Protein Family IF07188
Metagenome
Isolate
168
Members
113
Samples
122
Scaffolds
251.88
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_315937|Ga0466705_315937_1114_2010
- Length
- 298 aa
- Sequence
- MTMNSNSVDWIVPDWTAPARVVSLVTTRRGGLSVGVFASLNLGEHVGDDPAAVAANRELIRQRIGVRPVWLRQVPGAQVIDAAGSAGPHPPEADAAFARQAGIACAVMTADCLPVLFCDTGGTVVAAAHAGWRGLLAGVLEAAVAAMQAPHQDLLAWLGPAICPQAFEVGSEVRAAFVAAAPNTAEAFRPSGSGKWLADIYLLARQRLAKQGITRVFGGDFCTVSETERFYSHRRDGQTGRMASLIWLKCCPLTPSGRFRPDGSSSPARAGPASSKAIVSGRRQKSRTVSISLNIYGF
Sample Types
Isolate
27.4%
Metagenome
72.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.4%
Elmidae
13.0%
Kalotermitidae
13.0%
Termitidae
11.1%
Culicidae
9.3%
Formicidae
8.3%
Curculionidae
6.5%
Drosophilidae
3.7%
Rhinotermitidae
2.8%
Armadillidiidae
2.8%
Termopsidae
2.8%
Siricidae
0.9%
Hodotermitidae
0.9%
Tenebrionidae
0.9%
Majidae
0.9%
Aphididae
0.9%
Passalidae
0.9%
Cerambycidae
0.9%
Alydidae
0.9%
Taxonomy
Archaea
0
Bacteria
160
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 3 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 4 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 5 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 6 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 7 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 8 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 17 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 18 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 19 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 20 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 21 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 22 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 25 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 26 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 27 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 35 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 36 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 37 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 38 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 39 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 40 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 41 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 42 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 43 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 44 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 47 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 48 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 55 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 56 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 57 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 58 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 59 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 60 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 61 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 62 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 63 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 64 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 65 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 66 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 67 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 68 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 69 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 70 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 71 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 72 