Protein Family IF07155
Metagenome
Isolate
139
Members
49
Samples
133
Scaffolds
339.42
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_241648|Ga0466705_241648_87_1184
- Length
- 365 aa
- Sequence
- MARKRFNALAGSKVFSALVVLALLLLFNLFFTPNFFYISIMDGHLFGTLIDILKRGSSLALLSLGMTLVIASTGGADLSVGAVIAITGAMVARLIGGQLVIVDGVQTYISQTPMALAIAASLLLALAFGAWNGFLVAYAKIQPIVATLVLMVAGRGIAQLITDGQIITIYYKPFHFIGYDGYVLGLPFPVYMALAVFIIALFLTKKTSLGLFTAAVGGNAPASWYAGINEKAVKMFCFMFCAFCAGVAGLIVCSNIKASDANNAGLNMELDAILAAVIGGTNMAGGKFSLAGGVVGALLIQTLTTTIYSFGVPPEVSLVVKALVVVLVCFLQSSVAANFFLRLSGRPGGRLNAGTAAGPEKGNAA
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.8%
Kalotermitidae
30.4%
Culicidae
10.9%
Unclassified
8.7%
Termopsidae
6.5%
Rhinotermitidae
4.3%
Pyralidae
2.2%
Armadillidiidae
2.2%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 19 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 26 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 27 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 28 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 29 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 30 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 31 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 34 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 35 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 36 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 37 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 38 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 43 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 46 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_040997 | 3300042612 | Bacteria | 13230 |
| 2 | Ga0466705_085384 | 3300042612 | Bacteria | 17021 |
| 3 | Ga0466705_220302 | 3300042612 | Bacteria | 27223 |
| 4 | Ga0160440_100038 | 3300012815 | Bacteria | 193167 |
| 5 | Ga0466715_243935 | 3300042616 | Bacteria | 2271 |
| 6 | Ga0466723_154426 | 3300042618 | Bacteria | 9026 |
| 7 | Ga0466723_288614 | 3300042618 | Bacteria | 4422 |
| 8 | Ga0466734_029291 | 3300042623 | Bacteria | 1242 |
| 9 | Ga0466703_039474 | 3300042636 | Bacteria | 10760 |
| 10 | Ga0466703_395122 | 3300042636 | Bacteria | 51270 |
| 11 | Ga0466727_020974 | 3300042655 | Bacteria | 4995 |
| 12 | Ga0466719_070471 | 3300042606 | Bacteria | 7434 |
| 13 | Ga0466722_005029 | 3300042609 | Bacteria | 14605 |
| 14 | Ga0466722_065943 | 3300042609 | Bacteria | 8176 |
| 15 | JGI24698J34947_10001487 | 3300002449 | Bacteria | 12382 |
| 16 | Ga0466705_209273 | 3300042612 | Bacteria | 3486 |
| 17 | Ga0466732_094432 | 3300042656 | Bacteria | 3267 |
| 18 | Ga0160446_100041 | 3300012835 | Bacteria | 137551 |
| 19 | Ga0160447_100565 | 3300012849 | Bacteria | 16917 |
| 20 | Ga0264413_142011 | 3300024493 | Bacteria | 5837 |
| 21 | Ga0466690_156573 | 3300042590 | Bacteria | 1168 |
