Protein Family IF07169

Metagenome Isolate
139 Members
34 Samples
133 Scaffolds
549.42 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_271311|Ga0466705_271311_3935_5830
Length
631 aa
Sequence
VLKKGTAFFQLPQKIVNMALPGLPPGSGPPVSEKILITGLPATFRGEIGQNIDMRVMEAETLGELCLRAAAAYKKKRAFEIFRDGKVYDLVSYGEWGLRSRQFASLLGALGVKPGGRVMILAENCPEWPISYFGTALADAVSVPVLIDFSGEQIQNIAGHAEVSAICVTERTAPKCAGIDPAIPRIFIDTYEEAPLRVKKRGRSMDDIAESAEIRVSLGGTLRRLSLENRKSILPRREAGDLASIIYTSGTAGNSKGVMLSHRNLLFCAGASRKLMRIYPRDRLLSVIPLAHAYECTVGLLTAVMNGASITYLDKPPSPAVLLPAIQALRPTAMVTVPLFIEKIYRQKIAPALEASPLYRCPLTRPLALALAGRRLMAAFGGSIRFFGLGGAPLAADVEEFLRKVKFPYAPGYGLTETAPLLTGTAPYRFPGRSVGSVVPGVEIRIADGEIQARGPNVMMGYYRDEEGTREAFSPDGWLKTGDLGELDSRGRLYVRGRLKALILGPSGENIYPEEIEGLLNASGMVEDALVCPGEKGEIVALVVLNKKARAMINAAGEALEELKKKVNQQLASFSRLSRIEVKDEPFEKTPTHKIKRFLYGIQKPLDPKADPATGLPPGGSLFPGTSPGSA

📊 Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 41.2%
Unclassified 26.5%
Termitidae 20.6%
Rhinotermitidae 5.9%
Termopsidae 5.9%

🌳 Taxonomy

Archaea 0
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
10 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
11 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
26 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
30 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
31 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
32 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_095658 3300042612 Bacteria 3360
2 Ga0466711_162495 3300042615 Bacteria 17901
3 Ga0466723_014961 3300042618 Bacteria 2658
4 Ga0466723_097907 3300042618 Bacteria 21508
5 Ga0466723_129256 3300042618 Bacteria 14892
6 Ga0466723_130490 3300042618 Bacteria 37311
7 Ga0466723_134464 3300042618 Bacteria 3781
8 Ga0466723_184630 3300042618 Bacteria 5689
9 Ga0466728_103171 3300042620 Bacteria 16669
10 Ga0123353_10007431 3300010167 Bacteria 14798
11 Ga0466707_376956 3300042601 Bacteria 3287
12 Ga0466713_026171 3300042602 Bacteria 44886
13 Ga0466719_124486 3300042606 Bacteria 2355
14 Ga0466703_010769 3300042636 Bacteria 8615
15 Ga0466703_095988 3300042636 Bacteria 3386
16 Ga0466704_122002 3300042643 Bacteria 30457
17 Ga0466704_182687 3300042643 Bacteria 8732
18 Ga0466704_357597 3300042643 Bacteria 27543
19 Ga0466690_142920 3300042590 Bacteria 26948
20 Ga0466692_142303 3300042591 Bacteria 11124
21 Ga0466691_049012 3300042593 Bacteria 72676
22 Ga0123357_10000302 3300009784 Bacteria 47106
23 Ga0123357_10003171 3300009784 Bacteria 18712
24 Ga0466705_425681 3300042612 Bacteria 4534
25 Ga0466711_046351 3300042615 Bacteria 5291
26 Ga0466715_037413 3300042616 Bacteria 2680
27 Ga0466715_066323 3300042616 Bacteria 14582
28 Ga0466723_278246 3300042618 Unclassified 2405
29 Ga0466726_103367 3300042619 Bacteria 25672
30 Ga0466716_254268 3300042605 Bacteria 5400
31 Ga0466719_190072 3300042606 Bacteria 9720
32 Ga0466722_016171 3300042609 Bacteria 13736
33 Ga0466703_116782 3300042636 Bacteria 5169
34 Ga0466709_042965 3300042648 Bacteria 15358
35 Ga0466709_209552 3300042648 Bacteria 15383
36 Ga0466708_110091 3300042652 Bacteria 4004
37 Ga0466690_082983 3300042590 Bacteria 2424
38 Ga0466690_107045 3300042590 Bacteria 5122
39 Ga0466705_204513 3300042612 Bacteria 8817
40 Ga0466711_324170 3300042615 Bacteria 7971
41 Ga0466715_214932 3300042616 Bacteria 3896