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 73 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 74 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 75 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 76 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 77 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 78 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 79 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 80 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 81 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 82 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 83 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 84 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 85 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 86 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 87 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 88 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 89 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 90 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 91 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 92 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 93 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 94 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 95 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 96 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 97 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 98 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 99 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 100 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 101 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 102 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 103 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 104 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 105 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 106 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 107 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 108 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 109 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 110 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 111 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 112 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 113 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160448_103546 | 3300012854 | Unclassified | 4542 |
| 2 | Ga0466691_088302 | 3300042593 | Bacteria | 18567 |
| 3 | Ga0103268_1000012 | 3300007192 | Bacteria | 61889 |
| 4 | Ga0466703_129960 | 3300042636 | Bacteria | 66694 |
| 5 | Ga0466704_496140 | 3300042643 | Bacteria | 1224 |
| 6 | Ga0466704_560503 | 3300042643 | Bacteria | 9227 |
| 7 | Ga0466724_61568 | 3300042649 | Bacteria | 12303 |
| 8 | Ga0466708_045484 | 3300042652 | Bacteria | 14091 |
| 9 | Ga0466719_561327 | 3300042606 | Bacteria | 9010 |
| 10 | Ga0466722_054137 | 3300042609 | Bacteria | 11853 |
| 11 | Ga0466710_171687 | 3300042613 | Bacteria | 15463 |
| 12 | Ga0466715_145360 | 3300042616 | Bacteria | 3250 |
| 13 | Ga0160446_100349 | 3300012835 | Bacteria | 24540 |
| 14 | Ga0160460_102210 | 3300012845 | Bacteria | 4775 |
| 15 | Ga0160436_1009118 | 3300012861 | Unclassified | 2204 |
| 16 | Ga0466657_199187 | 3300042582 | Bacteria | 18046 |
| 17 | Ga0466690_297639 | 3300042590 | Bacteria | 53281 |
| 18 | Ga0466691_195824 | 3300042593 | Bacteria | 1516 |
| 19 | Ga0072941_1098442 | 3300005201 | Bacteria | 3032 |
| 20 | Ga0102739_1000720 | 3300007095 | Bacteria | 6111 |
