Protein Family IF07182

Metagenome Isolate
120 Members
52 Samples
107 Scaffolds
622.18 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_301679|Ga0466705_301679_5491_7596
Length
701 aa
Sequence
MQAFRVARQFGMYPAFQEQLLHTGFQYIKSGRQIDGNVDSSFSRIFPPVYVQFTKKSCTFVAQNKKNSNASSISDKNLYNFNNKKMPEETKAKLFSEFSPVSTEAWKEKIVADLKGADFEKKLIWKTNEGFNVHPFYRTDDIKDLKTTDSLPGEFPYVRGTANNNDWYVRQDIRVENFQASNKKALDILNKGINSLGFAVPAQDINAENIAVLLEGICPECVELNFETCSKSSVTLIKILVDYFKNKGLNPQSCQVSVNMDFVSPALTKGKDAETFLANIQEAVLLSKDFPFFRVLGVNAVLFSHAGSCITQELAYALAWGNELMNRLTGAGVDATLAAQKIKFNLGISSNYFMEIAKFRAARWLWAEIAKAYGASNEAAKMNIFAKTSSFNQTLYDAHVNLLRTQTEAMSAGMAGVDSLLVSPFDEAFKTPDDFSERIARNQQLLLKEESHFDKVVDPAGGSYYIETLTVSIAQQAWKIFLETEAEGFYKLVKSGEIQQAVNASANNRFKALSQRREVLLGTNQFPNFTETAAHKLQPETAACGCASEPAAITTLNTKRLSHAFESLRLTTEKSGKEVKAFMLTIGNLAMRLARAQFSSNFLACAGYKVIDNLGFETVAQGVDAARKVGADIIVLCSSDDEYATFAPEAHLLTGNREILIIAGAPACTDDLKALGINNFINVRSNVLETLQSFNEKLGIK

📊 Sample Types

Isolate 10.8%
Metagenome 89.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.7%
Kalotermitidae 25.0%
Unclassified 23.1%
Blattidae 5.8%
Rhinotermitidae 5.8%
Termopsidae 3.8%
Hodotermitidae 1.9%
Passalidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
10 2922326829 Bacteroides sp. 224 Isolate Blattidae
11 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
12 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
17 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
23 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
33 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
36 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
37 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
38 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
41 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
44 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
50 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
51 3004677695 Bacteroides sp. 214 Isolate Blattidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_339228 3300042612 Bacteria 2621
2 Ga0466700_214238 3300042600 Bacteria 27785
3 Ga0466713_092304 3300042602 Bacteria 15572
4 Ga0466714_111320 3300042603 Bacteria 185233
5 Ga0466716_134760 3300042605 Bacteria 10339
6 Ga0466722_240606 3300042609 Bacteria 2770
7 Ga0466698_251481 3300042610 Bacteria 2043
8 Ga0466735_008272 3300042624 Bacteria 10144
9 Ga0466703_176395 3300042636 Bacteria 15139
10 Ga0466696_357124 3300042596 Bacteria 23283
11 Ga0466715_013610 3300042616 Bacteria 25817
12 Ga0466728_161309 3300042620 Bacteria 32745
13 JGI24699J35502_11133980 3300002509 Bacteria 22458
14 Ga0466701_079535 3300042598 Bacteria 72629
15 Ga0466706_061104 3300042599 Bacteria 6902
16 Ga0466706_232099 3300042599 Bacteria 23051
17 Ga0466707_105492 3300042601 Bacteria 2327
18 Ga0466714_045948 3300042603 Bacteria 10759
19 Ga0466735_007964 3300042624 Bacteria 2704
20 Ga0466709_117840 3300042648 Bacteria 7447
21 Ga0466724_09281 3300042649 Bacteria 4615
22 Ga0466727_011394 3300042655 Bacteria 6594
23 Ga0466727_149398 3300042655 Bacteria 6796
24 Ga0123357_10036889 3300009784 Bacteria 6652
25 Ga0123356_10001217 3300010049 Bacteria 28613
26 Ga0123353_10000239 3300010167 Bacteria 69280
