Protein Family IF07213

Metagenome Isolate
501 Members
365 Samples
237 Scaffolds
335.5 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_391316|Ga0466705_391316_424_1593
Length
389 aa
Sequence
MYTINRQEILIKLPVRKCGAKSSSMFAEDGKVTCNFNASRPAVNRSRPHGCGFADGRRRGELMKITVAGGGSWGTALAGMAAAKGFSATLLVRDPALARAVNERHENPRYFPGLPLDRRLRASASPVDALADADILVTAVPCQSMRSFLESIARFVPDSAVPVCVSKGIETSTLKRMSEVTAEVLPAQAGRYAVLSGPSFAAEVMREKPTAVVVGSTDAAVREHLREVFSCGFFRVYSGSDVTGVELGGAIKNVMAIAAGICDGLGFGHNARAALVARGLAEMIRLGEALGARAATFMGLSGLGDLVLTCTGDLSRNRRVGLKLAAGENAAEAGSAMTAEGIKTTAAVLRLAALHAVDTPIAGAVGRILNGELAPASARELMNRTLREE

πŸ“Š Sample Types

Isolate 52.7%
Metagenome 47.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Apidae 31.9%
Coreidae 22.6%
Unclassified 8.8%
Termitidae 7.6%
Formicidae 5.6%
Drosophilidae 5.1%
Kalotermitidae 4.0%
Culicidae 2.8%
Armadillidiidae 2.0%
Rhinotermitidae 1.1%
Sarcophagidae 0.8%
Pteromalidae 0.8%
Elmidae 0.8%
Berytidae 0.6%
Ixodidae 0.6%
Largidae 0.6%
Termopsidae 0.6%
Curculionidae 0.6%
Reduviidae 0.3%
Hippoboscidae 0.3%
Lysianassidae 0.3%
Psyllidae 0.3%
Hydrophilidae 0.3%
Hodotermitidae 0.3%
Cixiidae 0.3%
Aphididae 0.3%
Calliphoridae 0.3%
Alydidae 0.3%
Aleyrodidae 0.3%

🌳 Taxonomy

Archaea 0
Bacteria 479
Eukaryota 0
Viruses 0
Unclassified 22

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
2 2510065003 Arsenophonus triatominarum ArT Isolate Reduviidae
3 2585428048 Colwellia sp. NBT2012 Isolate
4 2820070515 Unclassified Proteobacteria Nt197P3bin137 Isolate Unclassified
5 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
6 2832039703 Ignatzschineria cameli UAE-HKU59 Isolate Sarcophagidae
7 2840797934 Gilliamella apicola Choc5-1 Isolate Apidae
8 2846472545 Gilliamella sp. N-W3 Isolate Apidae
9 2846475167 Gilliamella apicola N-G5 Isolate Apidae
10 2846493360 Gilliamella apis N-G1 Isolate Apidae
11 2854132136 Gilliamella apicola wkB292 Isolate Apidae
12 2857888719 Gilliamella apicola N-15-12 Isolate Apidae
13 2870908367 Gilliamella apis NO13 Isolate Apidae
14 2870910722 Gilliamella apicola wkB112 Isolate Apidae
15 2873648542 Gilliamella apicola NO10 Isolate Apidae
16 2873653628 Gilliamella apicola App6-5 Isolate Apidae
17 2876014139 Gilliamella apicola wkB18 Isolate Apidae
18 2920413932 Bombella sp. ESL0380 Isolate Apidae
19 649633028 Candidatus Blochmannia vafer BVAF Isolate Formicidae
20 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
21 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
22 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
23 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
24 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
25 8065338428 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
26 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
27 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
28 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
29 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
30 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
31 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
32 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
33 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
34 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
35 3002773460 Coxiella endosymbiont of Amblyomma nuttalli Craf2019 Isolate Ixodidae
36 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
37 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
38 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
39 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
40 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
41 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
42 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
43 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
44 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
45 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
46 2510065004 Arsenophonus melophagi ArM Isolate Hippoboscidae
47 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
48 2837618715 Gilliamella apicola Aw-17 Isolate Apidae
49 2841195917 Gilliamella apicola wkB7 Isolate Apidae
50 2846495668 Gilliamella apicola ESL0178 Isolate Apidae
51 2849452216 Gilliamella apicola AW11 Isolate Apidae
52 2849455045 Gilliamella apicola NO8 Isolate Apidae
53 2868504459 Gilliamella apis NO4 Isolate Apidae
54 2870917785 Gilliamella apis NO15 Isolate Apidae
55 2873636219 Gilliamella apicola App2-1 Isolate Apidae
56 2876033458 Gilliamella apicola AM6 Isolate Apidae
57 2876036378 Gilliamella apicola Choc3-5 Isolate Apidae
58 2878462549 Gilliamella apicola Occ3-1 Isolate Apidae
59 2878464769 Gilliamella apis ESL0169 Isolate Apidae
60 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
61 2821312900 Unclassified Proteobacteria Lab288P4bin16 Isolate Unclassified
62 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
63 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
64 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
65 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
66 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
67 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
68 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
69 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
70 8102117041 Caballeronia sp. INML3 Isolate Coreidae
71 8102131453 Caballeronia sp. INML5 Isolate Coreidae
72 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
73 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
74 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
75 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
76 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
77 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
78 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
79 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
80 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
81 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
82 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
83 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
84 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
85 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
86 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
87 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
88 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
89 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
90 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
91 2512047046 Secondary Endosymbiont of Heteropsylla cubana Isolate Psyllidae
92 2515154047 Candidatus Gilliamella apicola wkB1 Isolate Apidae
93 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
94 2684622921 Frischella perrara Fp_167 Isolate Unclassified
95 2684622923 Gilliamella apicola Ga_172 Isolate Unclassified
96 2684622925 Gilliamella apicola Ga_178 Isolate Unclassified
97 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
98 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
99 2833532623 Frischella perrara ESL0167 Isolate Apidae
100 2840795165 Gilliamella apicola N-22 Isolate Apidae
101 2846483029 Gilliamella apis AM1 Isolate Apidae
102 2849466174 Gilliamella apis P83G Isolate Apidae
103 2854134697 Gilliamella apicola Fer4-1 Isolate Apidae
104 2854144746 Gilliamella apicola NO6 Isolate Apidae
105 2854149989 Gilliamella apis A-TSA1 Isolate Apidae
106 2857870431 Gilliamella apicola A-7-24 Isolate Apidae
107 2857873190 Gilliamella apicola Nev5-1 Isolate Apidae
108 2857886120 Gilliamella apicola Bim1-2 Isolate Apidae
109 2868492035 Gilliamella apicola Occ4-3 Isolate Apidae
110 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