| 21 | Ga0104042_1125545 | 3300007130 | Bacteria | 1246 |
| 22 | Ga0466703_137408 | 3300042636 | Bacteria | 14021 |
| 23 | Ga0466703_167167 | 3300042636 | Bacteria | 9107 |
| 24 | Ga0466704_309416 | 3300042643 | Bacteria | 3577 |
| 25 | Ga0466724_10614 | 3300042649 | Bacteria | 16626 |
| 26 | Ga0466708_341105 | 3300042652 | Bacteria | 17135 |
| 27 | Ga0466716_193843 | 3300042605 | Bacteria | 5453 |
| 28 | Ga0466726_110104 | 3300042619 | Bacteria | 1514 |
| 29 | Ga0466726_230706 | 3300042619 | Bacteria | 26465 |
| 30 | Ga0160465_102941 | 3300012803 | Unclassified | 3405 |
| 31 | Ga0160471_100052 | 3300012812 | Bacteria | 158370 |
| 32 | Ga0316159_14530 | 3300030930 | Bacteria | 1092 |
| 33 | Ga0466696_286577 | 3300042596 | Bacteria | 5509 |
| 34 | IMNBL1DRAFT_c0000382 | 3300000062 | Bacteria | 37904 |
| 35 | Ga0103260_1000463 | 3300007139 | Bacteria | 7766 |
| 36 | Ga0466717_077495 | 3300042604 | Bacteria | 3218 |
| 37 | Ga0466719_063737 | 3300042606 | Bacteria | 20898 |
| 38 | Ga0466705_089676 | 3300042612 | Bacteria | 4960 |
| 39 | Ga0160467_102458 | 3300012829 | Unclassified | 4122 |
| 40 | Ga0160433_100309 | 3300012846 | Bacteria | 31428 |
| 41 | Ga0160435_1001041 | 3300012857 | Bacteria | 7339 |
| 42 | Ga0466696_450416 | 3300042596 | Bacteria | 1144 |
| 43 | Ga0466703_179256 | 3300042636 | Bacteria | 1549 |
| 44 | Ga0466704_110726 | 3300042643 | Bacteria | 63753 |
| 45 | Ga0466727_278944 | 3300042655 | Bacteria | 6058 |
| 46 | Ga0466717_150566 | 3300042604 | Bacteria | 11963 |
| 47 | Ga0466719_284580 | 3300042606 | Bacteria | 6972 |
| 48 | Ga0466722_174602 | 3300042609 | Bacteria | 1232 |
| 49 | Ga0466712_241604 | 3300042614 | Bacteria | 4820 |
| 50 | Ga0466715_253110 | 3300042616 | Bacteria | 1679 |
| 51 | Ga0466723_025140 | 3300042618 | Unclassified | 10502 |
| 52 | Ga0466705_352386 | 3300042612 | Bacteria | 63158 |
| 53 | Ga0160446_100714 | 3300012835 | Bacteria | 10901 |
| 54 | Ga0466657_299572 | 3300042582 | Bacteria | 28786 |
| 55 | Ga0466692_036701 | 3300042591 | Bacteria | 5395 |
| 56 | Ga0466691_044797 | 3300042593 | Bacteria | 3600 |
| 57 | Ga0466701_008094 | 3300042598 | Bacteria | 39963 |
| 58 | DPO_contig00202 | 2032320009 | Bacteria | 4351 |
| 59 | FGTW_contig30927 | 2065487013 | Unclassified | 7747 |
| 60 | JGI24705J35276_12223513 | 3300002504 | Bacteria | 2517 |
| 61 | CVPL005W_1000216 | 3300002934 | Bacteria | 26567 |
| 62 | Ga0103266_1000546 | 3300007067 | Bacteria | 7558 |
| 63 | Ga0103266_1001230 | 3300007067 | Unclassified | 4499 |
| 64 | Ga0466729_226007 | 3300042621 | Bacteria | 17290 |
| 65 | Ga0466703_286960 | 3300042636 | Bacteria | 1188 |
| 66 | Ga0466704_105577 | 3300042643 | Bacteria | 17946 |
| 67 | Ga0466707_030916 | 3300042601 | Bacteria | 2301 |
| 68 | Ga0466713_078211 | 3300042602 | Bacteria | 22042 |
| 69 | Ga0466710_040331 | 3300042613 | Bacteria | 75769 |
| 70 | Ga0466711_211154 | 3300042615 | Bacteria | 28171 |
| 71 | Ga0466711_396178 | 3300042615 | Bacteria | 2518 |
| 72 | Ga0466715_092406 | 3300042616 | Bacteria | 7039 |
| 73 | Ga0466715_151670 | 3300042616 | Bacteria | 1668 |
| 74 | Ga0466728_248439 | 3300042620 | Bacteria | 27319 |
| 75 | Ga0562378_1346 | 3300056814 | Bacteria | 27526 |
| 76 | Ga0160454_100423 | 3300012798 | Bacteria | 19354 |
| 77 | Ga0160432_106340 | 3300012818 | Bacteria | 1060 |
| 78 | Ga0466696_395754 | 3300042596 | Bacteria | 1010 |
| 79 | DPO_contig09083 | 2032320009 | Bacteria | 4367 |
| 80 | SPBB_contig11492 | 2044078006 | Bacteria | 5065 |
| 81 | Meta3P_1004786 | 3300002464 | Unclassified | 4270 |