27 Ga0123354_10004213 3300010882 Bacteria 20291
28 Ga0466690_174976 3300042590 Bacteria 26076
29 Ga0466701_005833 3300042598 Bacteria 28890
30 Ga0466728_057961 3300042620 Bacteria 56835
31 Ga0466733_033923 3300042659 Bacteria 9673
32 Ga0466701_058831 3300042598 Bacteria 4625
33 Ga0466719_530861 3300042606 Bacteria 5784
34 Ga0466735_113967 3300042624 Bacteria 5985
35 Ga0466703_197865 3300042636 Bacteria 3509
36 Ga0123353_10000524 3300010167 Bacteria 47418
37 Ga0123353_10009879 3300010167 Bacteria 13232
38 Ga0466691_047932 3300042593 Bacteria 2737
39 Ga0466691_050888 3300042593 Bacteria 9526
40 Ga0466701_009900 3300042598 Bacteria 3089
41 Ga0466715_314686 3300042616 Bacteria 14830
42 Ga0466723_365550 3300042618 Bacteria 29929
43 Ga0466697_116925 3300042611 Bacteria 3496
44 Ga0466706_009495 3300042599 Bacteria 23049
45 Ga0466706_154785 3300042599 Bacteria 38589
46 Ga0466716_136184 3300042605 Bacteria 2288
47 Ga0466719_010983 3300042606 Bacteria 8883
48 Ga0466719_228375 3300042606 Bacteria 6027
49 Ga0466704_445354 3300042643 Bacteria 7423
50 Ga0466709_101202 3300042648 Bacteria 82104
51 Ga0466709_277595 3300042648 Bacteria 221236
52 Ga0466724_46801 3300042649 Bacteria 5083
53 Ga0466727_328921 3300042655 Bacteria 2814
54 Ga0123356_10034503 3300010049 Bacteria 4727
55 Ga0123353_10031036 3300010167 Bacteria 8269
56 Ga0123353_10231985 3300010167 Bacteria 2877
57 Ga0466715_105452 3300042616 Bacteria 35313
58 Ga0466715_195129 3300042616 Bacteria 15530
59 Ga0466715_428004 3300042616 Bacteria 2941
60 Ga0466723_095121 3300042618 Bacteria 177949
61 Ga0466729_015471 3300042621 Bacteria 5451
62 IMNBL1DRAFT_c0000158 3300000062 Bacteria 59947
63 IMNBL1DRAFT_c0008310 3300000062 Bacteria 5301
64 JGI24702J35022_10002562 3300002462 Bacteria 11048
65 Ga0466706_031164 3300042599 Bacteria 17266
66 Ga0466706_232171 3300042599 Bacteria 18954
67 Ga0466700_263863 3300042600 Bacteria 5774
68 Ga0466707_083535 3300042601 Bacteria 6753
69 Ga0466713_113907 3300042602 Bacteria 5457
70 Ga0466697_038342 3300042611 Unclassified 2513
71 Ga0466703_373012 3300042636 Bacteria 7623
72 Ga0466709_394155 3300042648 Bacteria 13544
73 Ga0123356_10017651 3300010049 Bacteria 6787
74 Ga0466657_175193 3300042582 Bacteria 4995
75 Ga0466690_359815 3300042590 Bacteria 2680
76 Ga0466728_087812 3300042620 Bacteria 65534
77 Ga0466728_308053 3300042620 Bacteria 16412
78 Ga0466728_399272 3300042620 Bacteria 209367
79 Ga0466705_301679 3300042612 Bacteria 30952
80 Ga0466706_268011 3300042599 Bacteria 8033
81 Ga0466722_118767 3300042609 Bacteria 13208
82 Ga0466729_279832 3300042621 Bacteria 5050
83 Ga0466704_045091 3300042643 Bacteria 3359
84 Ga0466708_021126 3300042652 Bacteria 7342
85 Ga0466696_403106 3300042596 Bacteria 5658
86 Ga0466718_117004 3300042617 Bacteria 8346
87 JGI24699J35502_11133889 3300002509 Bacteria 18309
88 Ga0068305_10016828 3300005083 Bacteria 22997
89 Ga0466706_090443 3300042599 Bacteria 10217
90 Ga0466706_095663 3300042599 Bacteria 79833
91 Ga0466716_064486 3300042605 Bacteria 8094
92 Ga0466704_233434 3300042643 Bacteria 3220
93 Ga0123356_10003573 3300010049 Bacteria 16250
