Protein Family IF07134

Metagenome Isolate
138 Members
49 Samples
130 Scaffolds
85.86 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_186309|Ga0466705_186309_62_352
Length
96 aa
Sequence
MIQIRPVSDLRNKFPEIETVVSGGNPVYLTKNGYGAMVVMSLEKYAELTDDLELKLDEADSAAAASDTRYTHEVVFSRLKGGLNGKTIHAALSAPV

📊 Sample Types

Isolate 5.8%
Metagenome 94.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.9%
Kalotermitidae 20.4%
Unclassified 18.4%
Passalidae 6.1%
Rhinotermitidae 4.1%
Termopsidae 4.1%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 5
Bacteria 117
Eukaryota 0
Viruses 1
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 650716102 Treponema primitia ZAS-2 Isolate Unclassified
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
12 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
13 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
14 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
15 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
23 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
26 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
27 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
39 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
40 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
43 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
44 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_016872 3300042659 Bacteria 1260
2 Ga0123357_10126231 3300009784 Bacteria 3204
3 Ga0123355_10000032 3300009826 Bacteria 139664
4 Ga0123356_10002333 3300010049 Bacteria 20378
5 Ga0123353_10000146 3300010167 Bacteria 87435
6 Ga0123353_10683743 3300010167 Bacteria 1444
7 Ga0123353_11425913 3300010167 Bacteria 888
8 Ga0123354_10963822 3300010882 Bacteria 552
9 Ga0466729_132326 3300042621 Bacteria 1965
10 Ga0466734_027142 3300042623 Bacteria 6512
11 Ga0466725_229408 3300042654 Bacteria 8218
12 Ga0466725_302793 3300042654 Bacteria 49393
13 Ga0466698_126921 3300042610 Bacteria 3324
14 2227475474 2225789004 Archaea 4669
15 IMNBL1DRAFT_c0026928 3300000062 Unclassified 2174
16 JGI24702J35022_10015311 3300002462 Bacteria 4223
17 JGI24702J35022_10536409 3300002462 Bacteria 720
18 Ga0123356_10238958 3300010049 Archaea 1886
19 Ga0466728_229216 3300042620 Bacteria 1676
20 Ga0415639_212257 3300038395 Bacteria 2010
21 Ga0466657_081287 3300042582 Bacteria 20523
22 Ga0466704_065690 3300042643 Bacteria 1835
23 Ga0466706_104056 3300042599 Bacteria 1561
24 Ga0466719_166514 3300042606 Bacteria 1922
25 2227477131 2225789004 Bacteria 4593
26 IMNBL1DRAFT_c0003200 3300000062 Archaea 10712
27 IMNBL1DRAFT_c0044970 3300000062 Unclassified 1446
28 Ga0072940_1145581 3300005200 Bacteria 7457
29 Ga0466705_288806 3300042612 Bacteria 3223
30 Ga0466733_100386 3300042659 Bacteria 91702
31 Ga0123357_10996969 3300009784 Bacteria 522
32 Ga0123355_10247904 3300009826 Bacteria 2513
33 Ga0123355_12039280 3300009826 Bacteria 530
34 Ga0123356_11114006 3300010049 Unclassified 957
35 Ga0123356_11630003 3300010049 Bacteria 799
36 Ga0123356_13827671 3300010049 Bacteria 519
37 Ga0466726_096654 3300042619 Bacteria 3862
38 Ga0466690_261994 3300042590 Bacteria 2796