| 82 | Ga0074188_1000481 | 3300005318 | Bacteria | 13595 |
| 83 | Ga0102736_1000134 | 3300007052 | Bacteria | 20672 |
| 84 | Ga0104041_1002334 | 3300007106 | Bacteria | 8164 |
| 85 | Ga0466702_080214 | 3300042635 | Bacteria | 7973 |
| 86 | Ga0466724_31766 | 3300042649 | Bacteria | 4831 |
| 87 | Ga0466727_312739 | 3300042655 | Bacteria | 55771 |
| 88 | Ga0466722_080577 | 3300042609 | Bacteria | 1117 |
| 89 | Ga0466715_084290 | 3300042616 | Bacteria | 20606 |
| 90 | Ga0466715_111155 | 3300042616 | Bacteria | 11083 |
| 91 | Ga0466723_336722 | 3300042618 | Bacteria | 9879 |
| 92 | Ga0466697_147185 | 3300042611 | Bacteria | 2975 |
| 93 | Ga0466705_302403 | 3300042612 | Bacteria | 1102 |
| 94 | Ga0466690_383350 | 3300042590 | Bacteria | 4231 |
| 95 | Ga0466692_085714 | 3300042591 | Bacteria | 18558 |
| 96 | SPBB_contig11556 | 2044078006 | Bacteria | 42322 |
| 97 | SWWA_contig31832__length_5195___numreads_345 | 2100351016 | Bacteria | 5195 |
| 98 | JGI24702J35022_10001333 | 3300002462 | Bacteria | 15340 |
| 99 | Ga0466704_075054 | 3300042643 | Bacteria | 1771 |
| 100 | Ga0466709_064763 | 3300042648 | Bacteria | 6417 |
| 101 | Ga0466707_081949 | 3300042601 | Bacteria | 43968 |
| 102 | Ga0466711_118618 | 3300042615 | Bacteria | 3356 |
| 103 | Ga0466723_197986 | 3300042618 | Bacteria | 15443 |
| 104 | Ga0466697_110728 | 3300042611 | Bacteria | 1340 |
| 105 | Ga0466705_315937 | 3300042612 | Bacteria | 2194 |
| 106 | Ga0160465_102958 | 3300012803 | Bacteria | 3392 |
| 107 | Ga0160460_100573 | 3300012845 | Bacteria | 19745 |
| 108 | Ga0160443_105914 | 3300012848 | Bacteria | 1633 |
| 109 | Ga0466690_260624 | 3300042590 | Bacteria | 14197 |
| 110 | Ga0466691_222809 | 3300042593 | Bacteria | 1298 |
| 111 | Ga0103265_1007537 | 3300007068 | Bacteria | 1447 |
| 112 | Ga0102737_1005581 | 3300007142 | Bacteria | 2492 |
| 113 | Ga0466734_053344 | 3300042623 | Bacteria | 92534 |
| 114 | Ga0466735_114449 | 3300042624 | Bacteria | 1838 |
| 115 | Ga0466704_384822 | 3300042643 | Bacteria | 1477 |
| 116 | Ga0466709_230238 | 3300042648 | Bacteria | 8706 |
| 117 | Ga0466708_088236 | 3300042652 | Bacteria | 25149 |
| 118 | Ga0466725_006956 | 3300042654 | Bacteria | 30587 |
| 119 | Ga0466701_023800 | 3300042598 | Bacteria | 25755 |
| 120 | Ga0466706_215191 | 3300042599 | Bacteria | 4748 |
| 121 | Ga0466722_039561 | 3300042609 | Bacteria | 2957 |
| 122 | Ga0466715_637563 | 3300042616 | Bacteria | 1419 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 2065487013 | FGTW_contig30927 | FGTW_00460240 | 225 |
| 2 | 3300042618 | Ga0466723_025140 | Ga0466723_025140_7410_8174 | 234 |
| 3 | 3300002464 | Meta3P_1004786 | Meta3P_10047863 | 236 |
| 4 | 2032320009 | DPO_contig00202 | DPOB_233890 | 241 |
| 5 | 2032320009 | DPO_contig09083 | DPOB_65670 | 241 |
| 6 | 2044078006 | SPBB_contig11492 | SPBB_256730 | 241 |
| 7 | 2044078006 | SPBB_contig11556 | SPBB_429790 | 241 |
| 8 | 3300007095 | Ga0102739_1000720 | Ga0102739_10007206 | 241 |
| 9 | 3300042623 | Ga0466734_053344 | Ga0466734_053344_25612_26337 | 241 |
| 10 | iso_pr_bacteria | 2519899622 | 2520387962 | 241 |
| 11 | iso_pr_bacteria | 2864745180 | 2864749888 | 241 |
| 12 | iso_pr_bacteria | 2864847319 | 2864849341 | 241 |
| 13 | iso_pr_bacteria | 2864853652 | 2864858090 | 241 |
| 14 | iso_pr_bacteria | 8035321120 | 8035326595 | 241 |
| 15 | iso_pr_bacteria | 8035326735 | 8035329299 | 241 |
| 16 | 3300012798 | Ga0160454_100423 | Ga0160454_1004233 | 242 |
| 17 | 3300012818 | Ga0160432_106340 | Ga0160432_1063402 | 242 |
| 18 | 3300012829 | Ga0160467_102458 | Ga0160467_1024582 | 242 |