94 Ga0123353_10208453 3300010167 Bacteria 3067
95 Ga0123354_10094886 3300010882 Bacteria 4087
96 Ga0466690_036440 3300042590 Bacteria 13174
97 Ga0466694_153599 3300042594 Bacteria 3072
98 Ga0466729_069874 3300042621 Bacteria 22633
99 JGI24695J34938_10003188 3300002450 Bacteria 11630
100 JGI24702J35022_10004562 3300002462 Bacteria 8216
101 JGI24702J35022_10007049 3300002462 Unclassified 6457
102 Ga0466701_063105 3300042598 Bacteria 8435
103 Ga0466704_110777 3300042643 Bacteria 23745
104 Ga0466709_413779 3300042648 Bacteria 9573
105 Ga0123353_10008600 3300010167 Bacteria 13966
106 Ga0466715_061999 3300042616 Bacteria 3325
107 Ga0466728_355716 3300042620 Bacteria 5142

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2609459943 2610743812 532
2 3300042617 Ga0466718_117004 Ga0466718_117004_24_1751 575
3 3300042603 Ga0466714_045948 Ga0466714_045948_1125_2858 577
4 3300042624 Ga0466735_008272 Ga0466735_008272_4991_6763 590
5 3300042618 Ga0466723_095121 Ga0466723_095121_41494_43401 601
6 3300042652 Ga0466708_021126 Ga0466708_021126_3638_5500 601
7 3300042616 Ga0466715_428004 Ga0466715_428004_794_2635 603
8 3300042596 Ga0466696_357124 Ga0466696_357124_775_2619 606
9 3300042598 Ga0466701_079535 Ga0466701_079535_35712_37553 607
10 3300042621 Ga0466729_279832 Ga0466729_279832_138_2051 608
11 3300042596 Ga0466696_403106 Ga0466696_403106_3064_4896 610
12 iso_pr_bacteria 2967483437 2967484598 610
13 3300042590 Ga0466690_359815 Ga0466690_359815_540_2396 613
14 3300042609 Ga0466722_118767 Ga0466722_118767_7746_9785 614
15 3300042616 Ga0466715_061999 Ga0466715_061999_1442_3286 614
16 3300042648 Ga0466709_101202 Ga0466709_101202_68100_69944 614
17 3300042620 Ga0466728_057961 Ga0466728_057961_9396_11243 615
18 3300042659 Ga0466733_033923 Ga0466733_033923_1919_3766 615
19 3300002509 JGI24699J35502_11133980 JGI24699J35502_1113398021 616
20 3300005083 Ga0068305_10016828 Ga0068305_1001682816 616
21 3300042599 Ga0466706_090443 Ga0466706_090443_2363_4318 616
22 3300042600 Ga0466700_214238 Ga0466700_214238_2151_4001 616
23 3300042606 Ga0466719_530861 Ga0466719_530861_974_2866 616
24 3300042643 Ga0466704_110777 Ga0466704_110777_17323_19173 616
25 3300042643 Ga0466704_445354 Ga0466704_445354_4589_6439 616
26 3300042598 Ga0466701_005833 Ga0466701_005833_4867_6720 617
27 3300042599 Ga0466706_154785 Ga0466706_154785_13662_15677 617
28 iso_pr_bacteria 2820783511 2820784462 617
29 3300000062 IMNBL1DRAFT_c0000158 IMNBL1DRAFT_000015847 618
30 3300010049 Ga0123356_10003573 Ga0123356_100035734 618
31 3300042598 Ga0466701_009900 Ga0466701_009900_522_2378 618
32 3300042598 Ga0466701_058831 Ga0466701_058831_2454_4310 618
33 3300042599 Ga0466706_031164 Ga0466706_031164_4376_6232 618
34 3300042603 Ga0466714_111320 Ga0466714_111320_27568_29424 618
35 iso_pr_bacteria 2820792843 2820793902 618
36 iso_pr_bacteria 2820795054 2820795657 618
37 3300010167 Ga0123353_10231985 Ga0123353_102319852 619
38 3300042582 Ga0466657_175193 Ga0466657_175193_2390_4249 619
39 3300042594 Ga0466694_153599 Ga0466694_153599_959_2818 619
40 3300042598 Ga0466701_063105 Ga0466701_063105_1767_3626 619
41 3300042611 Ga0466697_116925 Ga0466697_116925_1079_2938 619