| 22 | Ga0466692_046749 | 3300042591 | Bacteria | 3016 |
| 23 | Ga0466691_135210 | 3300042593 | Bacteria | 5429 |
| 24 | Ga0466711_340743 | 3300042615 | Bacteria | 3188 |
| 25 | Ga0466715_014820 | 3300042616 | Bacteria | 13320 |
| 26 | Ga0466715_030350 | 3300042616 | Unclassified | 2871 |
| 27 | Ga0466723_069244 | 3300042618 | Bacteria | 6607 |
| 28 | Ga0466703_159202 | 3300042636 | Bacteria | 5175 |
| 29 | Ga0466703_239980 | 3300042636 | Bacteria | 1191 |
| 30 | Ga0466709_319638 | 3300042648 | Bacteria | 2901 |
| 31 | Ga0466708_091453 | 3300042652 | Bacteria | 19162 |
| 32 | Ga0466708_143672 | 3300042652 | Bacteria | 6923 |
| 33 | Ga0466708_366091 | 3300042652 | Bacteria | 4123 |
| 34 | Ga0466727_280290 | 3300042655 | Bacteria | 2200 |
| 35 | Ga0466727_327788 | 3300042655 | Bacteria | 14506 |
| 36 | Ga0466698_079971 | 3300042610 | Bacteria | 1616 |
| 37 | Ga0466698_323495 | 3300042610 | Bacteria | 2041 |
| 38 | Ga0466698_480915 | 3300042610 | Bacteria | 1424 |
| 39 | JGI24705J35276_12221601 | 3300002504 | Bacteria | 2354 |
| 40 | Ga0466705_241648 | 3300042612 | Bacteria | 2770 |
| 41 | Ga0466692_085853 | 3300042591 | Bacteria | 2949 |
| 42 | Ga0466694_409411 | 3300042594 | Bacteria | 5854 |
| 43 | Ga0466712_149605 | 3300042614 | Unclassified | 2882 |
| 44 | Ga0466711_227077 | 3300042615 | Bacteria | 1513 |
| 45 | Ga0466711_307368 | 3300042615 | Bacteria | 6590 |
| 46 | Ga0466704_123618 | 3300042643 | Bacteria | 1392 |
| 47 | Ga0466727_171548 | 3300042655 | Bacteria | 1285 |
| 48 | Ga0466707_219319 | 3300042601 | Bacteria | 1136 |
| 49 | Ga0466722_096496 | 3300042609 | Bacteria | 15946 |
| 50 | Ga0466694_024675 | 3300042594 | Bacteria | 11048 |
| 51 | Ga0466696_068897 | 3300042596 | Bacteria | 7149 |
| 52 | Ga0466696_273069 | 3300042596 | Bacteria | 1254 |
| 53 | Ga0466715_295462 | 3300042616 | Bacteria | 17252 |
| 54 | Ga0466715_570578 | 3300042616 | Bacteria | 32007 |
| 55 | Ga0466723_009273 | 3300042618 | Bacteria | 1765 |
| 56 | Ga0466735_170895 | 3300042624 | Bacteria | 5759 |
| 57 | Ga0466708_058438 | 3300042652 | Bacteria | 6792 |
| 58 | Ga0466707_079192 | 3300042601 | Bacteria | 6947 |
| 59 | Ga0466716_382805 | 3300042605 | Bacteria | 32182 |
| 60 | Ga0466719_104296 | 3300042606 | Bacteria | 6900 |
| 61 | Ga0466698_321113 | 3300042610 | Bacteria | 1389 |
| 62 | Ga0466691_227589 | 3300042593 | Bacteria | 4424 |
| 63 | Ga0466696_107302 | 3300042596 | Bacteria | 4916 |
| 64 | Ga0466711_106112 | 3300042615 | Bacteria | 4516 |
| 65 | Ga0466715_164960 | 3300042616 | Bacteria | 4360 |
| 66 | Ga0466726_006628 | 3300042619 | Bacteria | 5070 |
| 67 | Ga0466726_372167 | 3300042619 | Bacteria | 3972 |
| 68 | Ga0466728_271542 | 3300042620 | Bacteria | 13311 |
| 69 | Ga0123356_10140568 | 3300010049 | Bacteria | 2381 |