111 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
112 2876030618 Gilliamella apicola HK2 Isolate Apidae
113 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
114 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
115 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
116 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
117 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
118 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
119 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
120 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
121 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
122 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
123 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
124 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
125 3300000461 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-P17 Metagenome Apidae
126 3300000472 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 Metagenome Apidae
127 3300000473 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 Metagenome Apidae
128 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
129 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
130 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
131 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
132 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
133 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
134 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
135 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
136 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
137 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
138 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
139 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
140 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
141 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
142 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
143 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
144 2505679062 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
145 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
146 2603880165 Burkholderiales A1 Isolate Unclassified
147 2617270844 Dyella sp. HyOG Isolate Cixiidae
148 2684622922 Gilliamella apicola Ga_169 Isolate Unclassified
149 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
150 2775506951 Candidatus Coxiella mudrowiae CRS-CAT Isolate Unclassified
151 2785510746 Gilliamella sp. ESL0441 Isolate Apidae
152 2785510747 Gilliamella sp. ESL0443 Isolate Apidae
153 2791354941 Bombella intestini R-52487 Isolate Unclassified
154 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
155 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
156 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
157 2846485327 Gilliamella apicola AM4 Isolate Apidae
158 2849471304 Gilliamella apicola NO5 Isolate Apidae
159 2873643457 Gilliamella apis A-4-12 Isolate Apidae
160 2876011797 Gilliamella apis NO16 Isolate Apidae
161 2876022486 Gilliamella apicola A8 Isolate Apidae
162 2876027665 Gilliamella apicola P54G Isolate Apidae
163 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
164 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
165 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
166 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
167 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
168 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
169 8076033509 Erwinia haradaeae ErCicuneomaculata/2628 Isolate Aphididae
170 8088491222 Gilliamella apicola ESL0178 Isolate Apidae
171 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
172 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
173 8102124461 Caballeronia sp. INML3B Isolate Coreidae
174 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
175 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
176 3300000462 Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 Metagenome Apidae
177 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
178 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
179 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
180 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
181 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
182 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
183 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
184 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
185 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
186 2515154034 Frischella perrara PEB0191 Isolate Apidae
187 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
188 2630968947 Frischella perrara PEB0191 Isolate Apidae
189 2718217749 Coxiella mudrowiae CRt Isolate Ixodidae
190 2744054871 Candidatus Arsenophonus triatominarum ATi Isolate Unclassified
191 2785510744 Gilliamella sp. ESL0405 Isolate Apidae
192 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
193 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
194 2843334863 Gilliamella apicola A-2-24 Isolate Apidae
195 2846490831 Gilliamella apis ESL0172 Isolate Apidae
196 2849446820 Gilliamella apicola Bif1-4 Isolate Apidae
197 2849468476 Gilliamella apicola N-28 Isolate Apidae
198 2854129949 Gilliamella apis M1-2G Isolate Apidae
199 2854137290 Gilliamella apicola Imp1-6 Isolate Apidae
200 2854139540 Gilliamella apicola Imp1-1 Isolate Apidae
201 2857883421 Gilliamella apicola N2 Isolate Apidae
202 2857891623 Gilliamella apicola wkB171 Isolate Apidae
203 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
204 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
205 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
206 2868486652 Gilliamella sp. N-G2 Isolate Apidae
207 2868506828 Gilliamella apicola App4-10 Isolate Apidae
208 2870897478 Gilliamella apicola A-7-12 Isolate Apidae
209 2870900452 Gilliamella apis NO14 Isolate Apidae
210 2873640908 Gilliamella apicola wkB308 Isolate Apidae
211 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
212 8023757577 Caballeronia peredens LP006 Isolate Coreidae
213 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
214 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
215 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
216 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
217 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
218 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
219 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
220 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
221 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
222 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
223 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
224 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
225 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
226 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
227 3300009461 Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov Metagenome
228 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
229 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
230 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
231 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
232 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
233 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
234 2756170265 Gilliamella apicola DSM 104097 Isolate Unclassified
235 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
236 2834098943 Gilliamella apis NO3 Isolate Apidae
237 2843337836 Gilliamella apicola N-12-12 Isolate Apidae
238 2846480698 Gilliamella apis N-G4 Isolate Apidae