39 Ga0466727_239196 3300042655 Bacteria 11634
40 Ga0466700_200774 3300042600 Viruses 1638
41 Ga0466719_212952 3300042606 Bacteria 7332
42 Ga0466719_420269 3300042606 Bacteria 2827
43 Ga0466721_063506 3300042608 Bacteria 1511
44 Ga0466721_284719 3300042608 Bacteria 2075
45 2227541323 2225789004 Bacteria 2985
46 IMNBL1DRAFT_c0032548 3300000062 Unclassified 1879
47 IMNBL1DRAFT_c0122021 3300000062 Bacteria 684
48 Ga0123357_10027982 3300009784 Bacteria 7624
49 Ga0123357_10308554 3300009784 Bacteria 1584
50 Ga0123355_10014332 3300009826 Bacteria 12391
51 Ga0123355_10815708 3300009826 Unclassified 1036
52 Ga0123356_10176583 3300010049 Bacteria 2153
53 Ga0123356_10927322 3300010049 Bacteria 1042
54 Ga0123353_13205803 3300010167 Bacteria 524
55 Ga0466718_006211 3300042617 Bacteria 3350
56 Ga0466723_022325 3300042618 Bacteria 1641
57 Ga0466723_077144 3300042618 Bacteria 6331
58 Ga0466726_210152 3300042619 Bacteria 1791
59 Ga0466695_212884 3300042595 Bacteria 1062
60 Ga0466713_046884 3300042602 Bacteria 7995
61 Ga0466714_017127 3300042603 Bacteria 1161
62 Ga0466714_030818 3300042603 Bacteria 1470
63 Ga0466697_032688 3300042611 Bacteria 5076
64 2227330782 2225789004 Bacteria 28620
65 JGI24702J35022_10017378 3300002462 Bacteria 3931
66 JGI24705J35276_11312082 3300002504 Bacteria 505
67 Ga0123357_10763333 3300009784 Bacteria 668
68 Ga0123356_10002359 3300010049 Bacteria 20271
69 Ga0123356_10278948 3300010049 Archaea 1765
70 Ga0123356_10531002 3300010049 Bacteria 1336
71 Ga0466705_456594 3300042612 Unclassified 13583
72 Ga0466690_005176 3300042590 Bacteria 1288
73 Ga0466731_399224 3300042622 Bacteria 1007
74 Ga0466706_192488 3300042599 Bacteria 10839
75 Ga0466717_116606 3300042604 Bacteria 1462
76 Ga0466721_050003 3300042608 Bacteria 1042
77 Ga0466722_206860 3300042609 Bacteria 3285
78 Ga0466698_354232 3300042610 Unclassified 1201
79 2227035912 2225789003 Unclassified 20763
80 2227161351 2225789004 Unclassified 8375
81 JGI24705J35276_12124339 3300002504 Bacteria 1082
82 Ga0466705_173195 3300042612 Bacteria 2110
83 Ga0123355_10618962 3300009826 Unclassified 1277
84 Ga0123356_10129801 3300010049 Bacteria 2467
85 Ga0123356_10132448 3300010049 Bacteria 2445
86 Ga0123356_10436741 3300010049 Unclassified 1454
87 Ga0123356_13161613 3300010049 Bacteria 574
88 Ga0123353_11748758 3300010167 Bacteria 776
89 Ga0123354_10383399 3300010882 Bacteria 1210
90 Ga0415639_254685 3300038395 Bacteria 851
91 Ga0466696_179977 3300042596 Bacteria 13311
92 Ga0466706_215202 3300042599 Bacteria 19000
93 Ga0466707_073953 3300042601 Bacteria 1276
94 Ga0466707_110034 3300042601 Bacteria 1382
95 Ga0466707_354055 3300042601 Bacteria 25446
96 Ga0466722_162936 3300042609 Bacteria 2857
97 JGI24702J35022_10012614 3300002462 Bacteria 4692
98 Ga0466705_186309 3300042612 Bacteria 3198
99 Ga0466733_042405 3300042659 Bacteria 2795
100 Ga0466733_120315 3300042659 Bacteria 1011
101 Ga0123356_12753899 3300010049 Bacteria 615
102 Ga0123353_10014340 3300010167 Bacteria 11414
103 Ga0123354_10168234 3300010882 Bacteria 2565
104 Ga0466715_551503 3300042616 Bacteria 24742
105 Ga0415639_001497 3300038395 Bacteria 101208