42 3300042643 Ga0466704_045091 Ga0466704_045091_644_2503 619
43 3300042643 Ga0466704_233434 Ga0466704_233434_1278_3137 619
44 3300042649 Ga0466724_09281 Ga0466724_09281_2162_4021 619
45 iso_pr_bacteria 2820741847 2820744345 619
46 iso_pr_bacteria 3004677695 3004678128 619
47 3300010167 Ga0123353_10000239 Ga0123353_100002399 620
48 3300010167 Ga0123353_10000524 Ga0123353_100005246 620
49 3300010167 Ga0123353_10009879 Ga0123353_100098797 620
50 3300042593 Ga0466691_050888 Ga0466691_050888_3766_5652 620
51 3300042611 Ga0466697_038342 Ga0466697_038342_486_2348 620
52 iso_pr_bacteria 2820753519 2820754848 620
53 iso_pr_bacteria 2820755292 2820756848 620
54 3300002462 JGI24702J35022_10007049 JGI24702J35022_100070495 621
55 3300010049 Ga0123356_10001217 Ga0123356_100012178 621
56 3300010167 Ga0123353_10031036 Ga0123353_100310365 621
57 3300042599 Ga0466706_268011 Ga0466706_268011_5193_7079 621
58 iso_pr_bacteria 2820797595 2820798322 621
59 3300002450 JGI24695J34938_10003188 JGI24695J34938_100031882 622
60 3300010882 Ga0123354_10004213 Ga0123354_100042132 622
61 3300042599 Ga0466706_009495 Ga0466706_009495_16575_18443 622
62 3300042605 Ga0466716_136184 Ga0466716_136184_88_1956 622
63 3300042610 Ga0466698_251481 Ga0466698_251481_45_1913 622
64 3300042616 Ga0466715_013610 Ga0466715_013610_1127_2995 622
65 3300042624 Ga0466735_007964 Ga0466735_007964_442_2310 622
66 3300042636 Ga0466703_197865 Ga0466703_197865_879_2747 622
67 3300042648 Ga0466709_277595 Ga0466709_277595_73573_75441 622
68 3300042649 Ga0466724_46801 Ga0466724_46801_708_2576 622
69 3300010049 Ga0123356_10034503 Ga0123356_100345034 623
70 3300042593 Ga0466691_047932 Ga0466691_047932_582_2453 623
71 3300042620 Ga0466728_087812 Ga0466728_087812_19506_21377 623
72 3300042590 Ga0466690_174976 Ga0466690_174976_14310_16184 624
73 3300042620 Ga0466728_399272 Ga0466728_399272_62056_63933 625
74 3300042655 Ga0466727_328921 Ga0466727_328921_836_2755 625
75 3300010049 Ga0123356_10017651 Ga0123356_100176514 626
76 3300042599 Ga0466706_061104 Ga0466706_061104_2030_4045 626
77 3300042636 Ga0466703_373012 Ga0466703_373012_5051_6931 626
78 3300002509 JGI24699J35502_11133889 JGI24699J35502_111338891 627
79 3300042599 Ga0466706_232171 Ga0466706_232171_5052_7049 627
80 3300042606 Ga0466719_010983 Ga0466719_010983_848_2731 627
81 3300042618 Ga0466723_365550 Ga0466723_365550_5504_7387 627
82 3300042648 Ga0466709_394155 Ga0466709_394155_9614_11497 627
83 3300042602 Ga0466713_092304 Ga0466713_092304_3577_5463 628
84 3300042612 Ga0466705_339228 Ga0466705_339228_706_2592 628
85 3300042590 Ga0466690_036440 Ga0466690_036440_906_2795 629
86 3300042599 Ga0466706_095663 Ga0466706_095663_12700_14592 630
87 3300042599 Ga0466706_232099 Ga0466706_232099_7585_9477 630
88 3300042605 Ga0466716_134760 Ga0466716_134760_4478_6370 630
89 3300042636 Ga0466703_176395 Ga0466703_176395_10230_12122 630
90 iso_pr_bacteria 2910930387 2910931497 630
91 3300002462 JGI24702J35022_10002562 JGI24702J35022_100025626 631
92 3300009784 Ga0123357_10036889 Ga0123357_100368893 631
93 3300042609 Ga0466722_240606 Ga0466722_240606_522_2417 631