| 19 | 3300012835 | Ga0160446_100349 | Ga0160446_10034920 | 242 |
| 20 | 3300012845 | Ga0160460_102210 | Ga0160460_1022102 | 242 |
| 21 | 3300012848 | Ga0160443_105914 | Ga0160443_1059142 | 242 |
| 22 | 3300012854 | Ga0160448_103546 | Ga0160448_1035462 | 242 |
| 23 | 3300012861 | Ga0160436_1009118 | Ga0160436_10091182 | 242 |
| 24 | 3300030930 | Ga0316159_14530 | Ga0316159_145302 | 242 |
| 25 | 3300042606 | Ga0466719_063737 | Ga0466719_063737_15898_16698 | 242 |
| 26 | 3300042613 | Ga0466710_040331 | Ga0466710_040331_13478_14206 | 242 |
| 27 | iso_pr_bacteria | 2565956518 | 2566025895 | 242 |
| 28 | iso_pr_bacteria | 2791355471 | 2794373232 | 242 |
| 29 | iso_pr_bacteria | 2871771314 | 2871772640 | 242 |
| 30 | iso_pr_bacteria | 3006225627 | 3006228529 | 242 |
| 31 | iso_pr_bacteria | 3006242587 | 3006244206 | 242 |
| 32 | 2100351016 | SWWA_contig31832__length_5195___numreads_345 | SWWA_02595630 | 243 |
| 33 | iso_pr_bacteria | 2528768011 | 2528816828 | 243 |
| 34 | iso_pr_bacteria | 2859315706 | 2859321050 | 243 |
| 35 | iso_pr_bacteria | 2978102237 | 2978104775 | 243 |
| 36 | 3300000062 | IMNBL1DRAFT_c0000382 | IMNBL1DRAFT_00003822 | 244 |
| 37 | 3300042593 | Ga0466691_222809 | Ga0466691_222809_186_920 | 244 |
| 38 | 3300042615 | Ga0466711_211154 | Ga0466711_211154_12270_13022 | 244 |
| 39 | 3300042619 | Ga0466726_110104 | Ga0466726_110104_76_837 | 244 |
| 40 | iso_pr_bacteria | 2820152154 | 2820153558 | 244 |
| 41 | iso_pr_bacteria | 2858407585 | 2858409264 | 244 |
| 42 | iso_pr_bacteria | 2873884416 | 2873888866 | 244 |
| 43 | iso_pr_bacteria | 8048923410 | 8048924009 | 244 |
| 44 | 3300005318 | Ga0074188_1000481 | Ga0074188_100048110 | 245 |
| 45 | 3300042596 | Ga0466696_450416 | Ga0466696_450416_167_904 | 245 |
| 46 | 3300042598 | Ga0466701_023800 | Ga0466701_023800_6998_7735 | 245 |
| 47 | 3300042611 | Ga0466697_147185 | Ga0466697_147185_1418_2155 | 245 |
| 48 | 3300042614 | Ga0466712_241604 | Ga0466712_241604_3749_4486 | 245 |
| 49 | 3300042616 | Ga0466715_151670 | Ga0466715_151670_711_1448 | 245 |
| 50 | iso_pr_bacteria | 2603880173 | 2606035793 | 245 |
| 51 | iso_pr_bacteria | 2864764899 | 2864767864 | 245 |
| 52 | iso_pr_bacteria | 2864768727 | 2864772307 | 245 |
| 53 | iso_pr_bacteria | 2864777284 | 2864780517 | 245 |
| 54 | iso_pr_bacteria | 2864791955 | 2864795536 | 245 |
| 55 | iso_pr_bacteria | 2864796242 | 2864799829 | 245 |
| 56 | iso_pr_bacteria | 637000219 | 638003563 | 245 |
| 57 | iso_pr_bacteria | 8062647588 | 8062651032 | 245 |
| 58 | 3300002934 | CVPL005W_1000216 | CVPL005W_100021617 | 246 |
| 59 | 3300005201 | Ga0072941_1098442 | Ga0072941_10984423 | 246 |
| 60 | 3300007052 | Ga0102736_1000134 | Ga0102736_100013410 | 246 |
| 61 | 3300007067 | Ga0103266_1000546 | Ga0103266_10005465 | 246 |
| 62 | 3300007067 | Ga0103266_1001230 | Ga0103266_10012303 | 246 |
| 63 | 3300007068 | Ga0103265_1007537 | Ga0103265_10075372 | 246 |
| 64 | 3300007106 | Ga0104041_1002334 | Ga0104041_10023342 | 246 |
| 65 | 3300007130 | Ga0104042_1125545 | Ga0104042_11255451 | 246 |
| 66 | 3300007139 | Ga0103260_1000463 | Ga0103260_10004633 | 246 |
| 67 | 3300007142 | Ga0102737_1005581 | Ga0102737_10055812 | 246 |
| 68 | 3300007192 | Ga0103268_1000012 | Ga0103268_100001221 | 246 |
| 69 | 3300012857 | Ga0160435_1001041 | Ga0160435_10010416 | 246 |
| 70 | 3300042593 | Ga0466691_195824 | Ga0466691_195824_510_1250 | 246 |
| 71 | 3300042598 | Ga0466701_008094 | Ga0466701_008094_21402_22142 | 246 |
| 72 | 3300042609 | Ga0466722_174602 | Ga0466722_174602_145_885 | 246 |
