Protein Family IF07134
Metagenome
Isolate
138
Members
49
Samples
130
Scaffolds
85.86
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_186309|Ga0466705_186309_62_352
- Length
- 96 aa
- Sequence
- MIQIRPVSDLRNKFPEIETVVSGGNPVYLTKNGYGAMVVMSLEKYAELTDDLELKLDEADSAAAASDTRYTHEVVFSRLKGGLNGKTIHAALSAPV
Sample Types
Isolate
5.8%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.9%
Kalotermitidae
20.4%
Unclassified
18.4%
Passalidae
6.1%
Rhinotermitidae
4.1%
Termopsidae
4.1%
Hodotermitidae
2.0%
Taxonomy
Archaea
5
Bacteria
117
Eukaryota
0
Viruses
1
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 12 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 39 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 2820134530 | Unclassified Proteobacteria Emb289P3bin65 | Isolate | Unclassified |
| 43 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 44 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_016872 | 3300042659 | Bacteria | 1260 |
| 2 | Ga0123357_10126231 | 3300009784 | Bacteria | 3204 |
| 3 | Ga0123355_10000032 | 3300009826 | Bacteria | 139664 |
| 4 | Ga0123356_10002333 | 3300010049 | Bacteria | 20378 |
| 5 | Ga0123353_10000146 | 3300010167 | Bacteria | 87435 |
| 6 | Ga0123353_10683743 | 3300010167 | Bacteria | 1444 |
| 7 | Ga0123353_11425913 | 3300010167 | Bacteria | 888 |
| 8 | Ga0123354_10963822 | 3300010882 | Bacteria | 552 |
| 9 | Ga0466729_132326 | 3300042621 | Bacteria | 1965 |
| 10 | Ga0466734_027142 | 3300042623 | Bacteria | 6512 |
| 11 | Ga0466725_229408 | 3300042654 | Bacteria | 8218 |
| 12 | Ga0466725_302793 | 3300042654 | Bacteria | 49393 |
| 13 | Ga0466698_126921 | 3300042610 | Bacteria | 3324 |
| 14 | 2227475474 | 2225789004 | Archaea | 4669 |
| 15 | IMNBL1DRAFT_c0026928 | 3300000062 | Unclassified | 2174 |
| 16 | JGI24702J35022_10015311 | 3300002462 | Bacteria | 4223 |
| 17 | JGI24702J35022_10536409 | 3300002462 | Bacteria | 720 |
| 18 | Ga0123356_10238958 | 3300010049 | Archaea | 1886 |
| 19 | Ga0466728_229216 | 3300042620 | Bacteria | 1676 |
| 20 | Ga0415639_212257 | 3300038395 | Bacteria | 2010 |
| 21 | Ga0466657_081287 | 3300042582 | Bacteria | 20523 |
| 22 | Ga0466704_065690 | 3300042643 | Bacteria | 1835 |
| 23 | Ga0466706_104056 | 3300042599 | Bacteria | 1561 |
| 24 | Ga0466719_166514 | 3300042606 | Bacteria | 1922 |
| 25 | 2227477131 | 2225789004 | Bacteria | 4593 |
| 26 | IMNBL1DRAFT_c0003200 | 3300000062 | Archaea | 10712 |
| 27 | IMNBL1DRAFT_c0044970 | 3300000062 | Unclassified | 1446 |
| 28 | Ga0072940_1145581 | 3300005200 | Bacteria | 7457 |
| 29 | Ga0466705_288806 | 3300042612 | Bacteria | 3223 |
| 30 | Ga0466733_100386 | 3300042659 | Bacteria | 91702 |
| 31 | Ga0123357_10996969 | 3300009784 | Bacteria | 522 |
| 32 | Ga0123355_10247904 | 3300009826 | Bacteria | 2513 |
| 33 | Ga0123355_12039280 | 3300009826 | Bacteria | 530 |
| 34 | Ga0123356_11114006 | 3300010049 | Unclassified | 957 |
| 35 | Ga0123356_11630003 | 3300010049 | Bacteria | 799 |
| 36 | Ga0123356_13827671 | 3300010049 | Bacteria | 519 |