42 Ga0466715_616341 3300042616 Bacteria 3355
43 Ga0466723_087129 3300042618 Bacteria 8950
44 Ga0466726_010703 3300042619 Bacteria 3049
45 Ga0466726_151322 3300042619 Bacteria 5060
46 Ga0466728_371819 3300042620 Bacteria 2066
47 Ga0466719_297251 3300042606 Bacteria 8240
48 Ga0466722_083961 3300042609 Unclassified 3492
49 Ga0466722_200946 3300042609 Bacteria 10626
50 Ga0466722_208058 3300042609 Bacteria 4041
51 Ga0466704_273989 3300042643 Bacteria 40108
52 Ga0466704_328878 3300042643 Bacteria 2343
53 Ga0466709_020639 3300042648 Bacteria 3352
54 Ga0466708_328999 3300042652 Bacteria 34433
55 Ga0466690_072701 3300042590 Bacteria 19918
56 Ga0466692_063115 3300042591 Bacteria 5393
57 Ga0466699_046280 3300042597 Bacteria 20535
58 JGI24702J35022_10007243 3300002462 Bacteria 6372
59 Ga0068305_10250197 3300005083 Bacteria 11124
60 Ga0466705_271311 3300042612 Bacteria 5873
61 Ga0466728_434293 3300042620 Bacteria 7001
62 Ga0466716_107515 3300042605 Unclassified 2374
63 Ga0466708_168156 3300042652 Bacteria 1953
64 Ga0466690_385057 3300042590 Bacteria 3404
65 Ga0466692_027843 3300042591 Bacteria 5851
66 Ga0466691_219584 3300042593 Bacteria 4361
67 Ga0466723_102905 3300042618 Bacteria 8977
68 Ga0466728_278655 3300042620 Bacteria 3789
69 Ga0123357_10038556 3300009784 Bacteria 6506
70 Ga0123353_10362507 3300010167 Bacteria 2177
71 Ga0466714_061799 3300042603 Bacteria 9766
72 Ga0466719_441410 3300042606 Bacteria 3012
73 Ga0466703_160805 3300042636 Bacteria 11268
74 Ga0466704_239917 3300042643 Bacteria 52442
75 Ga0466709_209965 3300042648 Bacteria 4612
76 Ga0466708_064700 3300042652 Bacteria 13699
77 Ga0466690_009541 3300042590 Bacteria 9709
78 Ga0466690_130140 3300042590 Bacteria 3536
79 Ga0466692_151505 3300042591 Bacteria 3486
80 Ga0466691_051419 3300042593 Bacteria 2994
81 Ga0466699_144593 3300042597 Bacteria 21273
82 Ga0466711_446304 3300042615 Bacteria 2174
83 Ga0466715_051153 3300042616 Bacteria 4706
84 Ga0466715_292908 3300042616 Bacteria 7908
85 Ga0466715_355084 3300042616 Bacteria 10122
86 Ga0466726_366783 3300042619 Bacteria 27666
87 Ga0466713_108833 3300042602 Bacteria 2156
88 Ga0466716_281805 3300042605 Bacteria 3817
89 Ga0466719_088550 3300042606 Bacteria 22253
90 Ga0466719_277160 3300042606 Bacteria 12540
91 Ga0466719_423689 3300042606 Bacteria 3299
92 Ga0466722_111930 3300042609 Bacteria 16207
93 Ga0466704_588500 3300042643 Bacteria 2694
94 Ga0466727_063480 3300042655 Bacteria 8765
95 Ga0466691_049216 3300042593 Bacteria 5857
96 Ga0466691_167865 3300042593 Bacteria 14514
97 Ga0466694_070882 3300042594 Bacteria 6176
98 Ga0466696_485444 3300042596 Bacteria 2034
99 Ga0466705_260067 3300042612 Bacteria 32862
100 Ga0466705_301165 3300042612 Bacteria 2670
101 Ga0466715_118861 3300042616 Bacteria 20979
102 Ga0466726_034522 3300042619 Bacteria 6769
103 Ga0466726_334055 3300042619 Bacteria 3785
104 Ga0466707_243324 3300042601 Bacteria 3176
105 Ga0466722_153465 3300042609 Bacteria 12546
106 Ga0466703_127538 3300042636 Bacteria 5442
107 Ga0466704_243546 3300042643 Bacteria 2372
108 Ga0466709_376046 3300042648 Bacteria 4151
109 Ga0466708_143885 3300042652 Bacteria 3141
110 Ga0466691_149240 3300042593 Bacteria 9541
111 Ga0466696_009889 3300042596 Bacteria 3852
112 Ga0466696_026532 3300042596 Bacteria 30218