239 2846488152 Gilliamella apicola Bim3-2 Isolate Apidae
240 2849449383 Gilliamella apicola WF3-4 Isolate Apidae
241 2849458003 Gilliamella apicola HK7 Isolate Apidae
242 2849463436 Gilliamella apicola A-8-12 Isolate Apidae
243 2857876020 Gilliamella apicola Nev6-6 Isolate Apidae
244 2857881114 Gilliamella apis N-G3 Isolate Apidae
245 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
246 2868494745 Gilliamella apis NO1 Isolate Apidae
247 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
248 2870902796 Gilliamella apicola GillExp13 Isolate Apidae
249 2870915472 Gilliamella apis A-TSA3 Isolate Apidae
250 2873656248 Gilliamella apicola A-1-24 Isolate Apidae
251 2876016455 Gilliamella apicola N6 Isolate Apidae
252 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
253 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
254 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
255 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
256 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
257 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
258 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
259 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
260 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
261 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
262 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
263 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
264 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
265 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
266 8088486376 Gilliamella apis ESL0172 Isolate Apidae
267 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
268 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
269 8102102351 Caballeronia sp. INML1 Isolate Coreidae
270 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
271 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
272 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
273 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
274 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
275 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
276 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
277 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
278 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
279 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
280 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
281 2508501043 Desulfovibrio termitidis HI1 Isolate Rhinotermitidae
282 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
283 2515154049 Candidatus Gilliamella apicola wkB30 Isolate Apidae
284 2585427711 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
285 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
286 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
287 2854141978 Gilliamella apicola A-12-12 Isolate Apidae
288 2854147632 Gilliamella apicola wkB195 Isolate Apidae
289 2857878760 Gilliamella apicola Gris1-4 Isolate Apidae
290 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
291 2868489326 Gilliamella apicola N10 Isolate Apidae
292 2868499409 Gilliamella apicola N-9-4 Isolate Apidae
293 2870913170 Gilliamella apis A-TSA2 Isolate Apidae
294 2870920129 Gilliamella apicola wkB108 Isolate Apidae
295 2873633977 Gilliamella apicola wkB178 Isolate Apidae
296 2873638493 Gilliamella apicola wkB72 Isolate Apidae
297 2873651485 Gilliamella apicola Choc4-2 Isolate Apidae
298 2876025319 Gilliamella apis NO12 Isolate Apidae
299 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
300 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
301 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
302 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
303 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
304 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
305 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
306 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
307 8088493931 Gilliamella apis K-MP18 Isolate Apidae
308 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
309 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
310 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
311 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
312 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
313 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
314 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
315 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
316 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
317 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
318 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
319 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
320 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
321 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
322 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
323 2515154048 Candidatus Gilliamella apicola wkB11 Isolate Apidae
324 2521172698 Candidatus Blochmannia chromaiodes 640 Isolate Unclassified
325 2585427605 Colwellia sp. MT2012 Isolate
326 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
327 2820137450 Unclassified Proteobacteria Emb289P3bin120 Isolate Unclassified
328 2832037495 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
329 2838140227 Dyella sp. OAE510 Isolate Unclassified
330 2838840603 Gilliamella apicola A-9-12 Isolate Apidae
331 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
332 2846477985 Gilliamella apicola Fer1-1 Isolate Apidae
333 2848317263 Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF Isolate Aleyrodidae
334 2849460838 Gilliamella apicola Gris3-2 Isolate Apidae
335 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
336 2854127928 Gilliamella apicola Choc6-1 Isolate Apidae
337 2857868033 Gilliamella apis P62G Isolate Apidae
338 2868497104 Gilliamella apis A-TSA4 Isolate Apidae
339 2870905362 Gilliamella apicola Nev3-1 Isolate Apidae
340 2873645950 Gilliamella apicola Fer2-1 Isolate Apidae
341 637000057 Candidatus Blochmannia pennsylvanicus BPEN Isolate Formicidae
342 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
343 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
344 8069748016 Caballeronia sp. LP003 Isolate Coreidae
345 8088488961 Gilliamella apis ESL0169 Isolate Apidae
346 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
347 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
348 8102109360 Caballeronia sp. INML2 Isolate Coreidae
349 8102145433 Caballeronia sp. LP006 Isolate Coreidae
350 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
351 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
352 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
353 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
354 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
355 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
356 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
357 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
358 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
359 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
360 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
361 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
362 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
363 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
364 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
365 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_122577 3300042612 Bacteria 3425
2 Ga0466705_204928 3300042612 Unclassified 6417
3 gam1t_NODE_668966_length=9231_GC=35_7_Contigs=6 2189573031 Unclassified 9281