106 Ga0466657_331034 3300042582 Bacteria 2552
107 Ga0466731_353333 3300042622 Unclassified 1069
108 Ga0466708_086563 3300042652 Bacteria 8196
109 Ga0466707_120805 3300042601 Bacteria 1530
110 Ga0466707_342751 3300042601 Bacteria 1025
111 Ga0466722_116129 3300042609 Bacteria 1610
112 IMNBL1DRAFT_c0000008 3300000062 Bacteria 244959
113 IMNBL1DRAFT_c0010770 3300000062 Archaea 4335
114 JGI24702J35022_10152680 3300002462 Bacteria 1296
115 Ga0466705_189378 3300042612 Bacteria 1177
116 Ga0466705_270678 3300042612 Unclassified 2099
117 Ga0123357_10266504 3300009784 Bacteria 1799
118 Ga0123357_10705418 3300009784 Bacteria 721
119 Ga0123356_11129565 3300010049 Bacteria 951
120 Ga0123353_10063865 3300010167 Bacteria 5906
121 Ga0123353_11124715 3300010167 Bacteria 1040
122 Ga0123354_10247013 3300010882 Unclassified 1819
123 Ga0123354_10890950 3300010882 Bacteria 585
124 Ga0466711_133229 3300042615 Bacteria 1055
125 Ga0466723_118246 3300042618 Bacteria 7979
126 Ga0466657_019410 3300042582 Bacteria 37865
127 Ga0466707_326354 3300042601 Unclassified 1482
128 2227154424 2225789004 Bacteria 1576
129 2227253024 2225789004 Bacteria 7089
130 JGI24705J35276_12227363 3300002504 Bacteria 2992

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_120315 Ga0466733_120315_169_405 78
2 3300010167 Ga0123353_11748758 Ga0123353_117487582 80
3 3300042601 Ga0466707_110034 Ga0466707_110034_40_282 80
4 3300010167 Ga0123353_11124715 Ga0123353_111247153 82
5 3300010882 Ga0123354_10890950 Ga0123354_108909502 82
6 3300042590 Ga0466690_005176 Ga0466690_005176_579_827 82
7 3300042599 Ga0466706_192488 Ga0466706_192488_6929_7177 82
8 3300042601 Ga0466707_326354 Ga0466707_326354_784_1032 82
9 3300042602 Ga0466713_046884 Ga0466713_046884_1160_1411 83
10 3300042619 Ga0466726_096654 Ga0466726_096654_1282_1533 83
11 3300002462 JGI24702J35022_10012614 JGI24702J35022_100126149 84
12 3300002504 JGI24705J35276_12124339 JGI24705J35276_121243392 84
13 3300010049 Ga0123356_10002333 Ga0123356_1000233317 84
14 3300042601 Ga0466707_073953 Ga0466707_073953_558_812 84
15 3300042608 Ga0466721_050003 Ga0466721_050003_52_306 84
16 3300042652 Ga0466708_086563 Ga0466708_086563_7844_8098 84
17 iso_pr_bacteria 2820360414 2820360928 84
18 iso_pr_bacteria 650716102 650883222 84
19 2225789004 2227154424 2227561543 85
20 2225789004 2227253024 2227696786 85
21 2225789004 2227330782 2227778563 85
22 2225789004 2227541323 2228063434 85
23 3300002504 JGI24705J35276_11312082 JGI24705J35276_113120822 85
24 3300009784 Ga0123357_10027982 Ga0123357_100279827 85
25 3300010049 Ga0123356_10436741 Ga0123356_104367412 85
26 3300010882 Ga0123354_10247013 Ga0123354_102470131 85
27 3300038395 Ga0415639_001497 Ga0415639_001497_18570_18827 85
28 3300038395 Ga0415639_212257 Ga0415639_212257_89_346 85
29 3300038395 Ga0415639_254685 Ga0415639_254685_34_291 85
30 3300042582 Ga0466657_019410 Ga0466657_019410_36903_37160 85
31 3300042582 Ga0466657_081287 Ga0466657_081287_18303_18560 85
32 3300042582 Ga0466657_331034 Ga0466657_331034_1861_2118 85
33 3300042590 Ga0466690_261994 Ga0466690_261994_1693_1950 85
34 3300042595 Ga0466695_212884 Ga0466695_212884_600_857 85