| 73 | 3300042616 | Ga0466715_092406 | Ga0466715_092406_3603_4343 | 246 |
| 74 | 3300042636 | Ga0466703_129960 | Ga0466703_129960_11924_12664 | 246 |
| 75 | 3300042649 | Ga0466724_10614 | Ga0466724_10614_12590_13330 | 246 |
| 76 | 3300042649 | Ga0466724_31766 | Ga0466724_31766_3045_3785 | 246 |
| 77 | iso_pr_bacteria | 2687453754 | 2690041391 | 246 |
| 78 | iso_pr_bacteria | 2687453755 | 2690044524 | 246 |
| 79 | iso_pr_bacteria | 2687453756 | 2690047555 | 246 |
| 80 | iso_pr_bacteria | 8011329375 | 8011333741 | 246 |
| 81 | 3300012803 | Ga0160465_102941 | Ga0160465_1029412 | 247 |
| 82 | 3300012803 | Ga0160465_102958 | Ga0160465_1029582 | 247 |
| 83 | 3300012846 | Ga0160433_100309 | Ga0160433_1003096 | 247 |
| 84 | 3300042616 | Ga0466715_637563 | Ga0466715_637563_424_1167 | 247 |
| 85 | 3300042648 | Ga0466709_230238 | Ga0466709_230238_2255_2998 | 247 |
| 86 | 3300042652 | Ga0466708_088236 | Ga0466708_088236_5701_6444 | 247 |
| 87 | iso_pr_bacteria | 2864859030 | 2864860511 | 247 |
| 88 | iso_pr_bacteria | 2864914039 | 2864915468 | 247 |
| 89 | iso_pr_bacteria | 2864988360 | 2864991374 | 247 |
| 90 | 3300042590 | Ga0466690_297639 | Ga0466690_297639_47485_48231 | 248 |
| 91 | 3300042601 | Ga0466707_030916 | Ga0466707_030916_101_847 | 248 |
| 92 | 3300042609 | Ga0466722_080577 | Ga0466722_080577_248_994 | 248 |
| 93 | 3300042618 | Ga0466723_197986 | Ga0466723_197986_14617_15363 | 248 |
| 94 | 3300042636 | Ga0466703_179256 | Ga0466703_179256_643_1389 | 248 |
| 95 | 3300042643 | Ga0466704_384822 | Ga0466704_384822_528_1274 | 248 |
| 96 | 3300042643 | Ga0466704_560503 | Ga0466704_560503_4588_5334 | 248 |
| 97 | 3300056814 | Ga0562378_1346 | Ga0562378_1346_3176_3922 | 248 |
| 98 | 3300042582 | Ga0466657_199187 | Ga0466657_199187_4976_5725 | 249 |
| 99 | 3300042582 | Ga0466657_299572 | Ga0466657_299572_25122_25871 | 249 |
| 100 | 3300042593 | Ga0466691_044797 | Ga0466691_044797_2513_3262 | 249 |
| 101 | 3300042601 | Ga0466707_081949 | Ga0466707_081949_33818_34567 | 249 |
| 102 | 3300042612 | Ga0466705_302403 | Ga0466705_302403_128_877 | 249 |
| 103 | 3300042613 | Ga0466710_171687 | Ga0466710_171687_4126_4875 | 249 |
| 104 | iso_pr_bacteria | 2820047982 | 2820048349 | 249 |
| 105 | iso_pr_bacteria | 2891720358 | 2891720361 | 249 |
| 106 | 3300002462 | JGI24702J35022_10001333 | JGI24702J35022_100013333 | 250 |
| 107 | 3300042591 | Ga0466692_085714 | Ga0466692_085714_15240_15992 | 250 |
| 108 | 3300042615 | Ga0466711_118618 | Ga0466711_118618_2521_3273 | 250 |
| 109 | 3300042616 | Ga0466715_145360 | Ga0466715_145360_412_1164 | 250 |
| 110 | 3300042643 | Ga0466704_075054 | Ga0466704_075054_349_1101 | 250 |
| 111 | 3300042643 | Ga0466704_309416 | Ga0466704_309416_725_1477 | 250 |
| 112 | iso_pr_bacteria | 2990166910 | 2990171250 | 250 |
| 113 | iso_pr_bacteria | 3007473699 | 3007478653 | 250 |
| 114 | 3300042612 | Ga0466705_089676 | Ga0466705_089676_2746_3501 | 251 |
| 115 | 3300042621 | Ga0466729_226007 | Ga0466729_226007_11860_12615 | 251 |
| 116 | 3300042643 | Ga0466704_105577 | Ga0466704_105577_5586_6341 | 251 |
| 117 | 3300042655 | Ga0466727_278944 | Ga0466727_278944_2508_3263 | 251 |
| 118 | 3300042602 | Ga0466713_078211 | Ga0466713_078211_10722_11480 | 252 |
| 119 | 3300042609 | Ga0466722_039561 | Ga0466722_039561_267_1025 | 252 |
| 120 | 3300042590 | Ga0466690_260624 | Ga0466690_260624_11408_12169 | 253 |
| 121 | 3300042596 | Ga0466696_395754 | Ga0466696_395754_209_973 | 254 |
| 122 | 3300042636 | Ga0466703_286960 | Ga0466703_286960_104_868 | 254 |