4 Ga0102735_1002454 3300007080 Bacteria 2808
5 Ga0103267_1054568 3300007190 Bacteria 2597
6 Ga0123357_10034017 3300009784 Bacteria 6925
7 Ga0123356_10036645 3300010049 Bacteria 4580
8 Ga0123353_10057430 3300010167 Unclassified 6234
9 Ga0466707_413653 3300042601 Bacteria 4972
10 Ga0466717_011008 3300042604 Bacteria 2015
11 Ga0466711_352641 3300042615 Bacteria 2375
12 Ga0466715_492705 3300042616 Bacteria 3245
13 Ga0160446_100107 3300012835 Bacteria 76250
14 Ga0160460_100128 3300012845 Bacteria 91139
15 Ga0160436_1005501 3300012861 Bacteria 2977
16 Ga0160436_1006400 3300012861 Unclassified 2733
17 Ga0466657_045296 3300042582 Bacteria 3416
18 Ga0466690_002060 3300042590 Bacteria 1653
19 Ga0466690_105411 3300042590 Bacteria 24234
20 Ga0466690_340290 3300042590 Bacteria 31321
21 Ga0466701_006187 3300042598 Bacteria 96523
22 Ga0466730_013512 3300042625 Bacteria 1835
23 Ga0466704_556028 3300042643 Unclassified 7954
24 Ga0466704_596754 3300042643 Bacteria 22176
25 Ga0466709_023308 3300042648 Bacteria 10603
26 Ga0466724_33421 3300042649 Bacteria 3131
27 Ga0466697_224456 3300042611 Bacteria 1913
28 SCG598I22_11165 3300000462 Bacteria 45656
29 CVPL010W_10021105 3300002931 Bacteria 3660
30 CVPL005W_1001637 3300002934 Bacteria 6091
31 CVPL005L_10011288 3300002938 Bacteria 8835
32 Ga0063521_1000009 3300003973 Bacteria 190208
33 Ga0102739_1006498 3300007095 Bacteria 1570
34 Ga0102734_1002608 3300007129 Bacteria 4475
35 Ga0102740_1000281 3300007140 Bacteria 14480
36 Ga0102738_1000053 3300007141 Bacteria 48646
37 Ga0102738_1001855 3300007141 Bacteria 3223
38 Ga0102737_1000013 3300007142 Bacteria 54146
39 Ga0103268_1021267 3300007192 Bacteria 1470
40 Ga0123355_10125761 3300009826 Bacteria 3962
41 Ga0466706_050992 3300042599 Bacteria 9334
42 Ga0466707_360682 3300042601 Bacteria 24713
43 Ga0466716_212663 3300042605 Bacteria 18159
44 Ga0466719_235576 3300042606 Bacteria 2537
45 Ga0466719_502196 3300042606 Bacteria 19826
46 Ga0466722_036985 3300042609 Bacteria 64137
47 Ga0466705_511922 3300042612 Bacteria 1724
48 Ga0466710_354410 3300042613 Bacteria 3466
49 Ga0466715_023961 3300042616 Bacteria 4518
50 Ga0466723_221711 3300042618 Bacteria 10388
51 Ga0160432_100139 3300012818 Bacteria 68754
52 Ga0160433_100098 3300012846 Bacteria 87666
53 Ga0160443_100313 3300012848 Bacteria 45770
54 Ga0160447_104409 3300012849 Unclassified 4171
55 Ga0160430_105220 3300012852 Bacteria 3026
56 Ga0466657_328796 3300042582 Bacteria 1631
57 Ga0466694_387143 3300042594 Bacteria 27026
58 Ga0466729_252102 3300042621 Bacteria 2781
59 Ga0466704_204274 3300042643 Bacteria 3390
60 Ga0466704_350815 3300042643 Unclassified 7356
61 Ga0466704_370196 3300042643 Unclassified 7093
62 Ga0466709_180344 3300042648 Bacteria 52700
63 Ga0466709_333206 3300042648 Bacteria 12214
64 Ga0466708_197678 3300042652 Unclassified 8496
65 Ga0466705_075585 3300042612 Bacteria 2421
66 Ga0466732_310786 3300042656 Bacteria 3749
67 Ga0466733_025503 3300042659 Bacteria 7283
68 DPOL_contig01005 2035918003 Unclassified 3843
69 SCG598P17_12889 3300000461 Bacteria 102048
70 Ga0074278_117976 3300005721 Bacteria 1342
71 Ga0103263_100243 3300007042 Bacteria 8099
72 Ga0102736_1000058 3300007052 Unclassified 28916
73 Ga0102734_1002946 3300007129 Bacteria 6506
74 Ga0102738_1000253 3300007141 Bacteria 12264
75 Ga0103268_1001892 3300007192 Bacteria 4878
76 Ga0123357_10000869 3300009784 Bacteria 30813
77 Ga0123354_10000048 3300010882 Bacteria 91660
78 Ga0466706_091212 3300042599 Bacteria 2107
79 Ga0466713_072810 3300042602 Bacteria 4348
80 Ga0466717_257098 3300042604 Bacteria 1047
81 Ga0466716_538507 3300042605 Bacteria 3136
82 Ga0466705_425873 3300042612 Bacteria 39314
83 Ga0466705_518078 3300042612 Bacteria 1975
84 Ga0466715_042530 3300042616 Bacteria 11739
85 Ga0466715_200302 3300042616 Bacteria 3796
86 Ga0466728_151858 3300042620 Bacteria 8528
87 Ga0160452_100095 3300012834 Unclassified 117643
88 Ga0466734_071296 3300042623 Bacteria 19945
89 Ga0466708_108901 3300042652 Bacteria 52993
90 Ga0466733_115242 3300042659 Bacteria 220013
91 SCG598B02_13034 3300000472 Bacteria 53304
92 JGI24705J35276_12237817 3300002504 Bacteria 13336
93 CVPL010W_10011352 3300002931 Bacteria 7433
94 CVPL010W_10025234 3300002931 Bacteria 2862
95 Ga0068302_10214749 3300005071 Bacteria 1267
96 Ga0074278_131570 3300005721 Unclassified 8052
97 Ga0103266_1000596 3300007067 Bacteria 7167
98 Ga0103261_1000048 3300007083 Bacteria 38400
99 Ga0123354_10033324 3300010882 Bacteria 8066
100 Ga0466719_446123 3300042606 Bacteria 2678
101 Ga0466705_391635 3300042612 Unclassified 6109
102 Ga0466718_148532 3300042617 Bacteria 2332
103 Ga0466723_281216 3300042618 Bacteria 3012
104 Ga0466728_402123 3300042620 Bacteria 9171
105 Ga0160456_100022 3300012820 Bacteria 269020
106 Ga0160436_1000007 3300012861 Bacteria 161775
107 Ga0415639_021139 3300038395 Bacteria 4072
108 Ga0415639_034868 3300038395 Bacteria 3729
109 Ga0466656_294034 3300042550 Bacteria 2201
110 Ga0466692_097692 3300042591 Bacteria 14014
111 Ga0466729_281628 3300042621 Bacteria 225559
112 Ga0466734_024434 3300042623 Bacteria 2018
113 Ga0466734_161418 3300042623 Bacteria 29362
114 Ga0466730_009661 3300042625 Bacteria 21517
115 Ga0466703_180206 3300042636 Bacteria 2099
116 Ga0466724_08874 3300042649 Bacteria 14343
117 Ga0466724_59786 3300042649 Bacteria 44500
118 Ga0466733_171037 3300042659 Bacteria 6257
119 JGI24705J35276_12236287 3300002504 Bacteria 7774
120 CVPL010W_10006624 3300002931 Bacteria 11772
121 Ga0072940_1177306 3300005200 Bacteria 3039
122 Ga0072941_1072695 3300005201 Bacteria 3103
123 Ga0102740_1005500 3300007140 Bacteria 2373
124 Ga0102737_1005365 3300007142 Bacteria 2563
125 Ga0103264_1006659 3300007188 Bacteria 5548
126 Ga0127645_146556 3300009461 Unclassified 2723
127 Ga0123357_10089434 3300009784 Bacteria 4020
128 Ga0123357_10187373 3300009784 Bacteria 2396
129 Ga0123356_10076935 3300010049 Bacteria 3146
130 Ga0123353_10024721 3300010167 Bacteria 9127
131 Ga0123354_10049251 3300010882 Bacteria 6393
132 Ga0466706_009931 3300042599 Bacteria 2506
133 Ga0466707_006559 3300042601 Bacteria 1206
134 Ga0466713_027261 3300042602 Bacteria 28095
135 Ga0466698_274189 3300042610 Bacteria 2008
136 Ga0466715_276542 3300042616 Bacteria 18301
137 Ga0466718_136890 3300042617 Bacteria 1299
138 Ga0160440_100020 3300012815 Bacteria 297910
139 Ga0160444_100343 3300012841 Bacteria 27779
140 Ga0160447_101916 3300012849 Bacteria 7690
141 Ga0160434_100964 3300012850 Bacteria 5956
142 Ga0316159_10003 3300030930 Bacteria 422460
143 Ga0466657_114499 3300042582 Bacteria 1338
144 Ga0466657_258557 3300042582 Bacteria 2656
145 Ga0466734_001100 3300042623 Bacteria 15559
146 Ga0466734_093934 3300042623 Bacteria 17242
147 Ga0466735_085821 3300042624 Bacteria 15332
148 Ga0466703_179064 3300042636 Bacteria 1881
149 Ga0466704_335275 3300042643 Bacteria 16018
150 Ga0466725_343034 3300042654 Bacteria 8145
151 Ga0466705_256870 3300042612 Bacteria 4755
152 gam1t_NODE_10840_length=100971_GC=34_2_Contigs=1 2189573031 Bacteria 100971
153 gam1t_NODE_600063_length=49977_GC=36_2_Contigs=3 2189573031 Bacteria 49997
154 HBC_ctgsDRAFT_1003971 3300000333 Unclassified 3399
155 CVPL005W_1000998 3300002934 Bacteria 8684
156 Ga0074278_146800 3300005721 Unclassified 9281
157 Ga0102736_1000317 3300007052 Bacteria 10418
158 Ga0103266_1004899 3300007067 Bacteria 1769
159 Ga0102739_1000045 3300007095 Bacteria 35022
160 Ga0104019_1193207 3300007150 Bacteria 1488
161 Ga0466700_187485 3300042600 Bacteria 6331
162 Ga0466698_373043 3300042610 Bacteria 2354
163 Ga0466711_082470 3300042615 Bacteria 1531