| 37 | Ga0466726_096654 | 3300042619 | Bacteria | 3862 |
| 38 | Ga0466690_261994 | 3300042590 | Bacteria | 2796 |
| 39 | Ga0466727_239196 | 3300042655 | Bacteria | 11634 |
| 40 | Ga0466700_200774 | 3300042600 | Viruses | 1638 |
| 41 | Ga0466719_212952 | 3300042606 | Bacteria | 7332 |
| 42 | Ga0466719_420269 | 3300042606 | Bacteria | 2827 |
| 43 | Ga0466721_063506 | 3300042608 | Bacteria | 1511 |
| 44 | Ga0466721_284719 | 3300042608 | Bacteria | 2075 |
| 45 | 2227541323 | 2225789004 | Bacteria | 2985 |
| 46 | IMNBL1DRAFT_c0032548 | 3300000062 | Unclassified | 1879 |
| 47 | IMNBL1DRAFT_c0122021 | 3300000062 | Bacteria | 684 |
| 48 | Ga0123357_10027982 | 3300009784 | Bacteria | 7624 |
| 49 | Ga0123357_10308554 | 3300009784 | Bacteria | 1584 |
| 50 | Ga0123355_10014332 | 3300009826 | Bacteria | 12391 |
| 51 | Ga0123355_10815708 | 3300009826 | Unclassified | 1036 |
| 52 | Ga0123356_10176583 | 3300010049 | Bacteria | 2153 |
| 53 | Ga0123356_10927322 | 3300010049 | Bacteria | 1042 |
| 54 | Ga0123353_13205803 | 3300010167 | Bacteria | 524 |
| 55 | Ga0466718_006211 | 3300042617 | Bacteria | 3350 |
| 56 | Ga0466723_022325 | 3300042618 | Bacteria | 1641 |
| 57 | Ga0466723_077144 | 3300042618 | Bacteria | 6331 |
| 58 | Ga0466726_210152 | 3300042619 | Bacteria | 1791 |
| 59 | Ga0466695_212884 | 3300042595 | Bacteria | 1062 |
| 60 | Ga0466713_046884 | 3300042602 | Bacteria | 7995 |
| 61 | Ga0466714_017127 | 3300042603 | Bacteria | 1161 |
| 62 | Ga0466714_030818 | 3300042603 | Bacteria | 1470 |
| 63 | Ga0466697_032688 | 3300042611 | Bacteria | 5076 |
| 64 | 2227330782 | 2225789004 | Bacteria | 28620 |
| 65 | JGI24702J35022_10017378 | 3300002462 | Bacteria | 3931 |
| 66 | JGI24705J35276_11312082 | 3300002504 | Bacteria | 505 |
| 67 | Ga0123357_10763333 | 3300009784 | Bacteria | 668 |
| 68 | Ga0123356_10002359 | 3300010049 | Bacteria | 20271 |
| 69 | Ga0123356_10278948 | 3300010049 | Archaea | 1765 |
| 70 | Ga0123356_10531002 | 3300010049 | Bacteria | 1336 |
| 71 | Ga0466705_456594 | 3300042612 | Unclassified | 13583 |
| 72 | Ga0466690_005176 | 3300042590 | Bacteria | 1288 |
| 73 | Ga0466731_399224 | 3300042622 | Bacteria | 1007 |
| 74 | Ga0466706_192488 | 3300042599 | Bacteria | 10839 |
| 75 | Ga0466717_116606 | 3300042604 | Bacteria | 1462 |
| 76 | Ga0466721_050003 | 3300042608 | Bacteria | 1042 |
| 77 | Ga0466722_206860 | 3300042609 | Bacteria | 3285 |
| 78 | Ga0466698_354232 | 3300042610 | Unclassified | 1201 |
| 79 | 2227035912 | 2225789003 | Unclassified | 20763 |
| 80 | 2227161351 | 2225789004 | Unclassified | 8375 |
| 81 | JGI24705J35276_12124339 | 3300002504 | Bacteria | 1082 |
| 82 | Ga0466705_173195 | 3300042612 | Bacteria | 2110 |
| 83 | Ga0123355_10618962 | 3300009826 | Unclassified | 1277 |
| 84 | Ga0123356_10129801 | 3300010049 | Bacteria | 2467 |
| 85 | Ga0123356_10132448 | 3300010049 | Bacteria | 2445 |
| 86 | Ga0123356_10436741 | 3300010049 | Unclassified | 1454 |
| 87 | Ga0123356_13161613 | 3300010049 | Bacteria | 574 |