35 3300042596 Ga0466696_179977 Ga0466696_179977_12717_12974 85
36 3300042600 Ga0466700_200774 Ga0466700_200774_1173_1430 85
37 3300042601 Ga0466707_120805 Ga0466707_120805_583_840 85
38 3300042601 Ga0466707_342751 Ga0466707_342751_520_777 85
39 3300042603 Ga0466714_017127 Ga0466714_017127_515_772 85
40 3300042604 Ga0466717_116606 Ga0466717_116606_1193_1450 85
41 3300042606 Ga0466719_166514 Ga0466719_166514_762_1019 85
42 3300042606 Ga0466719_212952 Ga0466719_212952_4066_4323 85
43 3300042606 Ga0466719_420269 Ga0466719_420269_1949_2206 85
44 3300042608 Ga0466721_063506 Ga0466721_063506_732_989 85
45 3300042610 Ga0466698_126921 Ga0466698_126921_1664_1921 85
46 3300042610 Ga0466698_354232 Ga0466698_354232_124_381 85
47 3300042612 Ga0466705_173195 Ga0466705_173195_392_649 85
48 3300042612 Ga0466705_189378 Ga0466705_189378_808_1065 85
49 3300042612 Ga0466705_270678 Ga0466705_270678_978_1235 85
50 3300042612 Ga0466705_288806 Ga0466705_288806_1456_1713 85
51 3300042612 Ga0466705_456594 Ga0466705_456594_13045_13302 85
52 3300042615 Ga0466711_133229 Ga0466711_133229_437_694 85
53 3300042616 Ga0466715_551503 Ga0466715_551503_15049_15306 85
54 3300042617 Ga0466718_006211 Ga0466718_006211_1526_1783 85
55 3300042618 Ga0466723_022325 Ga0466723_022325_307_564 85
56 3300042618 Ga0466723_077144 Ga0466723_077144_483_740 85
57 3300042618 Ga0466723_118246 Ga0466723_118246_5168_5425 85
58 3300042621 Ga0466729_132326 Ga0466729_132326_1093_1350 85
59 3300042622 Ga0466731_353333 Ga0466731_353333_657_914 85
60 3300042622 Ga0466731_399224 Ga0466731_399224_599_856 85
61 3300042623 Ga0466734_027142 Ga0466734_027142_566_823 85
62 3300042643 Ga0466704_065690 Ga0466704_065690_965_1222 85
63 3300042654 Ga0466725_302793 Ga0466725_302793_48387_48644 85
64 3300042655 Ga0466727_239196 Ga0466727_239196_10971_11228 85
65 3300042659 Ga0466733_016872 Ga0466733_016872_178_435 85
66 3300042659 Ga0466733_100386 Ga0466733_100386_2217_2474 85
67 iso_pr_bacteria 2820244222 2820246157 85
68 iso_pr_bacteria 2820435670 2820436711 85
69 iso_pr_bacteria 2820566695 2820566758 85
70 iso_pr_bacteria 2820587002 2820589117 85
71 3300000062 IMNBL1DRAFT_c0000008 IMNBL1DRAFT_0000008141 86
72 3300000062 IMNBL1DRAFT_c0122021 IMNBL1DRAFT_01220211 86
73 3300002462 JGI24702J35022_10015311 JGI24702J35022_100153119 86
74 3300002462 JGI24702J35022_10017378 JGI24702J35022_100173781 86
75 3300002462 JGI24702J35022_10152680 JGI24702J35022_101526803 86
76 3300002462 JGI24702J35022_10536409 JGI24702J35022_105364091 86
77 3300002504 JGI24705J35276_12227363 JGI24705J35276_122273635 86
78 3300005200 Ga0072940_1145581 Ga0072940_11455816 86
79 3300009784 Ga0123357_10126231 Ga0123357_101262313 86
80 3300009784 Ga0123357_10266504 Ga0123357_102665043 86
81 3300009784 Ga0123357_10308554 Ga0123357_103085542 86
82 3300009784 Ga0123357_10763333 Ga0123357_107633331 86
83 3300009784 Ga0123357_10996969 Ga0123357_109969692 86
84 3300009826 Ga0123355_10000032 Ga0123355_10000032108 86
85 3300009826 Ga0123355_10014332 Ga0123355_100143322 86
86 3300009826 Ga0123355_10247904 Ga0123355_102479041 86
87 3300009826 Ga0123355_12039280 Ga0123355_120392802 86