164 Ga0466711_332132 3300042615 Unclassified 4136
165 Ga0466715_225474 3300042616 Bacteria 21836
166 Ga0466715_437149 3300042616 Bacteria 22616
167 Ga0160467_100092 3300012829 Bacteria 130870
168 Ga0160444_100124 3300012841 Bacteria 82291
169 Ga0160445_100199 3300012847 Bacteria 46065
170 Ga0160457_1000058 3300012858 Bacteria 178891
171 Ga0466657_019628 3300042582 Bacteria 3430
172 Ga0466657_048119 3300042582 Bacteria 2400
173 Ga0466693_001823 3300042592 Bacteria 2022
174 Ga0466691_056478 3300042593 Bacteria 53505
175 Ga0466694_288791 3300042594 Bacteria 3667
176 Ga0466701_007583 3300042598 Bacteria 11497
177 Ga0466725_220900 3300042654 Bacteria 23606
178 Ga0466733_065275 3300042659 Bacteria 86472
179 SCG598I20_12770 3300000473 Bacteria 55316
180 JGI24702J35022_10001333 3300002462 Bacteria 15340
181 JGI24705J35276_12237881 3300002504 Bacteria 13815
182 WW0001_100248 3300002732 Bacteria 167261
183 JGI24696J40584_12957324 3300002834 Bacteria 3456
184 CVPL010W_10008965 3300002931 Bacteria 10687
185 Ga0074278_129590 3300005721 Bacteria 100971
186 Ga0102735_1000622 3300007080 Bacteria 7548
187 Ga0102734_1000081 3300007129 Bacteria 29333
188 Ga0103260_1000422 3300007139 Bacteria 8137
189 Ga0103260_1000519 3300007139 Bacteria 7385
190 Ga0102737_1000476 3300007142 Bacteria 13073
191 Ga0103267_1000001 3300007190 Bacteria 112220
192 Ga0123357_10067475 3300009784 Bacteria 4765
193 Ga0123356_10030709 3300010049 Bacteria 5027
194 Ga0123353_10010582 3300010167 Bacteria 12876
195 Ga0123353_10228965 3300010167 Bacteria 2900
196 Ga0123354_10000607 3300010882 Bacteria 37348
197 Ga0123354_10043665 3300010882 Bacteria 6888
198 Ga0160471_100214 3300012812 Unclassified 20316
199 Ga0160470_100064 3300012813 Bacteria 153495
200 Ga0466701_068458 3300042598 Bacteria 165759
201 Ga0466719_067139 3300042606 Bacteria 7598
202 Ga0466705_391316 3300042612 Bacteria 1631
203 Ga0466715_163671 3300042616 Bacteria 20103
204 Ga0466723_123689 3300042618 Bacteria 19530
205 Ga0466728_132354 3300042620 Bacteria 3038
206 Ga0160460_100129 3300012845 Bacteria 90952
207 Ga0160460_105710 3300012845 Bacteria 1758
208 Ga0160448_100185 3300012854 Bacteria 26347
209 Ga0466730_086542 3300042625 Bacteria 1634
210 Ga0466724_62208 3300042649 Unclassified 9961
211 Ga0466708_074047 3300042652 Bacteria 28825
212 Ga0466708_096890 3300042652 Bacteria 20475
213 Ga0466725_088086 3300042654 Bacteria 4927
214 Ga0466733_031990 3300042659 Bacteria 21694
215 CVPL010W_10036303 3300002931 Bacteria 1650
216 Ga0103260_1000473 3300007139 Bacteria 8211
217 Ga0102740_1000080 3300007140 Bacteria 23416
218 Ga0123357_10013687 3300009784 Bacteria 10548
219 Ga0160454_100047 3300012798 Unclassified 197474
220 Ga0466717_007140 3300042604 Bacteria 6609
221 Ga0466717_159377 3300042604 Bacteria 10175
222 Ga0466717_230118 3300042604 Bacteria 3280
223 Ga0466698_024981 3300042610 Bacteria 1849
224 Ga0466710_155008 3300042613 Bacteria 19269
225 Ga0466710_262153 3300042613 Bacteria 1992
226 Ga0466710_449998 3300042613 Bacteria 1572
227 Ga0466728_039683 3300042620 Bacteria 17092
228 Ga0160458_100011 3300012832 Bacteria 403207
229 Ga0160434_104350 3300012850 Unclassified 2362
230 Ga0160435_1000043 3300012857 Bacteria 95813
231 Ga0466692_125691 3300042591 Bacteria 4648
232 Ga0466696_346646 3300042596 Bacteria 8612
233 Ga0466734_037851 3300042623 Bacteria 2408
234 Ga0466734_147047 3300042623 Bacteria 2121
235 Ga0466735_167274 3300042624 Bacteria 1222
236 Ga0466703_091769 3300042636 Bacteria 2982
237 Ga0466708_204728 3300042652 Bacteria 3855

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042582 Ga0466657_328796 Ga0466657_328796_20_865 281
2 3300042604 Ga0466717_257098 Ga0466717_257098_140_1015 291
3 3300012812 Ga0160471_100214 Ga0160471_1002144 304
4 3300012845 Ga0160460_100128 Ga0160460_10012890 304
5 3300042606 Ga0466719_067139 Ga0466719_067139_4047_5033 305
6 3300042620 Ga0466728_039683 Ga0466728_039683_9747_10733 305
7 3300042654 Ga0466725_220900 Ga0466725_220900_13727_14719 307
8 3300042590 Ga0466690_105411 Ga0466690_105411_4175_5161 308
9 3300042593 Ga0466691_056478 Ga0466691_056478_23004_23990 308
10 3300042615 Ga0466711_332132 Ga0466711_332132_931_1857 308
11 3300007080 Ga0102735_1002454 Ga0102735_10024543 309
12 3300042594 Ga0466694_288791 Ga0466694_288791_1545_2480 311
13 2035918003 DPOL_contig01005 DPOLB_2335810 312
14 3300005200 Ga0072940_1177306 Ga0072940_11773061 314
15 3300012835 Ga0160446_100107 Ga0160446_10010741 315
16 3300042605 Ga0466716_538507 Ga0466716_538507_670_1620 316
17 3300042613 Ga0466710_155008 Ga0466710_155008_8718_9716 316
18 3300042613 Ga0466710_354410 Ga0466710_354410_1293_2291 316
19 3300042613 Ga0466710_449998 Ga0466710_449998_347_1345 316
20 3300012861 Ga0160436_1000007 Ga0160436_1000007130 318
21 3300042612 Ga0466705_256870 Ga0466705_256870_3265_4299 318
22 iso_pr_bacteria 2858102877 2858103710 318
23 iso_pr_bacteria 2858129007 2858129971 318
24 iso_pr_bacteria 2868677537 2868679529 318
25 3300007190 Ga0103267_1054568 Ga0103267_10545681 321
26 iso_pr_bacteria 2791354941 2792066634 323
27 iso_pr_bacteria 2920413932 2920414331 323
28 3300012852 Ga0160430_105220 Ga0160430_1052205 326
29 3300042604 Ga0466717_011008 Ga0466717_011008_504_1484 326
30 3300042611 Ga0466697_224456 Ga0466697_224456_327_1307 326
31 3300042624 Ga0466735_167274 Ga0466735_167274_77_1057 326
32 3300042654 Ga0466725_088086 Ga0466725_088086_3461_4459 326
33 3300002504 JGI24705J35276_12236287 JGI24705J35276_122362875 327
34 3300002504 JGI24705J35276_12237817 JGI24705J35276_122378172 327
35 3300042598 Ga0466701_006187 Ga0466701_006187_8175_9200 327
36 3300042616 Ga0466715_225474 Ga0466715_225474_20800_21783 327
37 3300042623 Ga0466734_024434 Ga0466734_024434_635_1633 327
38 3300042636 Ga0466703_091769 Ga0466703_091769_242_1225 327
39 3300042636 Ga0466703_180206 Ga0466703_180206_867_1850 327
40 3300042643 Ga0466704_370196 Ga0466704_370196_364_1347 327
41 3300042652 Ga0466708_108901 Ga0466708_108901_15197_16180 327
42 iso_pr_bacteria 2891720358 2891724123 327
43 3300042590 Ga0466690_002060 Ga0466690_002060_594_1580 328
44 3300042594 Ga0466694_387143 Ga0466694_387143_23345_24331 328
45 3300042601 Ga0466707_413653 Ga0466707_413653_2760_3746 328
46 3300042604 Ga0466717_159377 Ga0466717_159377_4574_5593 328
47 3300042612 Ga0466705_425873 Ga0466705_425873_38005_39006 328
48 3300042618 Ga0466723_123689 Ga0466723_123689_2243_3229 328
49 3300042618 Ga0466723_281216 Ga0466723_281216_891_1877 328
50 3300042623 Ga0466734_037851 Ga0466734_037851_196_1197 328
51 3300042624 Ga0466735_085821 Ga0466735_085821_11415_12401 328
52 3300042643 Ga0466704_335275 Ga0466704_335275_10739_11725 328
53 3300042652 Ga0466708_096890 Ga0466708_096890_6275_7261 328
54 3300042659 Ga0466733_115242 Ga0466733_115242_215083_216069 328
55 3300038395 Ga0415639_021139 Ga0415639_021139_554_1543 329
56 3300038395 Ga0415639_034868 Ga0415639_034868_375_1364 329
57 3300042550 Ga0466656_294034 Ga0466656_294034_234_1223 329
58 3300042604 Ga0466717_230118 Ga0466717_230118_1742_2731 329
59 3300042606 Ga0466719_235576 Ga0466719_235576_205_1194 329
60 3300042606 Ga0466719_502196 Ga0466719_502196_8259_9248 329
61 3300042610 Ga0466698_024981 Ga0466698_024981_391_1380 329
62 3300042610 Ga0466698_373043 Ga0466698_373043_928_1917 329
63 3300042615 Ga0466711_352641 Ga0466711_352641_859_1848 329
64 3300042616 Ga0466715_276542 Ga0466715_276542_6160_7149 329
65 3300042648 Ga0466709_333206 Ga0466709_333206_4600_5589 329
66 3300042652 Ga0466708_074047 Ga0466708_074047_7686_8675 329
67 iso_pr_bacteria 2820070515 2820070853 329
68 iso_pr_bacteria 2864808494 2864811789 329