| 88 | Ga0123353_11748758 | 3300010167 | Bacteria | 776 |
| 89 | Ga0123354_10383399 | 3300010882 | Bacteria | 1210 |
| 90 | Ga0415639_254685 | 3300038395 | Bacteria | 851 |
| 91 | Ga0466696_179977 | 3300042596 | Bacteria | 13311 |
| 92 | Ga0466706_215202 | 3300042599 | Bacteria | 19000 |
| 93 | Ga0466707_073953 | 3300042601 | Bacteria | 1276 |
| 94 | Ga0466707_110034 | 3300042601 | Bacteria | 1382 |
| 95 | Ga0466707_354055 | 3300042601 | Bacteria | 25446 |
| 96 | Ga0466722_162936 | 3300042609 | Bacteria | 2857 |
| 97 | JGI24702J35022_10012614 | 3300002462 | Bacteria | 4692 |
| 98 | Ga0466705_186309 | 3300042612 | Bacteria | 3198 |
| 99 | Ga0466733_042405 | 3300042659 | Bacteria | 2795 |
| 100 | Ga0466733_120315 | 3300042659 | Bacteria | 1011 |
| 101 | Ga0123356_12753899 | 3300010049 | Bacteria | 615 |
| 102 | Ga0123353_10014340 | 3300010167 | Bacteria | 11414 |
| 103 | Ga0123354_10168234 | 3300010882 | Bacteria | 2565 |
| 104 | Ga0466715_551503 | 3300042616 | Bacteria | 24742 |
| 105 | Ga0415639_001497 | 3300038395 | Bacteria | 101208 |
| 106 | Ga0466657_331034 | 3300042582 | Bacteria | 2552 |
| 107 | Ga0466731_353333 | 3300042622 | Unclassified | 1069 |
| 108 | Ga0466708_086563 | 3300042652 | Bacteria | 8196 |
| 109 | Ga0466707_120805 | 3300042601 | Bacteria | 1530 |
| 110 | Ga0466707_342751 | 3300042601 | Bacteria | 1025 |
| 111 | Ga0466722_116129 | 3300042609 | Bacteria | 1610 |
| 112 | IMNBL1DRAFT_c0000008 | 3300000062 | Bacteria | 244959 |
| 113 | IMNBL1DRAFT_c0010770 | 3300000062 | Archaea | 4335 |
| 114 | JGI24702J35022_10152680 | 3300002462 | Bacteria | 1296 |
| 115 | Ga0466705_189378 | 3300042612 | Bacteria | 1177 |
| 116 | Ga0466705_270678 | 3300042612 | Unclassified | 2099 |
| 117 | Ga0123357_10266504 | 3300009784 | Bacteria | 1799 |
| 118 | Ga0123357_10705418 | 3300009784 | Bacteria | 721 |
| 119 | Ga0123356_11129565 | 3300010049 | Bacteria | 951 |
| 120 | Ga0123353_10063865 | 3300010167 | Bacteria | 5906 |
| 121 | Ga0123353_11124715 | 3300010167 | Bacteria | 1040 |
| 122 | Ga0123354_10247013 | 3300010882 | Unclassified | 1819 |
| 123 | Ga0123354_10890950 | 3300010882 | Bacteria | 585 |
| 124 | Ga0466711_133229 | 3300042615 | Bacteria | 1055 |
| 125 | Ga0466723_118246 | 3300042618 | Bacteria | 7979 |
| 126 | Ga0466657_019410 | 3300042582 | Bacteria | 37865 |
| 127 | Ga0466707_326354 | 3300042601 | Unclassified | 1482 |
| 128 | 2227154424 | 2225789004 | Bacteria | 1576 |
| 129 | 2227253024 | 2225789004 | Bacteria | 7089 |
| 130 | JGI24705J35276_12227363 | 3300002504 | Bacteria | 2992 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042659 | Ga0466733_120315 | Ga0466733_120315_169_405 | 78 |
| 2 | 3300010167 | Ga0123353_11748758 | Ga0123353_117487582 | 80 |
| 3 | 3300042601 | Ga0466707_110034 | Ga0466707_110034_40_282 | 80 |
| 4 | 3300010167 | Ga0123353_11124715 | Ga0123353_111247153 | 82 |
| 5 | 3300010882 | Ga0123354_10890950 | Ga0123354_108909502 | 82 |
| 6 | 3300042590 | Ga0466690_005176 | Ga0466690_005176_579_827 | 82 |
