Protein Family IF07208
Metagenome
Isolate
107
Members
27
Samples
106
Scaffolds
181.31
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_374407|Ga0466705_374407_50_658
- Length
- 202 aa
- Sequence
- MKTEDFVLVRLDSDAVVALFDCGNDDLNDFLINDAALYQKERFAVTHVIVPLCNAGTIQIAGYFCLLTDKLAFDPSDEKQRKAWKTFNKQNKIHFNKHRKTYPSIKIGRLAVATTFAKQGLGRYIMSCIIYIIISIDNIGCRFITVDAYKSAFDFYLKNDFRFLSSEDESEETRVMYFDLKRYTMLIDELLSPTYRLLFPPV
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.7%
Termitidae
22.2%
Termopsidae
14.8%
Unclassified
14.8%
Passalidae
3.7%
Rhinotermitidae
3.7%
Taxonomy
Archaea
1
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 2 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 3 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 4 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 5 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 9 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 12 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_374407 | 3300042612 | Bacteria | 2136 |
| 2 | Ga0466711_074167 | 3300042615 | Bacteria | 2612 |
| 3 | Ga0466711_086493 | 3300042615 | Archaea | 3366 |
| 4 | Ga0466715_162938 | 3300042616 | Bacteria | 8464 |
| 5 | Ga0466728_274165 | 3300042620 | Bacteria | 15277 |
| 6 | Ga0068305_10476984 | 3300005083 | Unclassified | 711 |
| 7 | Ga0466729_239815 | 3300042621 | Bacteria | 1186 |
| 8 | Ga0466734_147344 | 3300042623 | Bacteria | 1490 |
| 9 | Ga0466719_298066 | 3300042606 | Unclassified | 1605 |
| 10 | Ga0466719_405753 | 3300042606 | Bacteria | 1063 |
| 11 | Ga0466711_011624 | 3300042615 | Bacteria | 6977 |
| 12 | Ga0466711_032755 | 3300042615 | Bacteria | 36049 |
| 13 | Ga0466711_166828 | 3300042615 | Bacteria | 1748 |
| 14 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 15 | Ga0466691_057342 | 3300042593 | Bacteria | 1869 |
| 16 | Ga0466735_156075 | 3300042624 | Unclassified | 1604 |
| 17 | Ga0466735_181585 | 3300042624 | Bacteria | 2466 |
| 18 | Ga0466703_163067 | 3300042636 | Bacteria | 3366 |
| 19 | Ga0466704_023818 | 3300042643 | Bacteria | 15020 |
| 20 | Ga0466704_070084 | 3300042643 | Bacteria | 1357 |
| 21 | Ga0466727_106535 | 3300042655 | Bacteria | 2563 |
| 22 | Ga0466707_023321 | 3300042601 | Bacteria | 4891 |
| 23 | Ga0466707_039862 | 3300042601 | Bacteria | 1247 |
| 24 | Ga0466707_118854 | 3300042601 | Bacteria | 1262 |
| 25 | Ga0466719_027467 | 3300042606 | Bacteria | 1611 |
| 26 | Ga0466719_446021 | 3300042606 | Bacteria | 1374 |
| 27 | Ga0123354_10004657 | 3300010882 | Bacteria | 19538 |
| 28 | Ga0466711_163410 | 3300042615 | Bacteria | 1391 |
| 29 | Ga0466711_431502 | 3300042615 | Bacteria | 10076 |
| 30 | Ga0466711_459607 | 3300042615 | Bacteria | 1192 |
| 31 | Ga0466726_215810 | 3300042619 | Bacteria | 1029 |