| 70 | Ga0466704_070955 | 3300042643 | Bacteria | 29865 |
| 71 | Ga0466708_330736 | 3300042652 | Bacteria | 1512 |
| 72 | Ga0466719_303715 | 3300042606 | Bacteria | 6462 |
| 73 | Ga0466719_543635 | 3300042606 | Bacteria | 9165 |
| 74 | Ga0466719_560412 | 3300042606 | Bacteria | 6733 |
| 75 | Ga0466705_100435 | 3300042612 | Bacteria | 10309 |
| 76 | Ga0160456_100681 | 3300012820 | Bacteria | 9710 |
| 77 | Ga0160458_100424 | 3300012832 | Bacteria | 19123 |
| 78 | Ga0466690_129063 | 3300042590 | Bacteria | 9562 |
| 79 | Ga0466692_010776 | 3300042591 | Bacteria | 12720 |
| 80 | Ga0466691_160533 | 3300042593 | Bacteria | 5815 |
| 81 | Ga0466691_202613 | 3300042593 | Bacteria | 20551 |
| 82 | Ga0466715_281100 | 3300042616 | Unclassified | 2785 |
| 83 | Ga0466723_001375 | 3300042618 | Bacteria | 10990 |
| 84 | Ga0466728_330544 | 3300042620 | Bacteria | 3153 |
| 85 | Ga0123353_10192648 | 3300010167 | Bacteria | 3216 |
| 86 | Ga0466735_023401 | 3300042624 | Bacteria | 6364 |
| 87 | Ga0466703_038438 | 3300042636 | Bacteria | 1222 |
| 88 | Ga0466704_242298 | 3300042643 | Unclassified | 5407 |
| 89 | Ga0466704_305168 | 3300042643 | Bacteria | 1466 |
| 90 | Ga0466708_088014 | 3300042652 | Bacteria | 4744 |
| 91 | Ga0466727_031017 | 3300042655 | Bacteria | 3504 |
| 92 | Ga0466713_003161 | 3300042602 | Bacteria | 4492 |
| 93 | Ga0466722_061926 | 3300042609 | Bacteria | 9315 |
| 94 | Ga0466722_254077 | 3300042609 | Bacteria | 10579 |
| 95 | JGI24698J34947_10006047 | 3300002449 | Bacteria | 6647 |
| 96 | Ga0074263_115597 | 3300005485 | Bacteria | 1355 |
| 97 | Ga0160448_100598 | 3300012854 | Bacteria | 12152 |
| 98 | Ga0160436_1002567 | 3300012861 | Unclassified | 4582 |
| 99 | Ga0466690_321455 | 3300042590 | Bacteria | 6095 |
| 100 | Ga0466692_078488 | 3300042591 | Bacteria | 8446 |
| 101 | Ga0466693_202006 | 3300042592 | Bacteria | 2119 |
| 102 | Ga0466691_086411 | 3300042593 | Bacteria | 6710 |
| 103 | Ga0466712_157010 | 3300042614 | Unclassified | 1744 |
| 104 | Ga0466711_034417 | 3300042615 | Bacteria | 22769 |
| 105 | Ga0466711_045935 | 3300042615 | Bacteria | 4835 |
| 106 | Ga0466715_278870 | 3300042616 | Bacteria | 11269 |
| 107 | Ga0466726_404798 | 3300042619 | Bacteria | 1361 |
| 108 | Ga0466728_291681 | 3300042620 | Bacteria | 7742 |
| 109 | Ga0466704_507641 | 3300042643 | Bacteria | 9011 |
| 110 | Ga0466708_113769 | 3300042652 | Bacteria | 1645 |
| 111 | Ga0466708_386368 | 3300042652 | Bacteria | 48842 |
| 112 | Ga0466727_232501 | 3300042655 | Bacteria | 1541 |
| 113 | Ga0466719_023068 | 3300042606 | Bacteria | 2387 |
| 114 | Ga0466722_058035 | 3300042609 | Bacteria | 1337 |
| 115 | Ga0466722_257360 | 3300042609 | Bacteria | 3645 |
| 116 | Ga0466698_012628 | 3300042610 | Bacteria | 2111 |
| 117 | Ga0068305_10095985 | 3300005083 | Bacteria | 3710 |