69 iso_pr_bacteria 2864812326 2864815391 329
70 3300010167 Ga0123353_10057430 Ga0123353_100574303 330
71 3300010167 Ga0123353_10228965 Ga0123353_102289652 330
72 3300012841 Ga0160444_100124 Ga0160444_10012456 330
73 3300042591 Ga0466692_097692 Ga0466692_097692_11121_12113 330
74 3300042596 Ga0466696_346646 Ga0466696_346646_3837_4829 330
75 3300042599 Ga0466706_091212 Ga0466706_091212_894_1886 330
76 3300042609 Ga0466722_036985 Ga0466722_036985_39888_40880 330
77 3300042612 Ga0466705_075585 Ga0466705_075585_524_1516 330
78 3300042612 Ga0466705_518078 Ga0466705_518078_734_1726 330
79 3300042615 Ga0466711_082470 Ga0466711_082470_178_1170 330
80 3300042620 Ga0466728_402123 Ga0466728_402123_6375_7367 330
81 3300042649 Ga0466724_59786 Ga0466724_59786_861_1886 330
82 3300042649 Ga0466724_62208 Ga0466724_62208_862_1887 330
83 3300042652 Ga0466708_204728 Ga0466708_204728_194_1186 330
84 3300042659 Ga0466733_171037 Ga0466733_171037_267_1259 330
85 iso_pr_bacteria 2832037495 2832039375 330
86 iso_pr_bacteria 2832039703 2832040494 330
87 iso_pr_bacteria 8065338428 8065340318 330
88 3300009784 Ga0123357_10034017 Ga0123357_100340178 331
89 3300010882 Ga0123354_10043665 Ga0123354_100436652 331
90 3300010882 Ga0123354_10049251 Ga0123354_100492511 331
91 3300012798 Ga0160454_100047 Ga0160454_100047166 331
92 3300012818 Ga0160432_100139 Ga0160432_10013933 331
93 3300012847 Ga0160445_100199 Ga0160445_10019926 331
94 3300012848 Ga0160443_100313 Ga0160443_10031321 331
95 3300012861 Ga0160436_1006400 Ga0160436_10064003 331
96 3300042602 Ga0466713_072810 Ga0466713_072810_1863_2858 331
97 3300042648 Ga0466709_180344 Ga0466709_180344_38206_39201 331
98 3300007190 Ga0103267_1000001 Ga0103267_100000120 332
99 3300042598 Ga0466701_068458 Ga0466701_068458_17201_18199 332
100 3300042601 Ga0466707_006559 Ga0466707_006559_54_1052 332
101 3300042601 Ga0466707_360682 Ga0466707_360682_11794_12792 332
102 3300042605 Ga0466716_212663 Ga0466716_212663_10527_11525 332
103 3300042616 Ga0466715_023961 Ga0466715_023961_1358_2356 332
104 3300042616 Ga0466715_492705 Ga0466715_492705_960_1958 332
105 3300042623 Ga0466734_161418 Ga0466734_161418_20260_21276 332
106 3300042625 Ga0466730_009661 Ga0466730_009661_19753_20751 332
107 3300042625 Ga0466730_013512 Ga0466730_013512_505_1503 332
108 3300042652 Ga0466708_197678 Ga0466708_197678_180_1178 332
109 3300042659 Ga0466733_031990 Ga0466733_031990_20666_21664 332
110 iso_pr_bacteria 2597489944 2598056328 332
111 iso_pr_bacteria 3003869270 3003869576 332
112 iso_pr_bacteria 3003878002 3003878298 332
113 iso_pr_bacteria 8023724303 8023728323 332
114 iso_pr_bacteria 8023747282 8023751471 332
115 iso_pr_bacteria 8023752828 8023756241 332
116 iso_pr_bacteria 8023757577 8023761597 332
117 iso_pr_bacteria 8023764196 8023769336 332
118 iso_pr_bacteria 8024001094 8024001278 332
119 iso_pr_bacteria 8024014383 8024014563 332
120 iso_pr_bacteria 8024019580 8024022320 332
121 iso_pr_bacteria 8024025509 8024028085 332
122 iso_pr_bacteria 8024037630 8024037816 332
123 iso_pr_bacteria 8024044713 8024044908 332
124 iso_pr_bacteria 8025650824 8025651022 332
125 iso_pr_bacteria 8025658853 8025659374 332
126 iso_pr_bacteria 8025666332 8025666547 332
127 iso_pr_bacteria 8025671076 8025671248 332
128 iso_pr_bacteria 8025678175 8025678357 332
129 iso_pr_bacteria 8025685901 8025686419 332
130 iso_pr_bacteria 8025694439 8025694721 332
131 iso_pr_bacteria 8025701579 8025705696 332
132 iso_pr_bacteria 8025708040 8025708291 332
133 iso_pr_bacteria 8025716094 8025716592 332
134 iso_pr_bacteria 8025723035 8025723211 332
135 iso_pr_bacteria 8025728939 8025729199 332
136 iso_pr_bacteria 8025735396 8025735967 332
137 iso_pr_bacteria 8025740903 8025741081 332
138 iso_pr_bacteria 8025747911 8025748113 332
139 iso_pr_bacteria 8025756023 8025756225 332
140 iso_pr_bacteria 8069748016 8069748838 332
141 iso_pr_bacteria 8069755105 8069755307 332
142 iso_pr_bacteria 8069763219 8069763397 332
143 iso_pr_bacteria 8069770227 8069774416 332
144 iso_pr_bacteria 8069775773 8069779186 332
145 iso_pr_bacteria 8078130113 8078130293 332
146 iso_pr_bacteria 8101951471 8101951688 332
147 iso_pr_bacteria 8101960468 8101960685 332
148 iso_pr_bacteria 8101967387 8101967604 332
149 iso_pr_bacteria 8101974301 8101974518 332
150 iso_pr_bacteria 8101981714 8101981994 332
151 iso_pr_bacteria 8101988189 8101988494 332
152 iso_pr_bacteria 8101994502 8101994997 332
153 iso_pr_bacteria 8102001125 8102001259 332
154 iso_pr_bacteria 8102007614 8102007824 332
155 iso_pr_bacteria 8102014801 8102014975 332
156 iso_pr_bacteria 8102020860 8102021361 332
157 iso_pr_bacteria 8102026984 8102027304 332
158 iso_pr_bacteria 8102033761 8102034198 332
159 iso_pr_bacteria 8102041249 8102041426 332
160 iso_pr_bacteria 8102047609 8102047969 332
161 iso_pr_bacteria 8102054868 8102055092 332
162 iso_pr_bacteria 8102060671 8102060944 332
163 iso_pr_bacteria 8102067727 8102068029 332
164 iso_pr_bacteria 8102074813 8102075051 332
165 iso_pr_bacteria 8102081745 8102082111 332
166 iso_pr_bacteria 8102087471 8102087718 332
167 iso_pr_bacteria 8102094248 8102094742 332
168 iso_pr_bacteria 8102102351 8102102583 332
169 iso_pr_bacteria 8102109360 8102109576 332
170 iso_pr_bacteria 8102117041 8102117242 332
171 iso_pr_bacteria 8102124461 8102124865 332
172 iso_pr_bacteria 8102131453 8102132339 332
173 iso_pr_bacteria 8102138357 8102138550 332
174 iso_pr_bacteria 8102145433 8102149453 332
175 iso_pr_bacteria 8102152052 8102157192 332
176 iso_pr_bacteria 8102161003 8102165015 332
177 iso_pr_bacteria 8102169119 8102169690 332
178 iso_pr_bacteria 8102174626 8102174886 332
179 iso_pr_bacteria 8102181083 8102181259 332
180 iso_pr_bacteria 8102186987 8102187485 332
181 iso_pr_bacteria 8102193924 8102194175 332
182 iso_pr_bacteria 8102201977 8102206094 332
183 iso_pr_bacteria 8102208438 8102208636 332
184 iso_pr_bacteria 8102216467 8102216749 332
185 iso_pr_bacteria 8102223607 8102223779 332
186 iso_pr_bacteria 8102230706 8102231224 332
187 iso_pr_bacteria 8102239244 8102239426 332
188 iso_pr_bacteria 8102246966 8102247181 332
189 iso_pr_bacteria 8102251710 8102252231 332
190 iso_pr_bacteria 8102264549 8102264857 332
191 iso_pr_bacteria 8102271933 8102272320 332
192 iso_pr_bacteria 8102279326 8102279527 332
193 iso_pr_bacteria 8102286609 8102287048 332
194 iso_pr_bacteria 8102312426 8102312643 332
195 3300012834 Ga0160452_100095 Ga0160452_100095105 333
196 3300012849 Ga0160447_101916 Ga0160447_1019166 333
197 3300012849 Ga0160447_104409 Ga0160447_1044093 333
198 3300012850 Ga0160434_104350 Ga0160434_1043504 333
199 3300042613 Ga0466710_262153 Ga0466710_262153_211_1248 333
200 3300042621 Ga0466729_252102 Ga0466729_252102_1625_2626 333
201 3300042623 Ga0466734_093934 Ga0466734_093934_4014_5015 333
202 3300042643 Ga0466704_204274 Ga0466704_204274_1862_2863 333
203 iso_pr_bacteria 2718217749 2718706031 333
204 3300007067 Ga0103266_1000596 Ga0103266_10005966 334
205 3300042582 Ga0466657_019628 Ga0466657_019628_2225_3229 334
206 3300042582 Ga0466657_114499 Ga0466657_114499_195_1214 334
207 3300042582 Ga0466657_258557 Ga0466657_258557_711_1715 334
208 3300042612 Ga0466705_122577 Ga0466705_122577_2292_3296 334
209 3300042612 Ga0466705_391635 Ga0466705_391635_255_1259 334
210 3300042616 Ga0466715_042530 Ga0466715_042530_9745_10749 334
211 3300042636 Ga0466703_179064 Ga0466703_179064_582_1586 334
212 3300042656 Ga0466732_310786 Ga0466732_310786_592_1596 334
213 iso_pr_bacteria 2501651205 2501715446 334
214 iso_pr_bacteria 2585427605 2585889431 334
215 iso_pr_bacteria 2585428048 2587694132 334