94 3300042616 Ga0466715_105452 Ga0466715_105452_16557_18452 631
95 3300042620 Ga0466728_161309 Ga0466728_161309_25307_27202 631
96 3300042620 Ga0466728_355716 Ga0466728_355716_346_2241 631
97 3300042655 Ga0466727_149398 Ga0466727_149398_1790_3685 631
98 iso_pr_bacteria 2922326829 2922326996 631
99 3300042602 Ga0466713_113907 Ga0466713_113907_1802_3700 632
100 3300042616 Ga0466715_195129 Ga0466715_195129_7081_8979 632
101 3300042621 Ga0466729_069874 Ga0466729_069874_4214_6112 632
102 iso_pr_bacteria 2830041218 2830041412 632
103 3300042601 Ga0466707_083535 Ga0466707_083535_525_2426 633
104 3300042648 Ga0466709_117840 Ga0466709_117840_4631_6532 633
105 3300000062 IMNBL1DRAFT_c0008310 IMNBL1DRAFT_00083102 634
106 3300002462 JGI24702J35022_10004562 JGI24702J35022_100045622 634
107 3300042600 Ga0466700_263863 Ga0466700_263863_3381_5324 634
108 3300042621 Ga0466729_015471 Ga0466729_015471_1959_3866 635
109 3300042624 Ga0466735_113967 Ga0466735_113967_1259_3166 635
110 3300042648 Ga0466709_413779 Ga0466709_413779_886_2793 635
111 3300010167 Ga0123353_10008600 Ga0123353_100086009 636
112 3300042605 Ga0466716_064486 Ga0466716_064486_3195_5105 636
113 3300042616 Ga0466715_314686 Ga0466715_314686_3254_5164 636
114 3300042601 Ga0466707_105492 Ga0466707_105492_370_2283 637
115 3300042655 Ga0466727_011394 Ga0466727_011394_2405_4321 638
116 3300010882 Ga0123354_10094886 Ga0123354_100948861 639
117 3300042606 Ga0466719_228375 Ga0466719_228375_3350_5272 640
118 3300010167 Ga0123353_10208453 Ga0123353_102084532 642
119 3300042620 Ga0466728_308053 Ga0466728_308053_7780_9732 650
120 3300042612 Ga0466705_301679 Ga0466705_301679_5491_7596 701

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01642 MM_CoA_mutase Methylmalonyl-CoA mutase 126 612 0.94

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
4req-assembly1.cif.gz_B Methylmalonyl-COA Mutase substrate complex 0.892 94 701
2req-assembly2.cif.gz_D METHYLMALONYL-COA MUTASE, NON-PRODUCTIVE COA COMPLEX, IN OPEN CONFORMATION REPRESENTING SUBSTRATE-FREE STATE 0.89 94 701
6oxd-assembly1.cif.gz_B Structure of Mycobacterium tuberculosis methylmalonyl-CoA mutase with adenosyl cobalamin 0.877 106 699
6oxc-assembly1.cif.gz_B Structure of Mycobacterium tuberculosis methylmalonyl-CoA mutase with adenosyl cobalamin 0.862 106 699
4r3u-assembly2.cif.gz_B Crystal structure of 2-Hydroxyisobutyryl-CoA Mutase 0.772 104 608
IDDescriptionScoreStartEndSuperfamily
af_P9WJK7_47_477_3.20.20.240 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Methylmalonyl-CoA mutase 0.899 126 566 3.20.20.240
1reqB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Methylmalonyl-CoA mutase 0.894 129 566 3.20.20.240
3reqB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.8409 571 700 3.40.50.280
4r3uB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Methylmalonyl-CoA mutase 0.7721 104 608 3.20.20.240
af_A4I2L1_6_566_3.20.20.240 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Methylmalonyl-CoA mutase 0.757 92 607 3.20.20.240
IDDescriptionScoreStartEndGO Terms
AF-A0A6H9PM40-F1-model_v4 Uncharacterized/unreviewed 0.9834 151 698

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.