| 118 | Ga0466705_117984 | 3300042612 | Bacteria | 2249 |
| 119 | Ga0160432_102726 | 3300012818 | Bacteria | 3366 |
| 120 | Ga0466694_140518 | 3300042594 | Bacteria | 1124 |
| 121 | Ga0466696_473017 | 3300042596 | Bacteria | 1373 |
| 122 | Ga0466711_069028 | 3300042615 | Bacteria | 1561 |
| 123 | Ga0466715_294266 | 3300042616 | Bacteria | 2245 |
| 124 | Ga0466715_527255 | 3300042616 | Bacteria | 14696 |
| 125 | Ga0466723_084743 | 3300042618 | Bacteria | 3620 |
| 126 | Ga0123353_10035919 | 3300010167 | Bacteria | 7758 |
| 127 | Ga0466709_012184 | 3300042648 | Bacteria | 20533 |
| 128 | Ga0466709_374692 | 3300042648 | Unclassified | 5941 |
| 129 | Ga0466719_280632 | 3300042606 | Bacteria | 4102 |
| 130 | Ga0466722_128735 | 3300042609 | Bacteria | 7449 |
| 131 | Ga0466722_205805 | 3300042609 | Bacteria | 16202 |
| 132 | JGI24695J34938_10021334 | 3300002450 | Bacteria | 3170 |
| 133 | Ga0072940_1084455 | 3300005200 | Bacteria | 2720 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042615 | Ga0466711_227077 | Ga0466711_227077_448_1473 | 285 |
| 2 | 3300042636 | Ga0466703_239980 | Ga0466703_239980_21_905 | 294 |
| 3 | 3300042596 | Ga0466696_273069 | Ga0466696_273069_323_1213 | 296 |
| 4 | 3300042590 | Ga0466690_156573 | Ga0466690_156573_43_1008 | 302 |
| 5 | 3300042624 | Ga0466735_170895 | Ga0466735_170895_1489_2508 | 303 |
| 6 | 3300042648 | Ga0466709_374692 | Ga0466709_374692_3613_4710 | 307 |
| 7 | 3300042619 | Ga0466726_372167 | Ga0466726_372167_3022_3948 | 308 |
| 8 | 3300042648 | Ga0466709_012184 | Ga0466709_012184_7582_8673 | 308 |
| 9 | 3300042652 | Ga0466708_113769 | Ga0466708_113769_632_1609 | 308 |
| 10 | 3300042593 | Ga0466691_160533 | Ga0466691_160533_3012_4064 | 309 |
| 11 | 3300042610 | Ga0466698_321113 | Ga0466698_321113_445_1377 | 310 |
| 12 | 3300042614 | Ga0466712_149605 | Ga0466712_149605_463_1560 | 311 |
| 13 | 3300042616 | Ga0466715_281100 | Ga0466715_281100_355_1440 | 311 |
| 14 | 3300042652 | Ga0466708_330736 | Ga0466708_330736_293_1384 | 311 |
| 15 | 3300010049 | Ga0123356_10140568 | Ga0123356_101405682 | 314 |
| 16 | 3300042591 | Ga0466692_010776 | Ga0466692_010776_4642_5694 | 315 |
| 17 | 3300042612 | Ga0466705_117984 | Ga0466705_117984_1266_2216 | 316 |
| 18 | 3300042615 | Ga0466711_340743 | Ga0466711_340743_812_1864 | 319 |
| 19 | 3300042620 | Ga0466728_291681 | Ga0466728_291681_1027_2079 | 319 |
| 20 | 3300042618 | Ga0466723_154426 | Ga0466723_154426_6428_7513 | 323 |
| 21 | 3300002450 | JGI24695J34938_10021334 | JGI24695J34938_100213342 | 326 |
| 22 | 3300042619 | Ga0466726_404798 | Ga0466726_404798_209_1291 | 326 |
| 23 | 3300042643 | Ga0466704_507641 | Ga0466704_507641_3112_4164 | 326 |
| 24 | 3300042593 | Ga0466691_202613 | Ga0466691_202613_1179_2231 | 327 |
| 25 | 3300042616 | Ga0466715_570578 | Ga0466715_570578_8424_9476 | 327 |