| 32 | Ga0466731_324844 | 3300042622 | Bacteria | 1502 |
| 33 | Ga0466735_045560 | 3300042624 | Bacteria | 1240 |
| 34 | Ga0466704_263939 | 3300042643 | Bacteria | 6064 |
| 35 | Ga0466727_165094 | 3300042655 | Bacteria | 3170 |
| 36 | Ga0466707_248165 | 3300042601 | Bacteria | 1744 |
| 37 | Ga0466707_299826 | 3300042601 | Bacteria | 1394 |
| 38 | Ga0466713_026021 | 3300042602 | Bacteria | 2524 |
| 39 | Ga0466711_149727 | 3300042615 | Bacteria | 2453 |
| 40 | Ga0466711_204350 | 3300042615 | Unclassified | 3832 |
| 41 | Ga0466711_230780 | 3300042615 | Bacteria | 1111 |
| 42 | Ga0466726_239320 | 3300042619 | Bacteria | 1716 |
| 43 | Ga0068305_10006957 | 3300005083 | Bacteria | 11216 |
| 44 | Ga0466690_352170 | 3300042590 | Bacteria | 1363 |
| 45 | Ga0466691_115948 | 3300042593 | Bacteria | 1511 |
| 46 | Ga0466707_131270 | 3300042601 | Bacteria | 23399 |
| 47 | Ga0466707_266318 | 3300042601 | Bacteria | 1258 |
| 48 | Ga0466713_034219 | 3300042602 | Bacteria | 3496 |
| 49 | Ga0466713_036443 | 3300042602 | Bacteria | 1397 |
| 50 | Ga0466714_001752 | 3300042603 | Bacteria | 1341 |
| 51 | Ga0466719_500063 | 3300042606 | Bacteria | 1175 |
| 52 | Ga0466733_082464 | 3300042659 | Bacteria | 12902 |
| 53 | Ga0466711_260073 | 3300042615 | Bacteria | 1536 |
| 54 | Ga0466711_389893 | 3300042615 | Bacteria | 1088 |
| 55 | Ga0466711_413161 | 3300042615 | Bacteria | 1171 |
| 56 | Ga0466726_343661 | 3300042619 | Bacteria | 9545 |
| 57 | Ga0466728_213683 | 3300042620 | Unclassified | 1523 |
| 58 | Ga0466691_042880 | 3300042593 | Bacteria | 6612 |
| 59 | Ga0466735_031603 | 3300042624 | Bacteria | 1125 |
| 60 | Ga0466735_149082 | 3300042624 | Bacteria | 2263 |
| 61 | Ga0466703_322116 | 3300042636 | Bacteria | 1817 |
| 62 | Ga0466704_386165 | 3300042643 | Unclassified | 4026 |
| 63 | Ga0466727_272517 | 3300042655 | Bacteria | 5123 |
| 64 | Ga0466713_068025 | 3300042602 | Bacteria | 10658 |
| 65 | Ga0466713_118181 | 3300042602 | Bacteria | 33659 |
| 66 | Ga0466719_245020 | 3300042606 | Bacteria | 1789 |
| 67 | Ga0466719_472765 | 3300042606 | Bacteria | 1166 |
| 68 | Ga0123353_10002921 | 3300010167 | Bacteria | 21404 |
| 69 | Ga0123354_10339627 | 3300010882 | Bacteria | 1355 |
| 70 | Ga0466711_077305 | 3300042615 | Bacteria | 2733 |
| 71 | Ga0466711_108096 | 3300042615 | Bacteria | 16742 |
| 72 | Ga0466711_130864 | 3300042615 | Bacteria | 2643 |
| 73 | Ga0466711_329786 | 3300042615 | Unclassified | 1173 |
| 74 | Ga0466711_388528 | 3300042615 | Bacteria | 1333 |
| 75 | Ga0466711_437771 | 3300042615 | Bacteria | 1289 |
| 76 | IMNBL1DRAFT_c0002452 | 3300000062 | Bacteria | 12900 |
| 77 | Ga0068302_10060312 | 3300005071 | Unclassified | 1814 |
| 78 | Ga0068305_10476176 | 3300005083 | Bacteria | 977 |
| 79 | Ga0466729_253337 | 3300042621 | Bacteria | 1538 |