113 Ga0466696_036398 3300042596 Bacteria 21968
114 Ga0466696_084141 3300042596 Bacteria 13334
115 Ga0466696_181188 3300042596 Bacteria 26938
116 Ga0466705_097602 3300042612 Bacteria 4995
117 Ga0466705_110406 3300042612 Bacteria 13237
118 Ga0466705_288417 3300042612 Bacteria 14872
119 Ga0466712_081403 3300042614 Bacteria 5468
120 Ga0466715_023475 3300042616 Bacteria 4972
121 Ga0466715_318882 3300042616 Bacteria 2832
122 Ga0466723_207114 3300042618 Bacteria 2660
123 Ga0123357_10216647 3300009784 Bacteria 2136
124 Ga0466707_028708 3300042601 Bacteria 2651
125 Ga0466707_256611 3300042601 Bacteria 1802
126 Ga0466716_232051 3300042605 Bacteria 3466
127 Ga0466722_230751 3300042609 Bacteria 2557
128 Ga0466703_011058 3300042636 Bacteria 10546
129 Ga0466703_116450 3300042636 Bacteria 8401
130 Ga0466703_155935 3300042636 Bacteria 32957
131 Ga0466704_117890 3300042643 Bacteria 8548
132 Ga0466727_297500 3300042655 Bacteria 2815
133 JGI24702J35022_10003945 3300002462 Bacteria 8915

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_243546 Ga0466704_243546_905_2356 483
2 3300042615 Ga0466711_324170 Ga0466711_324170_283_1887 499
3 3300042596 Ga0466696_485444 Ga0466696_485444_334_1869 511
4 3300042619 Ga0466726_034522 Ga0466726_034522_464_2083 516
5 3300042591 Ga0466692_151505 Ga0466692_151505_1360_2952 519
6 3300042596 Ga0466696_026532 Ga0466696_026532_28494_30098 520
7 3300042612 Ga0466705_425681 Ga0466705_425681_1127_2773 520
8 3300042605 Ga0466716_281805 Ga0466716_281805_1187_2755 522
9 3300042603 Ga0466714_061799 Ga0466714_061799_7565_9172 523
10 3300042616 Ga0466715_118861 Ga0466715_118861_6694_8265 523
11 3300042618 Ga0466723_184630 Ga0466723_184630_307_1878 523
12 3300042655 Ga0466727_297500 Ga0466727_297500_188_1759 523
13 3300042601 Ga0466707_243324 Ga0466707_243324_573_2168 524
14 3300010167 Ga0123353_10007431 Ga0123353_1000743111 525
15 3300042596 Ga0466696_084141 Ga0466696_084141_10992_12632 525
16 3300042618 Ga0466723_207114 Ga0466723_207114_244_1821 525
17 3300042619 Ga0466726_334055 Ga0466726_334055_909_2486 525
18 3300042636 Ga0466703_010769 Ga0466703_010769_2105_3724 525
19 3300009784 Ga0123357_10000302 Ga0123357_1000030210 526
20 3300042601 Ga0466707_028708 Ga0466707_028708_382_1962 526
21 3300042606 Ga0466719_277160 Ga0466719_277160_1193_2773 526
22 iso_pr_bacteria 650716099 650879960 526
23 3300042616 Ga0466715_292908 Ga0466715_292908_3288_4871 527
24 iso_pr_bacteria 2781125697 2781442925 527
25 3300002462 JGI24702J35022_10007243 JGI24702J35022_100072433 528
26 3300010167 Ga0123353_10362507 Ga0123353_103625072 528
27 3300042606 Ga0466719_441410 Ga0466719_441410_1086_2672 528
28 3300042616 Ga0466715_355084 Ga0466715_355084_651_2237 528
29 3300042636 Ga0466703_095988 Ga0466703_095988_944_2530 528
30 3300042643 Ga0466704_122002 Ga0466704_122002_9027_10613 528
31 iso_pr_bacteria 2781125632 2781270245 528
32 3300009784 Ga0123357_10003171 Ga0123357_1000317116 529
33 3300009784 Ga0123357_10216647 Ga0123357_102166471 529
34 3300042648 Ga0466709_209965 Ga0466709_209965_2918_4546 529
35 3300042601 Ga0466707_256611 Ga0466707_256611_50_1645 531
36 3300042597 Ga0466699_144593 Ga0466699_144593_6267_7865 532
37 3300002462 JGI24702J35022_10003945 JGI24702J35022_100039459 534