88 3300010049 Ga0123356_10002359 Ga0123356_100023599 86
89 3300010049 Ga0123356_10129801 Ga0123356_101298012 86
90 3300010049 Ga0123356_10132448 Ga0123356_101324481 86
91 3300010049 Ga0123356_11114006 Ga0123356_111140061 86
92 3300010049 Ga0123356_11630003 Ga0123356_116300031 86
93 3300010049 Ga0123356_12753899 Ga0123356_127538992 86
94 3300010049 Ga0123356_13161613 Ga0123356_131616132 86
95 3300010049 Ga0123356_13827671 Ga0123356_138276711 86
96 3300010167 Ga0123353_10000146 Ga0123353_1000014612 86
97 3300010167 Ga0123353_10014340 Ga0123353_100143405 86
98 3300010167 Ga0123353_10683743 Ga0123353_106837431 86
99 3300010167 Ga0123353_11425913 Ga0123353_114259132 86
100 3300010167 Ga0123353_13205803 Ga0123353_132058032 86
101 3300010882 Ga0123354_10383399 Ga0123354_103833992 86
102 3300010882 Ga0123354_10963822 Ga0123354_109638222 86
103 3300042611 Ga0466697_032688 Ga0466697_032688_1128_1388 86
104 3300042654 Ga0466725_229408 Ga0466725_229408_1557_1817 86
105 2225789003 2227035912 2227396260 87
106 2225789004 2227161351 2227571031 87
107 2225789004 2227475474 2227927027 87
108 2225789004 2227477131 2227930503 87
109 3300009784 Ga0123357_10705418 Ga0123357_107054182 87
110 3300010049 Ga0123356_10238958 Ga0123356_102389582 87
111 3300010049 Ga0123356_10278948 Ga0123356_102789482 87
112 3300042608 Ga0466721_284719 Ga0466721_284719_1514_1777 87
113 3300042659 Ga0466733_042405 Ga0466733_042405_1350_1613 87
114 3300000062 IMNBL1DRAFT_c0010770 IMNBL1DRAFT_00107706 88
115 3300000062 IMNBL1DRAFT_c0026928 IMNBL1DRAFT_00269283 88
116 3300000062 IMNBL1DRAFT_c0032548 IMNBL1DRAFT_00325482 88
117 3300000062 IMNBL1DRAFT_c0044970 IMNBL1DRAFT_00449703 88
118 3300010167 Ga0123353_10063865 Ga0123353_100638652 88
119 3300010882 Ga0123354_10168234 Ga0123354_101682344 88
120 3300042599 Ga0466706_215202 Ga0466706_215202_8889_9155 88
121 3300042609 Ga0466722_116129 Ga0466722_116129_979_1245 88
122 3300042609 Ga0466722_162936 Ga0466722_162936_1148_1414 88
123 3300042609 Ga0466722_206860 Ga0466722_206860_2736_3002 88
124 3300042620 Ga0466728_229216 Ga0466728_229216_891_1157 88
125 iso_pr_bacteria 2820134530 2820134705 88
126 iso_pr_bacteria 2820134530 2820135343 88
127 3300009826 Ga0123355_10618962 Ga0123355_106189623 89
128 3300010049 Ga0123356_10531002 Ga0123356_105310023 89
129 3300010049 Ga0123356_11129565 Ga0123356_111295652 89
130 3300009826 Ga0123355_10815708 Ga0123355_108157082 90
131 3300010049 Ga0123356_10927322 Ga0123356_109273222 90
132 3300042599 Ga0466706_104056 Ga0466706_104056_285_557 90
133 3300042603 Ga0466714_030818 Ga0466714_030818_241_513 90
134 3300042619 Ga0466726_210152 Ga0466726_210152_903_1175 90
135 3300042601 Ga0466707_354055 Ga0466707_354055_20462_20737 91
136 3300010049 Ga0123356_10176583 Ga0123356_101765833 93
137 3300000062 IMNBL1DRAFT_c0003200 IMNBL1DRAFT_000320012 94
138 3300042612 Ga0466705_186309 Ga0466705_186309_62_352 96

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02604 PhdYeFM_antitox Antitoxin Phd_YefM, type II toxin-antitoxin system 3 66 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.43 0.74 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.