| 80 | Ga0466727_033690 | 3300042655 | Bacteria | 21432 |
| 81 | Ga0466707_203462 | 3300042601 | Bacteria | 2616 |
| 82 | Ga0466707_226787 | 3300042601 | Bacteria | 17750 |
| 83 | Ga0466713_028662 | 3300042602 | Bacteria | 23021 |
| 84 | Ga0466713_052265 | 3300042602 | Bacteria | 2802 |
| 85 | Ga0466714_031186 | 3300042603 | Bacteria | 1148 |
| 86 | Ga0466719_341122 | 3300042606 | Bacteria | 1240 |
| 87 | Ga0466711_088296 | 3300042615 | Bacteria | 1760 |
| 88 | Ga0466711_172654 | 3300042615 | Bacteria | 2370 |
| 89 | Ga0466691_036704 | 3300042593 | Bacteria | 9460 |
| 90 | Ga0466735_126492 | 3300042624 | Bacteria | 1047 |
| 91 | Ga0466735_191597 | 3300042624 | Bacteria | 1129 |
| 92 | Ga0466716_267950 | 3300042605 | Unclassified | 1846 |
| 93 | Ga0466705_121305 | 3300042612 | Bacteria | 1395 |
| 94 | Ga0466705_294834 | 3300042612 | Unclassified | 1208 |
| 95 | Ga0466733_024263 | 3300042659 | Bacteria | 5894 |
| 96 | Ga0466733_195814 | 3300042659 | Bacteria | 2735 |
| 97 | Ga0466711_093377 | 3300042615 | Bacteria | 7250 |
| 98 | Ga0466711_320271 | 3300042615 | Bacteria | 1045 |
| 99 | Ga0466726_095292 | 3300042619 | Bacteria | 1066 |
| 100 | Ga0068305_10013231 | 3300005083 | Unclassified | 859 |
| 101 | Ga0068305_10032522 | 3300005083 | Bacteria | 13312 |
| 102 | Ga0466691_057313 | 3300042593 | Bacteria | 7402 |
| 103 | Ga0466709_029239 | 3300042648 | Bacteria | 1529 |
| 104 | Ga0466707_138317 | 3300042601 | Bacteria | 1372 |
| 105 | Ga0466719_074812 | 3300042606 | Bacteria | 1246 |
| 106 | Ga0466719_371008 | 3300042606 | Bacteria | 2303 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042603 | Ga0466714_001752 | Ga0466714_001752_227_661 | 144 |
| 2 | 3300042615 | Ga0466711_163410 | Ga0466711_163410_901_1365 | 154 |
| 3 | 3300042619 | Ga0466726_095292 | Ga0466726_095292_226_726 | 166 |
| 4 | 3300042602 | Ga0466713_036443 | Ga0466713_036443_285_830 | 168 |
| 5 | 3300042606 | Ga0466719_298066 | Ga0466719_298066_262_822 | 169 |
| 6 | 3300042615 | Ga0466711_413161 | Ga0466711_413161_234_743 | 169 |
| 7 | 3300042619 | Ga0466726_239320 | Ga0466726_239320_648_1157 | 169 |
| 8 | 3300042601 | Ga0466707_138317 | Ga0466707_138317_377_925 | 173 |
| 9 | 3300042606 | Ga0466719_341122 | Ga0466719_341122_69_635 | 173 |
| 10 | 3300042590 | Ga0466690_276223 | Ga0466690_276223_50845_51402 | 174 |
| 11 | 3300042602 | Ga0466713_028662 | Ga0466713_028662_7886_8431 | 175 |
| 12 | 3300042623 | Ga0466734_147344 | Ga0466734_147344_195_725 | 176 |
| 13 | 3300042643 | Ga0466704_023818 | Ga0466704_023818_7352_7906 | 176 |
| 14 | 3300042643 | Ga0466704_070084 | Ga0466704_070084_208_741 | 177 |
| 15 | 3300042655 | Ga0466727_106535 | Ga0466727_106535_1878_2411 | 177 |
| 16 | 3300042659 | Ga0466733_024263 | Ga0466733_024263_905_1438 | 177 |