216 iso_pr_bacteria 2775506951 2776479231 334
217 iso_pr_bacteria 2821312900 2821313408 334
218 iso_pr_bacteria 2900132049 2900132730 334
219 iso_pr_bacteria 3002773460 3002773553 334
220 3300002931 CVPL010W_10021105 CVPL010W_100211052 335
221 3300010882 Ga0123354_10000048 Ga0123354_1000004831 335
222 3300042598 Ga0466701_007583 Ga0466701_007583_10372_11379 335
223 3300042600 Ga0466700_187485 Ga0466700_187485_541_1548 335
224 3300042612 Ga0466705_204928 Ga0466705_204928_5013_6020 335
225 3300042612 Ga0466705_511922 Ga0466705_511922_393_1400 335
226 3300042617 Ga0466718_136890 Ga0466718_136890_126_1133 335
227 3300042617 Ga0466718_148532 Ga0466718_148532_881_1888 335
228 3300042618 Ga0466723_221711 Ga0466723_221711_5786_6793 335
229 3300042620 Ga0466728_151858 Ga0466728_151858_1797_2804 335
230 3300042621 Ga0466729_281628 Ga0466729_281628_173293_174300 335
231 3300042643 Ga0466704_556028 Ga0466704_556028_6594_7601 335
232 3300042643 Ga0466704_596754 Ga0466704_596754_608_1615 335
233 iso_pr_bacteria 2508501043 2508701709 335
234 iso_pr_bacteria 2889908211 2889908768 335
235 iso_pr_bacteria 2902896024 2902899415 335
236 3300009784 Ga0123357_10067475 Ga0123357_100674755 336
237 3300009784 Ga0123357_10089434 Ga0123357_100894343 336
238 3300010049 Ga0123356_10030709 Ga0123356_100307092 336
239 3300010167 Ga0123353_10010582 Ga0123353_100105824 336
240 3300010167 Ga0123353_10024721 Ga0123353_100247215 336
241 iso_pr_bacteria 2820089333 2820089846 336
242 3300012846 Ga0160433_100098 Ga0160433_10009882 337
243 3300042590 Ga0466690_340290 Ga0466690_340290_21597_22610 337
244 iso_pr_bacteria 2510065004 2510076400 337
245 iso_pr_bacteria 2515154047 2515332162 337
246 iso_pr_bacteria 2515154048 2515334005 337
247 iso_pr_bacteria 2515154049 2515336843 337
248 iso_pr_bacteria 2684622922 2686094368 337
249 iso_pr_bacteria 2684622923 2686096812 337
250 iso_pr_bacteria 2684622924 2686099627 337
251 iso_pr_bacteria 2684622925 2686100463 337
252 iso_pr_bacteria 2684622926 2686105318 337
253 iso_pr_bacteria 2756170265 2756751895 337
254 iso_pr_bacteria 2785510744 2785738958 337
255 iso_pr_bacteria 2785510745 2785741426 337
256 iso_pr_bacteria 2785510746 2785742279 337
257 iso_pr_bacteria 2834098943 2834099595 337
258 iso_pr_bacteria 2837615801 2837618297 337
259 iso_pr_bacteria 2837618715 2837620248 337
260 iso_pr_bacteria 2838840603 2838840608 337
261 iso_pr_bacteria 2840795165 2840795557 337
262 iso_pr_bacteria 2840797934 2840798399 337
263 iso_pr_bacteria 2841195917 2841197863 337
264 iso_pr_bacteria 2843334863 2843335753 337
265 iso_pr_bacteria 2843337836 2843338019 337
266 iso_pr_bacteria 2846472545 2846473228 337
267 iso_pr_bacteria 2846475167 2846475354 337
268 iso_pr_bacteria 2846477985 2846480267 337
269 iso_pr_bacteria 2846480698 2846482361 337
270 iso_pr_bacteria 2846483029 2846483166 337
271 iso_pr_bacteria 2846485327 2846486969 337
272 iso_pr_bacteria 2846488152 2846488944 337
273 iso_pr_bacteria 2846490831 2846492995 337
274 iso_pr_bacteria 2846493360 2846494323 337
275 iso_pr_bacteria 2846495668 2846496094 337
276 iso_pr_bacteria 2849446820 2849448493 337
277 iso_pr_bacteria 2849449383 2849450466 337
278 iso_pr_bacteria 2849452216 2849453095 337
279 iso_pr_bacteria 2849455045 2849455303 337
280 iso_pr_bacteria 2849458003 2849458339 337
281 iso_pr_bacteria 2849460838 2849462809 337
282 iso_pr_bacteria 2849463436 2849465057 337
283 iso_pr_bacteria 2849466174 2849467497 337
284 iso_pr_bacteria 2849468476 2849471297 337
285 iso_pr_bacteria 2849471304 2849472147 337
286 iso_pr_bacteria 2854127928 2854129920 337
287 iso_pr_bacteria 2854129949 2854130880 337
288 iso_pr_bacteria 2854132136 2854133038 337
289 iso_pr_bacteria 2854134697 2854135757 337
290 iso_pr_bacteria 2854137290 2854138384 337
291 iso_pr_bacteria 2854139540 2854141473 337
292 iso_pr_bacteria 2854141978 2854143184 337
293 iso_pr_bacteria 2854144746 2854144790 337
294 iso_pr_bacteria 2854149989 2854150628 337
295 iso_pr_bacteria 2857868033 2857868208 337
296 iso_pr_bacteria 2857870431 2857871732 337
297 iso_pr_bacteria 2857873190 2857875769 337
298 iso_pr_bacteria 2857876020 2857876883 337
299 iso_pr_bacteria 2857878760 2857880796 337
300 iso_pr_bacteria 2857881114 2857881717 337
301 iso_pr_bacteria 2857883421 2857883964 337
302 iso_pr_bacteria 2857886120 2857886463 337
303 iso_pr_bacteria 2857888719 2857890825 337
304 iso_pr_bacteria 2857891623 2857893351 337
305 iso_pr_bacteria 2868486652 2868486983 337
306 iso_pr_bacteria 2868489326 2868491095 337
307 iso_pr_bacteria 2868492035 2868492575 337
308 iso_pr_bacteria 2868494745 2868495816 337
309 iso_pr_bacteria 2868497104 2868497913 337
310 iso_pr_bacteria 2868499409 2868500858 337
311 iso_pr_bacteria 2868504459 2868506608 337
312 iso_pr_bacteria 2868506828 2868508950 337
313 iso_pr_bacteria 2870897478 2870897847 337
314 iso_pr_bacteria 2870900452 2870901177 337
315 iso_pr_bacteria 2870902796 2870904308 337
316 iso_pr_bacteria 2870905362 2870906683 337
317 iso_pr_bacteria 2870908367 2870909848 337
318 iso_pr_bacteria 2870910722 2870912660 337
319 iso_pr_bacteria 2870913170 2870914181 337
320 iso_pr_bacteria 2870915472 2870916475 337
321 iso_pr_bacteria 2870917785 2870918679 337
322 iso_pr_bacteria 2870920129 2870921106 337
323 iso_pr_bacteria 2873633977 2873636071 337
324 iso_pr_bacteria 2873636219 2873636870 337
325 iso_pr_bacteria 2873640908 2873643311 337
326 iso_pr_bacteria 2873643457 2873643934 337
327 iso_pr_bacteria 2873645950 2873647659 337
328 iso_pr_bacteria 2873648542 2873650624 337
329 iso_pr_bacteria 2873651485 2873653427 337
330 iso_pr_bacteria 2873653628 2873654156 337
331 iso_pr_bacteria 2873656248 2873657299 337
332 iso_pr_bacteria 2876011797 2876013703 337
333 iso_pr_bacteria 2876014139 2876014458 337
334 iso_pr_bacteria 2876016455 2876017004 337
335 iso_pr_bacteria 2876019154 2876021882 337
336 iso_pr_bacteria 2876022486 2876024032 337
337 iso_pr_bacteria 2876025319 2876026183 337
338 iso_pr_bacteria 2876027665 2876028827 337
339 iso_pr_bacteria 2876030618 2876032284 337
340 iso_pr_bacteria 2876033458 2876033749 337
341 iso_pr_bacteria 2876036378 2876036636 337
342 iso_pr_bacteria 2878462549 2878464702 337
343 iso_pr_bacteria 2878464769 2878466679 337
344 iso_pr_bacteria 8088486376 8088487087 337
345 iso_pr_bacteria 8088488961 8088489609 337
346 iso_pr_bacteria 8088491222 8088493721 337
347 iso_pr_bacteria 8088493931 8088494622 337
348 3300000461 SCG598P17_12889 SCG598P17_1288917 338
349 3300000472 SCG598B02_13034 SCG598B02_1303432 338
350 3300000473 SCG598I20_12770 SCG598I20_1277032 338
351 3300002732 WW0001_100248 WW0001_100248103 338
352 3300005721 Ga0074278_117976 Ga0074278_1179761 338
353 3300005721 Ga0074278_131570 Ga0074278_1315706 338
354 3300012829 Ga0160467_100092 Ga0160467_10009219 338
355 3300042602 Ga0466713_027261 Ga0466713_027261_178_1194 338
356 3300042659 Ga0466733_025503 Ga0466733_025503_1224_2240 338
357 iso_pr_bacteria 2512047046 2512398146 338
358 iso_pr_bacteria 2820131053 2820131978 338
359 iso_pr_bacteria 2843904799 2843908559 338
360 3300012845 Ga0160460_100129 Ga0160460_10012970 339
361 3300042599 Ga0466706_050992 Ga0466706_050992_4932_5951 339
362 3300042648 Ga0466709_023308 Ga0466709_023308_204_1223 339
363 iso_pr_bacteria 2505679062 2505925682 339
364 iso_pr_bacteria 2585427711 2586307486 339
365 iso_pr_bacteria 2785510747 2785744744 339
366 iso_pr_bacteria 2854147632 2854149862 339
367 iso_pr_bacteria 2873638493 2873640666 339
368 iso_pr_bacteria 3001459110 3001459528 339
369 iso_pr_bacteria 3001462594 3001463373 339
370 iso_pr_bacteria 8065462725 8065463257 339