38 3300042597 Ga0466699_046280 Ga0466699_046280_18451_20055 534
39 3300042606 Ga0466719_423689 Ga0466719_423689_1163_2872 534
40 3300042596 Ga0466696_181188 Ga0466696_181188_23942_25570 535
41 3300042652 Ga0466708_064700 Ga0466708_064700_5328_7013 536
42 iso_pr_bacteria 2781125666 2781343921 536
43 3300042601 Ga0466707_376956 Ga0466707_376956_739_2352 537
44 3300042614 Ga0466712_081403 Ga0466712_081403_698_2311 537
45 3300042616 Ga0466715_318882 Ga0466715_318882_512_2212 538
46 3300009784 Ga0123357_10038556 Ga0123357_100385566 539
47 3300042593 Ga0466691_167865 Ga0466691_167865_10244_11863 539
48 3300042643 Ga0466704_239917 Ga0466704_239917_19717_21336 539
49 3300042652 Ga0466708_143885 Ga0466708_143885_1172_2791 539
50 3300042648 Ga0466709_209552 Ga0466709_209552_13591_15213 540
51 3300042655 Ga0466727_063480 Ga0466727_063480_5494_7116 540
52 3300042619 Ga0466726_151322 Ga0466726_151322_366_1991 541
53 3300042591 Ga0466692_142303 Ga0466692_142303_5122_6843 543
54 3300042615 Ga0466711_046351 Ga0466711_046351_369_2000 543
55 3300042643 Ga0466704_182687 Ga0466704_182687_6813_8489 543
56 3300042606 Ga0466719_297251 Ga0466719_297251_3391_5067 544
57 3300042609 Ga0466722_111930 Ga0466722_111930_488_2158 544
58 3300042590 Ga0466690_107045 Ga0466690_107045_1783_3420 545
59 3300042606 Ga0466719_190072 Ga0466719_190072_5353_6990 545
60 3300042636 Ga0466703_155935 Ga0466703_155935_4559_6199 546
61 3300042643 Ga0466704_328878 Ga0466704_328878_640_2307 546
62 3300042612 Ga0466705_301165 Ga0466705_301165_496_2139 547
63 3300042636 Ga0466703_127538 Ga0466703_127538_3706_5352 548
64 3300042643 Ga0466704_357597 Ga0466704_357597_25409_27097 548
65 3300042643 Ga0466704_588500 Ga0466704_588500_662_2308 548
66 3300042609 Ga0466722_153465 Ga0466722_153465_7804_9498 549
67 3300042618 Ga0466723_102905 Ga0466723_102905_7018_8667 549
68 3300042591 Ga0466692_063115 Ga0466692_063115_990_2642 550
69 3300042648 Ga0466709_376046 Ga0466709_376046_2197_3849 550
70 3300042591 Ga0466692_027843 Ga0466692_027843_709_2364 551
71 3300042594 Ga0466694_070882 Ga0466694_070882_258_1913 551
72 iso_pr_bacteria 2781125693 2781434406 551
73 3300042590 Ga0466690_072701 Ga0466690_072701_284_1942 552
74 3300042596 Ga0466696_036398 Ga0466696_036398_10213_11871 552
75 3300042609 Ga0466722_016171 Ga0466722_016171_10776_12434 552
76 3300042615 Ga0466711_446304 Ga0466711_446304_490_2148 552
77 3300042620 Ga0466728_434293 Ga0466728_434293_910_2568 552
78 iso_pr_bacteria 2819990093 2819991513 552
79 3300042602 Ga0466713_026171 Ga0466713_026171_31106_32767 553
80 3300042609 Ga0466722_208058 Ga0466722_208058_278_1939 553
81 3300042612 Ga0466705_260067 Ga0466705_260067_20021_21682 553
82 3300042618 Ga0466723_130490 Ga0466723_130490_31282_32943 553
83 3300042636 Ga0466703_160805 Ga0466703_160805_8922_10583 553
84 3300042590 Ga0466690_385057 Ga0466690_385057_82_1746 554
85 3300042593 Ga0466691_149240 Ga0466691_149240_1204_2868 554
86 3300042612 Ga0466705_110406 Ga0466705_110406_6247_7911 554
87 3300042648 Ga0466709_042965 Ga0466709_042965_6901_8565 554
88 3300042616 Ga0466715_616341 Ga0466715_616341_92_1759 555
89 3300042636 Ga0466703_116450 Ga0466703_116450_1312_2979 555
90 3300042616 Ga0466715_051153 Ga0466715_051153_926_2596 556