| 17 | 3300042659 | Ga0466733_082464 | Ga0466733_082464_3191_3724 | 177 |
| 18 | 3300042659 | Ga0466733_195814 | Ga0466733_195814_1889_2422 | 177 |
| 19 | 3300000062 | IMNBL1DRAFT_c0002452 | IMNBL1DRAFT_00024523 | 178 |
| 20 | 3300042590 | Ga0466690_352170 | Ga0466690_352170_177_752 | 178 |
| 21 | 3300042601 | Ga0466707_118854 | Ga0466707_118854_216_752 | 178 |
| 22 | 3300042603 | Ga0466714_031186 | Ga0466714_031186_71_607 | 178 |
| 23 | 3300042615 | Ga0466711_093377 | Ga0466711_093377_3120_3656 | 178 |
| 24 | 3300042622 | Ga0466731_324844 | Ga0466731_324844_96_632 | 178 |
| 25 | 3300042601 | Ga0466707_248165 | Ga0466707_248165_360_899 | 179 |
| 26 | 3300042601 | Ga0466707_266318 | Ga0466707_266318_199_738 | 179 |
| 27 | 3300042624 | Ga0466735_126492 | Ga0466735_126492_306_845 | 179 |
| 28 | 3300042602 | Ga0466713_052265 | Ga0466713_052265_1922_2464 | 180 |
| 29 | 3300042615 | Ga0466711_260073 | Ga0466711_260073_745_1287 | 180 |
| 30 | 3300042615 | Ga0466711_389893 | Ga0466711_389893_181_723 | 180 |
| 31 | 3300042619 | Ga0466726_343661 | Ga0466726_343661_5491_6033 | 180 |
| 32 | 3300042624 | Ga0466735_045560 | Ga0466735_045560_76_618 | 180 |
| 33 | 3300042624 | Ga0466735_149082 | Ga0466735_149082_1163_1705 | 180 |
| 34 | 3300005083 | Ga0068305_10006957 | Ga0068305_100069574 | 181 |
| 35 | 3300005083 | Ga0068305_10476176 | Ga0068305_104761762 | 181 |
| 36 | 3300010882 | Ga0123354_10004657 | Ga0123354_100046573 | 181 |
| 37 | 3300010882 | Ga0123354_10339627 | Ga0123354_103396272 | 181 |
| 38 | 3300042655 | Ga0466727_033690 | Ga0466727_033690_13114_13659 | 181 |
| 39 | 3300042601 | Ga0466707_203462 | Ga0466707_203462_1589_2137 | 182 |
| 40 | 3300042601 | Ga0466707_226787 | Ga0466707_226787_8932_9480 | 182 |
| 41 | 3300042602 | Ga0466713_034219 | Ga0466713_034219_646_1194 | 182 |
| 42 | 3300042602 | Ga0466713_118181 | Ga0466713_118181_1148_1696 | 182 |
| 43 | 3300042621 | Ga0466729_253337 | Ga0466729_253337_402_950 | 182 |
| 44 | 3300042624 | Ga0466735_031603 | Ga0466735_031603_169_717 | 182 |
| 45 | 3300042624 | Ga0466735_156075 | Ga0466735_156075_693_1241 | 182 |
| 46 | 3300042636 | Ga0466703_163067 | Ga0466703_163067_555_1103 | 182 |
| 47 | 3300042655 | Ga0466727_272517 | Ga0466727_272517_3807_4355 | 182 |
| 48 | iso_pr_bacteria | 2967483437 | 2967483443 | 182 |
| 49 | 3300005083 | Ga0068305_10476984 | Ga0068305_104769842 | 183 |
| 50 | 3300042601 | Ga0466707_023321 | Ga0466707_023321_3129_3680 | 183 |
| 51 | 3300042601 | Ga0466707_299826 | Ga0466707_299826_350_901 | 183 |
| 52 | 3300042615 | Ga0466711_086493 | Ga0466711_086493_1911_2462 | 183 |
| 53 | 3300042615 | Ga0466711_108096 | Ga0466711_108096_647_1198 | 183 |
| 54 | 3300042615 | Ga0466711_204350 | Ga0466711_204350_1587_2138 | 183 |