371 iso_pr_bacteria 8065466226 8065466378 339
372 iso_pr_bacteria 8065469765 8065470459 339
373 iso_pr_bacteria 8074288691 8074289212 339
374 iso_pr_bacteria 8074292191 8074293039 339
375 iso_pr_bacteria 8076033509 8076033556 339
376 2189573031 gam1t_NODE_668966_length=9231_GC=35_7_Contigs=6 gam1t_00031340 340
377 3300007095 Ga0102739_1006498 Ga0102739_10064982 340
378 3300009826 Ga0123355_10125761 Ga0123355_101257612 340
379 3300042592 Ga0466693_001823 Ga0466693_001823_64_1086 340
380 iso_pr_bacteria 2510065002 2510072806 340
381 iso_pr_bacteria 2510065003 2510075552 340
382 iso_pr_bacteria 2524614872 2526111659 340
383 iso_pr_bacteria 2744054871 2745948098 340
384 iso_pr_bacteria 2820042117 2820043348 340
385 iso_pr_bacteria 2820062699 2820064257 340
386 iso_pr_bacteria 2820121232 2820122323 340
387 iso_pr_bacteria 2836755666 2836756472 340
388 iso_pr_bacteria 2848317263 2848322175 340
389 3300002931 CVPL010W_10011352 CVPL010W_100113524 341
390 3300005721 Ga0074278_146800 Ga0074278_1468006 341
391 3300007129 Ga0102734_1000081 Ga0102734_100008129 341
392 3300009461 Ga0127645_146556 Ga0127645_1465562 341
393 3300042599 Ga0466706_009931 Ga0466706_009931_813_1838 341
394 3300042610 Ga0466698_274189 Ga0466698_274189_713_1738 341
395 3300042659 Ga0466733_065275 Ga0466733_065275_71970_72995 341
396 iso_pr_bacteria 2548876789 2549846041 341
397 iso_pr_bacteria 2617270844 2617735452 341
398 iso_pr_bacteria 2864761044 2864763713 341
399 3300002931 CVPL010W_10006624 CVPL010W_100066244 342
400 3300002931 CVPL010W_10036303 CVPL010W_100363032 342
401 3300002934 CVPL005W_1000998 CVPL005W_10009982 342
402 3300007042 Ga0103263_100243 Ga0103263_1002433 342
403 3300007052 Ga0102736_1000058 Ga0102736_100005819 342
404 3300007052 Ga0102736_1000317 Ga0102736_10003179 342
405 3300007083 Ga0103261_1000048 Ga0103261_10000484 342
406 3300007095 Ga0102739_1000045 Ga0102739_10000453 342
407 3300007129 Ga0102734_1002946 Ga0102734_10029467 342
408 3300007139 Ga0103260_1000473 Ga0103260_10004736 342
409 3300007141 Ga0102738_1000053 Ga0102738_100005338 342
410 3300007142 Ga0102737_1000013 Ga0102737_10000134 342
411 3300007142 Ga0102737_1005365 Ga0102737_10053653 342
412 3300007192 Ga0103268_1001892 Ga0103268_10018925 342
413 3300010049 Ga0123356_10036645 Ga0123356_100366456 342
414 3300012813 Ga0160470_100064 Ga0160470_100064111 342
415 3300012820 Ga0160456_100022 Ga0160456_100022105 342
416 3300012850 Ga0160434_100964 Ga0160434_1009645 342
417 3300012857 Ga0160435_1000043 Ga0160435_100004381 342
418 3300042623 Ga0466734_071296 Ga0466734_071296_1562_2590 342
419 3300042625 Ga0466730_086542 Ga0466730_086542_554_1582 342
420 3300042649 Ga0466724_08874 Ga0466724_08874_11435_12463 342
421 3300042649 Ga0466724_33421 Ga0466724_33421_1433_2461 342
422 iso_pr_bacteria 2521172698 2521991004 342
423 iso_pr_bacteria 2597489902 2597923589 342
424 iso_pr_bacteria 2597489903 2597926938 342
425 iso_pr_bacteria 2841260384 2841263882 342
426 iso_pr_bacteria 2850131454 2850135566 342
427 iso_pr_bacteria 2896187957 2896192813 342
428 iso_pr_bacteria 8101676404 8101679437 342
429 iso_pr_bacteria 8101680043 8101682847 342
430 iso_pr_bacteria 8101683685 8101686387 342
431 3300002931 CVPL010W_10025234 CVPL010W_100252344 343
432 3300002934 CVPL005W_1001637 CVPL005W_10016376 343
433 3300003973 Ga0063521_1000009 Ga0063521_100000940 343
434 3300007067 Ga0103266_1004899 Ga0103266_10048992 343
435 3300007140 Ga0102740_1000281 Ga0102740_100028112 343
436 3300007141 Ga0102738_1001855 Ga0102738_10018552 343
437 3300007192 Ga0103268_1021267 Ga0103268_10212672 343
438 3300012815 Ga0160440_100020 Ga0160440_100020120 343
439 3300042591 Ga0466692_125691 Ga0466692_125691_155_1186 343
440 3300042604 Ga0466717_007140 Ga0466717_007140_239_1270 343
441 iso_pr_bacteria 2820065746 2820066185 343
442 iso_pr_bacteria 2873562573 2873562951 343
443 3300002462 JGI24702J35022_10001333 JGI24702J35022_1000133318 344
444 3300002504 JGI24705J35276_12237881 JGI24705J35276_1223788110 344
445 3300007150 Ga0104019_1193207 Ga0104019_11932072 344
446 3300009784 Ga0123357_10000869 Ga0123357_1000086914 344
447 3300012841 Ga0160444_100343 Ga0160444_10034317 344
448 3300012858 Ga0160457_1000058 Ga0160457_100005862 344
449 3300030930 Ga0316159_10003 Ga0316159_10003268 344
450 3300042623 Ga0466734_001100 Ga0466734_001100_11830_12864 344
451 3300042623 Ga0466734_147047 Ga0466734_147047_730_1764 344
452 iso_pr_bacteria 2529292851 2530236134 344
453 iso_pr_bacteria 637000057 637673059 344
454 3300002834 JGI24696J40584_12957324 JGI24696J40584_129573243 345
455 3300009784 Ga0123357_10187373 Ga0123357_101873732 345
456 3300012832 Ga0160458_100011 Ga0160458_10001195 345
457 3300012845 Ga0160460_105710 Ga0160460_1057102 345
458 3300012854 Ga0160448_100185 Ga0160448_1001854 345
459 3300042582 Ga0466657_048119 Ga0466657_048119_1007_2044 345
460 iso_pr_bacteria 649633028 649854890 345
461 3300005071 Ga0068302_10214749 Ga0068302_102147491 346
462 3300007080 Ga0102735_1000622 Ga0102735_10006225 346
463 3300007139 Ga0103260_1000422 Ga0103260_10004224 346
464 3300007140 Ga0102740_1005500 Ga0102740_10055001 346
465 3300007142 Ga0102737_1000476 Ga0102737_10004765 346
466 iso_pr_bacteria 2838140227 2838142025 346
467 2189573031 gam1t_NODE_10840_length=100971_GC=34_2_Contigs=1 gam1t_00124850 347
468 2189573031 gam1t_NODE_600063_length=49977_GC=36_2_Contigs=3 gam1t_00176080 347
469 3300005201 Ga0072941_1072695 Ga0072941_10726952 347
470 3300010882 Ga0123354_10000607 Ga0123354_1000060728 347
471 3300042582 Ga0466657_045296 Ga0466657_045296_637_1680 347
472 3300042606 Ga0466719_446123 Ga0466719_446123_1386_2429 347
473 3300042654 Ga0466725_343034 Ga0466725_343034_571_1614 347
474 iso_pr_bacteria 2515154034 2515298460 347
475 iso_pr_bacteria 2630968947 2633885491 347
476 iso_pr_bacteria 2684622921 2686092380 347
477 iso_pr_bacteria 2756170266 2756755116 347
478 iso_pr_bacteria 2833532623 2833534873 347
479 iso_pr_bacteria 8024019580 8024019601 347
480 3300000333 HBC_ctgsDRAFT_1003971 HBC_ctgsDRAFT_10039712 348
481 3300000462 SCG598I22_11165 SCG598I22_1116530 348
482 3300005721 Ga0074278_129590 Ga0074278_1295902 348
483 3300007140 Ga0102740_1000080 Ga0102740_100008024 348
484 3300042616 Ga0466715_200302 Ga0466715_200302_405_1451 348
485 iso_pr_bacteria 2820137450 2820140938 348
486 3300010049 Ga0123356_10076935 Ga0123356_100769353 349
487 3300012861 Ga0160436_1005501 Ga0160436_10055013 349
488 3300007141 Ga0102738_1000253 Ga0102738_100025310 352
489 3300042616 Ga0466715_163671 Ga0466715_163671_3521_4579 352
490 3300002931 CVPL010W_10008965 CVPL010W_100089657 353
491 3300009784 Ga0123357_10013687 Ga0123357_100136875 355
492 3300010882 Ga0123354_10033324 Ga0123354_100333242 356
493 3300002938 CVPL005L_10011288 CVPL005L_100112885 357
494 3300042616 Ga0466715_437149 Ga0466715_437149_7219_8298 359
495 3300042620 Ga0466728_132354 Ga0466728_132354_70_1149 359
496 3300007129 Ga0102734_1002608 Ga0102734_10026085 361
497 3300007139 Ga0103260_1000519 Ga0103260_10005198 361
498 iso_pr_bacteria 2603880165 2606013097 364
499 3300007188 Ga0103264_1006659 Ga0103264_10066596 365
500 3300042612 Ga0466705_391316 Ga0466705_391316_424_1593 389
501 3300042643 Ga0466704_350815 Ga0466704_350815_5914_7101 395

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 64 220 0.99
PF20618 GPD_NAD_C_bact Bacterial GPD, NAD-dependent C-terminal 301 365 0.96
PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus 241 378 0.96
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 64 152 0.9

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.