ga0103260_1000519 | Ga0103260_10005198 | 361 |
| 498 | iso_pr_bacteria | 2603880165 | 2606013097 | 364 |
| 499 | 3300007188 | Ga0103264_1006659 | Ga0103264_10066596 | 365 |
| 500 | 3300042612 | Ga0466705_391316 | Ga0466705_391316_424_1593 | 389 |
| 501 | 3300042643 | Ga0466704_350815 | Ga0466704_350815_5914_7101 | 395 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01210 | NAD_Gly3P_dh_N | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus | 64 | 220 | 0.99 |
| PF20618 | GPD_NAD_C_bact | Bacterial GPD, NAD-dependent C-terminal | 301 | 365 | 0.96 |
| PF07479 | NAD_Gly3P_dh_C | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus | 241 | 378 | 0.96 |
| PF03807 | F420_oxidored | NADP oxidoreductase coenzyme F420-dependent | 64 | 152 | 0.9 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.82 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.