| 55 | 3300042619 | Ga0466726_215810 | Ga0466726_215810_398_949 | 183 |
| 56 | 3300005071 | Ga0068302_10060312 | Ga0068302_100603124 | 184 |
| 57 | 3300005083 | Ga0068305_10032522 | Ga0068305_1003252211 | 184 |
| 58 | 3300042593 | Ga0466691_042880 | Ga0466691_042880_2847_3401 | 184 |
| 59 | 3300042593 | Ga0466691_057342 | Ga0466691_057342_387_941 | 184 |
| 60 | 3300042593 | Ga0466691_115948 | Ga0466691_115948_273_827 | 184 |
| 61 | 3300042606 | Ga0466719_027467 | Ga0466719_027467_575_1129 | 184 |
| 62 | 3300042606 | Ga0466719_245020 | Ga0466719_245020_448_1002 | 184 |
| 63 | 3300042606 | Ga0466719_371008 | Ga0466719_371008_413_967 | 184 |
| 64 | 3300042606 | Ga0466719_446021 | Ga0466719_446021_473_1027 | 184 |
| 65 | 3300042612 | Ga0466705_121305 | Ga0466705_121305_230_784 | 184 |
| 66 | 3300042615 | Ga0466711_074167 | Ga0466711_074167_1543_2097 | 184 |
| 67 | 3300042615 | Ga0466711_077305 | Ga0466711_077305_1391_1945 | 184 |
| 68 | 3300042615 | Ga0466711_149727 | Ga0466711_149727_1535_2089 | 184 |
| 69 | 3300042615 | Ga0466711_166828 | Ga0466711_166828_276_830 | 184 |
| 70 | 3300042615 | Ga0466711_172654 | Ga0466711_172654_964_1518 | 184 |
| 71 | 3300042615 | Ga0466711_320271 | Ga0466711_320271_303_857 | 184 |
| 72 | 3300042615 | Ga0466711_329786 | Ga0466711_329786_230_784 | 184 |
| 73 | 3300042615 | Ga0466711_388528 | Ga0466711_388528_131_685 | 184 |
| 74 | 3300042615 | Ga0466711_431502 | Ga0466711_431502_9159_9713 | 184 |
| 75 | 3300042615 | Ga0466711_437771 | Ga0466711_437771_478_1032 | 184 |
| 76 | 3300042615 | Ga0466711_459607 | Ga0466711_459607_269_823 | 184 |
| 77 | 3300042620 | Ga0466728_213683 | Ga0466728_213683_135_689 | 184 |
| 78 | 3300042620 | Ga0466728_274165 | Ga0466728_274165_4352_4906 | 184 |
| 79 | 3300042624 | Ga0466735_191597 | Ga0466735_191597_63_617 | 184 |
| 80 | 3300042643 | Ga0466704_263939 | Ga0466704_263939_398_952 | 184 |
| 81 | 3300042648 | Ga0466709_029239 | Ga0466709_029239_376_930 | 184 |
| 82 | 3300010167 | Ga0123353_10002921 | Ga0123353_100029212 | 185 |
| 83 | 3300042593 | Ga0466691_057313 | Ga0466691_057313_6425_6982 | 185 |
| 84 | 3300042601 | Ga0466707_131270 | Ga0466707_131270_21295_21852 | 185 |
| 85 | 3300042602 | Ga0466713_026021 | Ga0466713_026021_428_985 | 185 |
| 86 | 3300042602 | Ga0466713_068025 | Ga0466713_068025_3837_4394 | 185 |
| 87 | 3300042605 | Ga0466716_267950 | Ga0466716_267950_839_1396 | 185 |
| 88 | 3300042606 | Ga0466719_472765 | Ga0466719_472765_571_1128 | 185 |
| 89 | 3300042606 | Ga0466719_500063 | Ga0466719_500063_117_674 | 185 |
| 90 | 3300042615 | Ga0466711_088296 | Ga0466711_088296_333_890 | 185 |
| 91 | 3300042615 | Ga0466711_130864 | Ga0466711_130864_1713_2270 | 185 |
| 92 | 3300042615 | Ga0466711_230780 | Ga0466711_230780_200_757 | 185 |