| 26 | 3300042655 | Ga0466727_327788 | Ga0466727_327788_3281_4357 | 329 |
| 27 | 3300042616 | Ga0466715_030350 | Ga0466715_030350_1317_2402 | 330 |
| 28 | 3300012835 | Ga0160446_100041 | Ga0160446_10004172 | 331 |
| 29 | 3300042643 | Ga0466704_242298 | Ga0466704_242298_1117_2211 | 331 |
| 30 | 3300042616 | Ga0466715_164960 | Ga0466715_164960_951_2006 | 332 |
| 31 | 3300042616 | Ga0466715_278870 | Ga0466715_278870_1772_2830 | 332 |
| 32 | 3300042652 | Ga0466708_143672 | Ga0466708_143672_5168_6247 | 332 |
| 33 | 3300042594 | Ga0466694_024675 | Ga0466694_024675_4105_5154 | 333 |
| 34 | 3300042615 | Ga0466711_045935 | Ga0466711_045935_1347_2417 | 333 |
| 35 | 3300012854 | Ga0160448_100598 | Ga0160448_1005988 | 335 |
| 36 | 3300042606 | Ga0466719_070471 | Ga0466719_070471_1845_2909 | 335 |
| 37 | 3300042609 | Ga0466722_065943 | Ga0466722_065943_4390_5442 | 335 |
| 38 | 3300042609 | Ga0466722_257360 | Ga0466722_257360_1389_2441 | 335 |
| 39 | 3300042620 | Ga0466728_330544 | Ga0466728_330544_1776_2828 | 335 |
| 40 | 3300042652 | Ga0466708_058438 | Ga0466708_058438_1756_2841 | 335 |
| 41 | 3300042652 | Ga0466708_091453 | Ga0466708_091453_14176_15261 | 335 |
| 42 | 3300012849 | Ga0160447_100565 | Ga0160447_1005655 | 336 |
| 43 | 3300042590 | Ga0466690_321455 | Ga0466690_321455_3318_4394 | 336 |
| 44 | 3300042596 | Ga0466696_068897 | Ga0466696_068897_3259_4311 | 336 |
| 45 | 3300042605 | Ga0466716_382805 | Ga0466716_382805_28826_29872 | 336 |
| 46 | 3300042618 | Ga0466723_084743 | Ga0466723_084743_518_1603 | 336 |
| 47 | 3300002504 | JGI24705J35276_12221601 | JGI24705J35276_122216011 | 337 |
| 48 | 3300042606 | Ga0466719_303715 | Ga0466719_303715_4269_5321 | 337 |
| 49 | 3300042610 | Ga0466698_012628 | Ga0466698_012628_663_1715 | 337 |
| 50 | 3300042591 | Ga0466692_085853 | Ga0466692_085853_996_2063 | 338 |
| 51 | 3300042610 | Ga0466698_323495 | Ga0466698_323495_219_1271 | 338 |
| 52 | 3300042615 | Ga0466711_106112 | Ga0466711_106112_3022_4074 | 338 |
| 53 | 3300042616 | Ga0466715_014820 | Ga0466715_014820_8706_9758 | 338 |
| 54 | 3300042636 | Ga0466703_395122 | Ga0466703_395122_29762_30817 | 338 |
| 55 | 3300042592 | Ga0466693_202006 | Ga0466693_202006_654_1703 | 339 |
| 56 | 3300042594 | Ga0466694_140518 | Ga0466694_140518_39_1088 | 339 |
| 57 | 3300042609 | Ga0466722_096496 | Ga0466722_096496_7742_8794 | 339 |
| 58 | 3300042648 | Ga0466709_319638 | Ga0466709_319638_1038_2132 | 339 |
| 59 | 3300042609 | Ga0466722_058035 | Ga0466722_058035_216_1238 | 340 |
| 60 | 3300042616 | Ga0466715_294266 | Ga0466715_294266_95_1174 | 340 |
| 61 | 3300042610 | Ga0466698_079971 | Ga0466698_079971_251_1300 | 341 |
| 62 | 3300042612 | Ga0466705_100435 | Ga0466705_100435_6646_7728 | 341 |
| 63 | 3300042620 | Ga0466728_271542 | Ga0466728_271542_3257_4336 | 341 |