| 7 | 3300042599 | Ga0466706_192488 | Ga0466706_192488_6929_7177 | 82 |
| 8 | 3300042601 | Ga0466707_326354 | Ga0466707_326354_784_1032 | 82 |
| 9 | 3300042602 | Ga0466713_046884 | Ga0466713_046884_1160_1411 | 83 |
| 10 | 3300042619 | Ga0466726_096654 | Ga0466726_096654_1282_1533 | 83 |
| 11 | 3300002462 | JGI24702J35022_10012614 | JGI24702J35022_100126149 | 84 |
| 12 | 3300002504 | JGI24705J35276_12124339 | JGI24705J35276_121243392 | 84 |
| 13 | 3300010049 | Ga0123356_10002333 | Ga0123356_1000233317 | 84 |
| 14 | 3300042601 | Ga0466707_073953 | Ga0466707_073953_558_812 | 84 |
| 15 | 3300042608 | Ga0466721_050003 | Ga0466721_050003_52_306 | 84 |
| 16 | 3300042652 | Ga0466708_086563 | Ga0466708_086563_7844_8098 | 84 |
| 17 | iso_pr_bacteria | 2820360414 | 2820360928 | 84 |
| 18 | iso_pr_bacteria | 650716102 | 650883222 | 84 |
| 19 | 2225789004 | 2227154424 | 2227561543 | 85 |
| 20 | 2225789004 | 2227253024 | 2227696786 | 85 |
| 21 | 2225789004 | 2227330782 | 2227778563 | 85 |
| 22 | 2225789004 | 2227541323 | 2228063434 | 85 |
| 23 | 3300002504 | JGI24705J35276_11312082 | JGI24705J35276_113120822 | 85 |
| 24 | 3300009784 | Ga0123357_10027982 | Ga0123357_100279827 | 85 |
| 25 | 3300010049 | Ga0123356_10436741 | Ga0123356_104367412 | 85 |
| 26 | 3300010882 | Ga0123354_10247013 | Ga0123354_102470131 | 85 |
| 27 | 3300038395 | Ga0415639_001497 | Ga0415639_001497_18570_18827 | 85 |
| 28 | 3300038395 | Ga0415639_212257 | Ga0415639_212257_89_346 | 85 |
| 29 | 3300038395 | Ga0415639_254685 | Ga0415639_254685_34_291 | 85 |
| 30 | 3300042582 | Ga0466657_019410 | Ga0466657_019410_36903_37160 | 85 |
| 31 | 3300042582 | Ga0466657_081287 | Ga0466657_081287_18303_18560 | 85 |
| 32 | 3300042582 | Ga0466657_331034 | Ga0466657_331034_1861_2118 | 85 |
| 33 | 3300042590 | Ga0466690_261994 | Ga0466690_261994_1693_1950 | 85 |
| 34 | 3300042595 | Ga0466695_212884 | Ga0466695_212884_600_857 | 85 |
| 35 | 3300042596 | Ga0466696_179977 | Ga0466696_179977_12717_12974 | 85 |
| 36 | 3300042600 | Ga0466700_200774 | Ga0466700_200774_1173_1430 | 85 |
| 37 | 3300042601 | Ga0466707_120805 | Ga0466707_120805_583_840 | 85 |
| 38 | 3300042601 | Ga0466707_342751 | Ga0466707_342751_520_777 | 85 |
| 39 | 3300042603 | Ga0466714_017127 | Ga0466714_017127_515_772 | 85 |
| 40 | 3300042604 | Ga0466717_116606 | Ga0466717_116606_1193_1450 | 85 |
| 41 | 3300042606 | Ga0466719_166514 | Ga0466719_166514_762_1019 | 85 |
| 42 | 3300042606 | Ga0466719_212952 | Ga0466719_212952_4066_4323 | 85 |
| 43 | 3300042606 | Ga0466719_420269 | Ga0466719_420269_1949_2206 | 85 |
| 44 | 3300042608 | Ga0466721_063506 | Ga0466721_063506_732_989 | 85 |
| 45 | 3300042610 | Ga0466698_126921 | Ga0466698_126921_1664_1921 | 85 |
| 46 | 3300042610 | Ga0466698_354232 | Ga0466698_354232_124_381 | 85 |
| 47 | 3300042612 | Ga0466705_173195 | Ga0466705_173195_392_649 | 85 |
| 48 | 3300042612 | Ga0466705_189378 | Ga0466705_189378_808_1065 | 85 |
| 49 | 3300042612 | Ga0466705_270678 | Ga0466705_270678_978_1235 | 85 |