91 3300042616 Ga0466715_214932 Ga0466715_214932_1797_3467 556
92 3300042619 Ga0466726_010703 Ga0466726_010703_429_2099 556
93 3300042620 Ga0466728_371819 Ga0466728_371819_130_1800 556
94 3300042609 Ga0466722_200946 Ga0466722_200946_6684_8357 557
95 3300042648 Ga0466709_020639 Ga0466709_020639_358_2031 557
96 3300042652 Ga0466708_168156 Ga0466708_168156_30_1703 557
97 3300042606 Ga0466719_088550 Ga0466719_088550_5320_6996 558
98 3300042609 Ga0466722_083961 Ga0466722_083961_1523_3223 559
99 3300042612 Ga0466705_097602 Ga0466705_097602_603_2282 559
100 3300042618 Ga0466723_014961 Ga0466723_014961_241_1920 559
101 3300042612 Ga0466705_204513 Ga0466705_204513_5259_7016 560
102 3300042636 Ga0466703_116782 Ga0466703_116782_210_1895 561
103 3300042593 Ga0466691_049216 Ga0466691_049216_3647_5335 562
104 3300042616 Ga0466715_037413 Ga0466715_037413_216_1904 562
105 3300042602 Ga0466713_108833 Ga0466713_108833_163_1857 564
106 3300042612 Ga0466705_095658 Ga0466705_095658_1393_3087 564
107 3300042618 Ga0466723_134464 Ga0466723_134464_935_2653 564
108 3300042612 Ga0466705_288417 Ga0466705_288417_7009_8706 565
109 3300042643 Ga0466704_273989 Ga0466704_273989_27502_29199 565
110 3300042616 Ga0466715_023475 Ga0466715_023475_2366_4120 566
111 3300042619 Ga0466726_103367 Ga0466726_103367_3582_5285 567
112 3300042593 Ga0466691_051419 Ga0466691_051419_151_1857 568
113 3300042605 Ga0466716_232051 Ga0466716_232051_152_1867 571
114 3300042615 Ga0466711_162495 Ga0466711_162495_3848_5566 572
115 3300042636 Ga0466703_011058 Ga0466703_011058_1271_2992 573
116 3300042643 Ga0466704_117890 Ga0466704_117890_2595_4316 573
117 3300042590 Ga0466690_082983 Ga0466690_082983_519_2318 574
118 3300042590 Ga0466690_142920 Ga0466690_142920_19768_21492 574
119 3300042593 Ga0466691_049012 Ga0466691_049012_64438_66162 574
120 3300042605 Ga0466716_254268 Ga0466716_254268_2882_4606 574
121 3300042618 Ga0466723_097907 Ga0466723_097907_10633_12357 574
122 3300042620 Ga0466728_278655 Ga0466728_278655_816_2540 574
123 3300042616 Ga0466715_066323 Ga0466715_066323_8303_10030 575
124 3300042652 Ga0466708_110091 Ga0466708_110091_2216_3943 575
125 3300042596 Ga0466696_009889 Ga0466696_009889_998_2728 576
126 3300042652 Ga0466708_328999 Ga0466708_328999_13876_15618 580
127 3300042590 Ga0466690_130140 Ga0466690_130140_1265_3028 581
128 3300042618 Ga0466723_129256 Ga0466723_129256_8890_10659 581
129 3300042618 Ga0466723_278246 Ga0466723_278246_492_2237 581
130 3300042605 Ga0466716_107515 Ga0466716_107515_284_2035 583
131 3300042609 Ga0466722_230751 Ga0466722_230751_728_2479 583
132 3300042618 Ga0466723_087129 Ga0466723_087129_1687_3516 583
133 3300042619 Ga0466726_366783 Ga0466726_366783_3818_5581 587
134 3300042620 Ga0466728_103171 Ga0466728_103171_6135_7898 587
135 3300005083 Ga0068305_10250197 Ga0068305_102501971 588
136 3300042606 Ga0466719_124486 Ga0466719_124486_177_1943 588
137 3300042590 Ga0466690_009541 Ga0466690_009541_7609_9378 589
138 3300042593 Ga0466691_219584 Ga0466691_219584_1742_3526 594
139 3300042612 Ga0466705_271311 Ga0466705_271311_3935_5830 631

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF23562 507 597 0.84
PF00501 AMP-binding AMP-binding enzyme 68 463 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.