| 64 | 3300012820 | Ga0160456_100681 | Ga0160456_1006817 | 342 |
| 65 | 3300042593 | Ga0466691_086411 | Ga0466691_086411_3832_4917 | 342 |
| 66 | 3300042618 | Ga0466723_069244 | Ga0466723_069244_136_1221 | 342 |
| 67 | 3300042643 | Ga0466704_305168 | Ga0466704_305168_152_1237 | 342 |
| 68 | 3300042652 | Ga0466708_366091 | Ga0466708_366091_443_1528 | 342 |
| 69 | 3300042606 | Ga0466719_560412 | Ga0466719_560412_570_1655 | 343 |
| 70 | 3300042618 | Ga0466723_288614 | Ga0466723_288614_2054_3127 | 343 |
| 71 | 3300042596 | Ga0466696_107302 | Ga0466696_107302_3329_4420 | 344 |
| 72 | 3300042606 | Ga0466719_104296 | Ga0466719_104296_2697_3776 | 344 |
| 73 | 3300042616 | Ga0466715_243935 | Ga0466715_243935_281_1357 | 344 |
| 74 | 3300042618 | Ga0466723_001375 | Ga0466723_001375_6617_7693 | 344 |
| 75 | 3300042652 | Ga0466708_088014 | Ga0466708_088014_437_1534 | 344 |
| 76 | 3300012815 | Ga0160440_100038 | Ga0160440_10003861 | 345 |
| 77 | 3300042616 | Ga0466715_527255 | Ga0466715_527255_9595_10650 | 345 |
| 78 | 3300042655 | Ga0466727_020974 | Ga0466727_020974_2070_3125 | 345 |
| 79 | 3300005200 | Ga0072940_1084455 | Ga0072940_10844552 | 346 |
| 80 | 3300012818 | Ga0160432_102726 | Ga0160432_1027263 | 346 |
| 81 | 3300012832 | Ga0160458_100424 | Ga0160458_10042410 | 346 |
| 82 | 3300012861 | Ga0160436_1002567 | Ga0160436_10025672 | 346 |
| 83 | 3300042593 | Ga0466691_227589 | Ga0466691_227589_2543_3628 | 346 |
| 84 | 3300042606 | Ga0466719_543635 | Ga0466719_543635_5615_6700 | 346 |
| 85 | 3300042636 | Ga0466703_039474 | Ga0466703_039474_1616_2698 | 346 |
| 86 | 3300042636 | Ga0466703_159202 | Ga0466703_159202_1183_2256 | 346 |
| 87 | 3300042652 | Ga0466708_386368 | Ga0466708_386368_3237_4322 | 346 |
| 88 | iso_pr_bacteria | 2590828840 | 2593254884 | 346 |
| 89 | iso_pr_bacteria | 2593339125 | 2595064885 | 346 |
| 90 | 3300042601 | Ga0466707_079192 | Ga0466707_079192_3834_4907 | 347 |
| 91 | 3300042624 | Ga0466735_023401 | Ga0466735_023401_3585_4628 | 347 |
| 92 | iso_pr_bacteria | 2590828840 | 2593255626 | 347 |
| 93 | 3300042606 | Ga0466719_023068 | Ga0466719_023068_492_1571 | 348 |
| 94 | iso_pr_bacteria | 2529293168 | 2531454383 | 348 |
| 95 | 3300042601 | Ga0466707_219319 | Ga0466707_219319_66_1115 | 349 |
| 96 | 3300042609 | Ga0466722_061926 | Ga0466722_061926_5914_6963 | 349 |
| 97 | 3300042610 | Ga0466698_480915 | Ga0466698_480915_176_1225 | 349 |
| 98 | 3300042612 | Ga0466705_085384 | Ga0466705_085384_7741_8829 | 349 |
| 99 | 3300042616 | Ga0466715_295462 | Ga0466715_295462_7303_8385 | 349 |
| 100 | 3300042619 | Ga0466726_006628 | Ga0466726_006628_2457_3506 | 349 |
| 101 | 3300042590 | Ga0466690_129063 | Ga0466690_129063_997_2091 | 350 |
| 102 | 3300042606 | Ga0466719_280632 | Ga0466719_280632_1716_2768 | 350 |