| 50 | 3300042612 | Ga0466705_288806 | Ga0466705_288806_1456_1713 | 85 |
| 51 | 3300042612 | Ga0466705_456594 | Ga0466705_456594_13045_13302 | 85 |
| 52 | 3300042615 | Ga0466711_133229 | Ga0466711_133229_437_694 | 85 |
| 53 | 3300042616 | Ga0466715_551503 | Ga0466715_551503_15049_15306 | 85 |
| 54 | 3300042617 | Ga0466718_006211 | Ga0466718_006211_1526_1783 | 85 |
| 55 | 3300042618 | Ga0466723_022325 | Ga0466723_022325_307_564 | 85 |
| 56 | 3300042618 | Ga0466723_077144 | Ga0466723_077144_483_740 | 85 |
| 57 | 3300042618 | Ga0466723_118246 | Ga0466723_118246_5168_5425 | 85 |
| 58 | 3300042621 | Ga0466729_132326 | Ga0466729_132326_1093_1350 | 85 |
| 59 | 3300042622 | Ga0466731_353333 | Ga0466731_353333_657_914 | 85 |
| 60 | 3300042622 | Ga0466731_399224 | Ga0466731_399224_599_856 | 85 |
| 61 | 3300042623 | Ga0466734_027142 | Ga0466734_027142_566_823 | 85 |
| 62 | 3300042643 | Ga0466704_065690 | Ga0466704_065690_965_1222 | 85 |
| 63 | 3300042654 | Ga0466725_302793 | Ga0466725_302793_48387_48644 | 85 |
| 64 | 3300042655 | Ga0466727_239196 | Ga0466727_239196_10971_11228 | 85 |
| 65 | 3300042659 | Ga0466733_016872 | Ga0466733_016872_178_435 | 85 |
| 66 | 3300042659 | Ga0466733_100386 | Ga0466733_100386_2217_2474 | 85 |
| 67 | iso_pr_bacteria | 2820244222 | 2820246157 | 85 |
| 68 | iso_pr_bacteria | 2820435670 | 2820436711 | 85 |
| 69 | iso_pr_bacteria | 2820566695 | 2820566758 | 85 |
| 70 | iso_pr_bacteria | 2820587002 | 2820589117 | 85 |
| 71 | 3300000062 | IMNBL1DRAFT_c0000008 | IMNBL1DRAFT_0000008141 | 86 |
| 72 | 3300000062 | IMNBL1DRAFT_c0122021 | IMNBL1DRAFT_01220211 | 86 |
| 73 | 3300002462 | JGI24702J35022_10015311 | JGI24702J35022_100153119 | 86 |
| 74 | 3300002462 | JGI24702J35022_10017378 | JGI24702J35022_100173781 | 86 |
| 75 | 3300002462 | JGI24702J35022_10152680 | JGI24702J35022_101526803 | 86 |
| 76 | 3300002462 | JGI24702J35022_10536409 | JGI24702J35022_105364091 | 86 |
| 77 | 3300002504 | JGI24705J35276_12227363 | JGI24705J35276_122273635 | 86 |
| 78 | 3300005200 | Ga0072940_1145581 | Ga0072940_11455816 | 86 |
| 79 | 3300009784 | Ga0123357_10126231 | Ga0123357_101262313 | 86 |
| 80 | 3300009784 | Ga0123357_10266504 | Ga0123357_102665043 | 86 |
| 81 | 3300009784 | Ga0123357_10308554 | Ga0123357_103085542 | 86 |
| 82 | 3300009784 | Ga0123357_10763333 | Ga0123357_107633331 | 86 |
| 83 | 3300009784 | Ga0123357_10996969 | Ga0123357_109969692 | 86 |
| 84 | 3300009826 | Ga0123355_10000032 | Ga0123355_10000032108 | 86 |
| 85 | 3300009826 | Ga0123355_10014332 | Ga0123355_100143322 | 86 |
| 86 | 3300009826 | Ga0123355_10247904 | Ga0123355_102479041 | 86 |
| 87 | 3300009826 | Ga0123355_12039280 | Ga0123355_120392802 | 86 |
| 88 | 3300010049 | Ga0123356_10002359 | Ga0123356_100023599 | 86 |
| 89 | 3300010049 | Ga0123356_10129801 | Ga0123356_101298012 | 86 |
| 90 | 3300010049 | Ga0123356_10132448 | Ga0123356_101324481 | 86 |
| 91 | 3300010049 | Ga0123356_11114006 | Ga0123356_111140061 | 86 |
| 92 | 3300010049 | Ga0123356_11630003 | Ga0123356_116300031 | 86 |