| 93 | 3300042636 | Ga0466703_322116 | Ga0466703_322116_492_1049 | 185 |
| 94 | 3300042655 | Ga0466727_165094 | Ga0466727_165094_1572_2129 | 185 |
| 95 | 3300005083 | Ga0068305_10013231 | Ga0068305_100132312 | 186 |
| 96 | 3300042606 | Ga0466719_405753 | Ga0466719_405753_155_715 | 186 |
| 97 | 3300042612 | Ga0466705_294834 | Ga0466705_294834_412_972 | 186 |
| 98 | 3300042616 | Ga0466715_162938 | Ga0466715_162938_6766_7326 | 186 |
| 99 | 3300042643 | Ga0466704_386165 | Ga0466704_386165_533_1093 | 186 |
| 100 | 3300042601 | Ga0466707_039862 | Ga0466707_039862_275_838 | 187 |
| 101 | 3300042606 | Ga0466719_074812 | Ga0466719_074812_479_1042 | 187 |
| 102 | 3300042615 | Ga0466711_032755 | Ga0466711_032755_27743_28306 | 187 |
| 103 | 3300042621 | Ga0466729_239815 | Ga0466729_239815_223_789 | 188 |
| 104 | 3300042624 | Ga0466735_181585 | Ga0466735_181585_381_947 | 188 |
| 105 | 3300042593 | Ga0466691_036704 | Ga0466691_036704_516_1088 | 190 |
| 106 | 3300042615 | Ga0466711_011624 | Ga0466711_011624_4138_4710 | 190 |
| 107 | 3300042612 | Ga0466705_374407 | Ga0466705_374407_50_658 | 202 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ak9-assembly1.cif.gz_B | Structure of Salmonella TacT3 toxin bound to TacA3 antitoxin C-terminal peptide | 0.884 | 5 | 189 |
| 6gtr-assembly1.cif.gz_A | Structure of the AtaT Y144F mutant toxin bound to the C-terminus of the antitoxin AtaR and Acetyl-CoA | 0.879 | 5 | 187 |
| 6gtr-assembly2.cif.gz_B | Structure of the AtaT Y144F mutant toxin bound to the C-terminus of the antitoxin AtaR and Acetyl-CoA | 0.872 | 5 | 188 |
| 6gtq-assembly1.cif.gz_A | Structure of the AtaT Y144F mutant toxin bound to the C-terminus of the antitoxin AtaR | 0.868 | 5 | 186 |
| 6gtq-assembly2.cif.gz_B | Structure of the AtaT Y144F mutant toxin bound to the C-terminus of the antitoxin AtaR | 0.867 | 5 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5fvjB00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.845 | 7 | 179 | 3.40.630.30 |
| af_A0A0P0VD75_30_125_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8196 | 104 | 179 | 3.40.630.30 |
| af_A4IDI3_157_301_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8093 | 44 | 171 | 3.40.630.30 |
| af_A0A1D6LYK2_621_771_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8004 | 43 | 148 | 3.40.630.30 |
| 1i21N00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7928 | 44 | 162 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L1NYQ9-F1-model_v4 | Uncharacterized/unreviewed | 0.9554 | 93 | 184 | |
| AF-L1P504-F1-model_v4 | Uncharacterized/unreviewed | 0.952 | 106 | 184 | |
| AF-A0A849S3G8-F1-model_v4 | Uncharacterized/unreviewed | 0.9388 | 104 | 186 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.