| 103 | 3300042612 | Ga0466705_220302 | Ga0466705_220302_21175_22227 | 350 |
| 104 | 3300042615 | Ga0466711_034417 | Ga0466711_034417_127_1179 | 350 |
| 105 | 3300042615 | Ga0466711_069028 | Ga0466711_069028_461_1513 | 350 |
| 106 | 3300042643 | Ga0466704_070955 | Ga0466704_070955_19417_20469 | 350 |
| 107 | 3300002449 | JGI24698J34947_10006047 | JGI24698J34947_100060474 | 351 |
| 108 | 3300042594 | Ga0466694_409411 | Ga0466694_409411_1776_2831 | 351 |
| 109 | 3300042596 | Ga0466696_473017 | Ga0466696_473017_63_1118 | 351 |
| 110 | 3300042612 | Ga0466705_040997 | Ga0466705_040997_9992_11077 | 351 |
| 111 | 3300042614 | Ga0466712_157010 | Ga0466712_157010_207_1262 | 351 |
| 112 | 3300042615 | Ga0466711_307368 | Ga0466711_307368_2963_4018 | 351 |
| 113 | 3300042636 | Ga0466703_038438 | Ga0466703_038438_150_1205 | 351 |
| 114 | 3300042655 | Ga0466727_171548 | Ga0466727_171548_16_1071 | 351 |
| 115 | 3300042656 | Ga0466732_094432 | Ga0466732_094432_196_1251 | 351 |
| 116 | 3300002449 | JGI24698J34947_10001487 | JGI24698J34947_1000148711 | 352 |
| 117 | 3300005083 | Ga0068305_10095985 | Ga0068305_100959854 | 352 |
| 118 | 3300005485 | Ga0074263_115597 | Ga0074263_1155972 | 352 |
| 119 | 3300010167 | Ga0123353_10035919 | Ga0123353_100359197 | 352 |
| 120 | 3300024493 | Ga0264413_142011 | Ga0264413_1420113 | 352 |
| 121 | 3300042609 | Ga0466722_205805 | Ga0466722_205805_2562_3620 | 352 |
| 122 | 3300042609 | Ga0466722_254077 | Ga0466722_254077_7100_8158 | 352 |
| 123 | iso_pr_bacteria | 2884351759 | 2884355266 | 352 |
| 124 | 3300042609 | Ga0466722_005029 | Ga0466722_005029_10583_11644 | 353 |
| 125 | 3300042655 | Ga0466727_232501 | Ga0466727_232501_100_1206 | 353 |
| 126 | 3300042655 | Ga0466727_280290 | Ga0466727_280290_1046_2140 | 353 |
| 127 | iso_pr_bacteria | 2820946191 | 2820947555 | 354 |
| 128 | 3300042623 | Ga0466734_029291 | Ga0466734_029291_164_1231 | 355 |
| 129 | 3300042612 | Ga0466705_209273 | Ga0466705_209273_987_2057 | 356 |
| 130 | 3300042591 | Ga0466692_078488 | Ga0466692_078488_4433_5554 | 358 |
| 131 | 3300042602 | Ga0466713_003161 | Ga0466713_003161_2550_3629 | 359 |
| 132 | 3300042591 | Ga0466692_046749 | Ga0466692_046749_671_1759 | 362 |
| 133 | 3300042609 | Ga0466722_128735 | Ga0466722_128735_3750_4838 | 362 |
| 134 | 3300042618 | Ga0466723_009273 | Ga0466723_009273_367_1455 | 362 |
| 135 | 3300042655 | Ga0466727_031017 | Ga0466727_031017_191_1279 | 362 |
| 136 | 3300042643 | Ga0466704_123618 | Ga0466704_123618_273_1364 | 363 |
| 137 | 3300042593 | Ga0466691_135210 | Ga0466691_135210_953_2050 | 365 |
| 138 | 3300042612 | Ga0466705_241648 | Ga0466705_241648_87_1184 | 365 |
| 139 | 3300010167 | Ga0123353_10192648 | Ga0123353_101926484 | 366 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 49 | 328 | 0.9 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.