| 123 | 3300042648 | Ga0466709_064763 | Ga0466709_064763_2139_2903 | 254 |
| 124 | iso_pr_bacteria | 2599185261 | 2599816195 | 254 |
| 125 | iso_pr_bacteria | 2820071837 | 2820071954 | 254 |
| 126 | 3300042611 | Ga0466697_110728 | Ga0466697_110728_123_890 | 255 |
| 127 | 3300042635 | Ga0466702_080214 | Ga0466702_080214_417_1184 | 255 |
| 128 | 3300012845 | Ga0160460_100573 | Ga0160460_10057315 | 257 |
| 129 | 3300042616 | Ga0466715_084290 | Ga0466715_084290_11992_12765 | 257 |
| 130 | 3300042654 | Ga0466725_006956 | Ga0466725_006956_15830_16603 | 257 |
| 131 | 3300042655 | Ga0466727_312739 | Ga0466727_312739_8145_8918 | 257 |
| 132 | 3300042612 | Ga0466705_352386 | Ga0466705_352386_37207_37983 | 258 |
| 133 | 3300042591 | Ga0466692_036701 | Ga0466692_036701_2156_2935 | 259 |
| 134 | 3300042609 | Ga0466722_054137 | Ga0466722_054137_5580_6359 | 259 |
| 135 | 3300042599 | Ga0466706_215191 | Ga0466706_215191_1549_2481 | 261 |
| 136 | 3300042636 | Ga0466703_167167 | Ga0466703_167167_3469_4254 | 261 |
| 137 | 3300042652 | Ga0466708_341105 | Ga0466708_341105_16120_16908 | 262 |
| 138 | iso_pr_bacteria | 2864755708 | 2864757701 | 263 |
| 139 | 3300012812 | Ga0160471_100052 | Ga0160471_10005299 | 264 |
| 140 | 3300012835 | Ga0160446_100714 | Ga0160446_1007147 | 264 |
| 141 | 3300042596 | Ga0466696_286577 | Ga0466696_286577_486_1280 | 264 |
| 142 | 3300042604 | Ga0466717_077495 | Ga0466717_077495_231_1025 | 264 |
| 143 | 3300042615 | Ga0466711_396178 | Ga0466711_396178_1345_2139 | 264 |
| 144 | iso_pr_bacteria | 2820065746 | 2820067772 | 264 |
| 145 | 3300042593 | Ga0466691_088302 | Ga0466691_088302_16625_17422 | 265 |
| 146 | 3300042606 | Ga0466719_284580 | Ga0466719_284580_2305_3108 | 267 |
| 147 | iso_pr_bacteria | 2834230000 | 2834230417 | 269 |
| 148 | 3300042604 | Ga0466717_150566 | Ga0466717_150566_4097_4912 | 271 |
| 149 | 3300042618 | Ga0466723_336722 | Ga0466723_336722_4930_5745 | 271 |
| 150 | iso_pr_bacteria | 2820062699 | 2820062711 | 271 |
| 151 | 3300002504 | JGI24705J35276_12223513 | JGI24705J35276_122235132 | 272 |
| 152 | 3300042616 | Ga0466715_111155 | Ga0466715_111155_10101_10919 | 272 |
| 153 | 3300042636 | Ga0466703_137408 | Ga0466703_137408_10368_11186 | 272 |
| 154 | iso_pr_bacteria | 8024031916 | 8024033157 | 272 |
| 155 | 3300042619 | Ga0466726_230706 | Ga0466726_230706_5741_6565 | 274 |
| 156 | 3300042605 | Ga0466716_193843 | Ga0466716_193843_3953_4780 | 275 |
| 157 | 3300042590 | Ga0466690_383350 | Ga0466690_383350_665_1495 | 276 |
| 158 | 3300042620 | Ga0466728_248439 | Ga0466728_248439_26207_27037 | 276 |
| 159 | 3300042652 | Ga0466708_045484 | Ga0466708_045484_8809_9639 | 276 |
| 160 | 3300042624 | Ga0466735_114449 | Ga0466735_114449_840_1766 | 277 |
| 161 | 3300042616 | Ga0466715_253110 | Ga0466715_253110_522_1364 | 280 |
| 162 | 3300042643 | Ga0466704_110726 | Ga0466704_110726_36343_37185 | 280 |
| 163 | 3300042606 | Ga0466719_561327 | Ga0466719_561327_51_905 | 284 |
| 164 | 3300042643 | Ga0466704_496140 | Ga0466704_496140_293_1153 | 286 |
| 165 | 3300042649 | Ga0466724_61568 | Ga0466724_61568_2413_3294 | 293 |
| 166 | iso_pr_bacteria | 2864870719 | 2864874651 | 296 |
| 167 | iso_pr_bacteria | 2864960361 | 2864964301 | 296 |
| 168 | 3300042612 | Ga0466705_315937 | Ga0466705_315937_1114_2010 | 298 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02578 | Cu-oxidase_4 | Multi-copper polyphenol oxidoreductase laccase | 26 | 247 | 0.94 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.82 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.