| 93 | 3300010049 | Ga0123356_12753899 | Ga0123356_127538992 | 86 |
| 94 | 3300010049 | Ga0123356_13161613 | Ga0123356_131616132 | 86 |
| 95 | 3300010049 | Ga0123356_13827671 | Ga0123356_138276711 | 86 |
| 96 | 3300010167 | Ga0123353_10000146 | Ga0123353_1000014612 | 86 |
| 97 | 3300010167 | Ga0123353_10014340 | Ga0123353_100143405 | 86 |
| 98 | 3300010167 | Ga0123353_10683743 | Ga0123353_106837431 | 86 |
| 99 | 3300010167 | Ga0123353_11425913 | Ga0123353_114259132 | 86 |
| 100 | 3300010167 | Ga0123353_13205803 | Ga0123353_132058032 | 86 |
| 101 | 3300010882 | Ga0123354_10383399 | Ga0123354_103833992 | 86 |
| 102 | 3300010882 | Ga0123354_10963822 | Ga0123354_109638222 | 86 |
| 103 | 3300042611 | Ga0466697_032688 | Ga0466697_032688_1128_1388 | 86 |
| 104 | 3300042654 | Ga0466725_229408 | Ga0466725_229408_1557_1817 | 86 |
| 105 | 2225789003 | 2227035912 | 2227396260 | 87 |
| 106 | 2225789004 | 2227161351 | 2227571031 | 87 |
| 107 | 2225789004 | 2227475474 | 2227927027 | 87 |
| 108 | 2225789004 | 2227477131 | 2227930503 | 87 |
| 109 | 3300009784 | Ga0123357_10705418 | Ga0123357_107054182 | 87 |
| 110 | 3300010049 | Ga0123356_10238958 | Ga0123356_102389582 | 87 |
| 111 | 3300010049 | Ga0123356_10278948 | Ga0123356_102789482 | 87 |
| 112 | 3300042608 | Ga0466721_284719 | Ga0466721_284719_1514_1777 | 87 |
| 113 | 3300042659 | Ga0466733_042405 | Ga0466733_042405_1350_1613 | 87 |
| 114 | 3300000062 | IMNBL1DRAFT_c0010770 | IMNBL1DRAFT_00107706 | 88 |
| 115 | 3300000062 | IMNBL1DRAFT_c0026928 | IMNBL1DRAFT_00269283 | 88 |
| 116 | 3300000062 | IMNBL1DRAFT_c0032548 | IMNBL1DRAFT_00325482 | 88 |
| 117 | 3300000062 | IMNBL1DRAFT_c0044970 | IMNBL1DRAFT_00449703 | 88 |
| 118 | 3300010167 | Ga0123353_10063865 | Ga0123353_100638652 | 88 |
| 119 | 3300010882 | Ga0123354_10168234 | Ga0123354_101682344 | 88 |
| 120 | 3300042599 | Ga0466706_215202 | Ga0466706_215202_8889_9155 | 88 |
| 121 | 3300042609 | Ga0466722_116129 | Ga0466722_116129_979_1245 | 88 |
| 122 | 3300042609 | Ga0466722_162936 | Ga0466722_162936_1148_1414 | 88 |
| 123 | 3300042609 | Ga0466722_206860 | Ga0466722_206860_2736_3002 | 88 |
| 124 | 3300042620 | Ga0466728_229216 | Ga0466728_229216_891_1157 | 88 |
| 125 | iso_pr_bacteria | 2820134530 | 2820134705 | 88 |
| 126 | iso_pr_bacteria | 2820134530 | 2820135343 | 88 |
| 127 | 3300009826 | Ga0123355_10618962 | Ga0123355_106189623 | 89 |
| 128 | 3300010049 | Ga0123356_10531002 | Ga0123356_105310023 | 89 |
| 129 | 3300010049 | Ga0123356_11129565 | Ga0123356_111295652 | 89 |
| 130 | 3300009826 | Ga0123355_10815708 | Ga0123355_108157082 | 90 |
| 131 | 3300010049 | Ga0123356_10927322 | Ga0123356_109273222 | 90 |
| 132 | 3300042599 | Ga0466706_104056 | Ga0466706_104056_285_557 | 90 |
| 133 | 3300042603 | Ga0466714_030818 | Ga0466714_030818_241_513 | 90 |
| 134 | 3300042619 | Ga0466726_210152 | Ga0466726_210152_903_1175 | 90 |
| 135 | 3300042601 | Ga0466707_354055 | Ga0466707_354055_20462_20737 | 91 |
| 136 | 3300010049 | Ga0123356_10176583 | Ga0123356_101765833 | 93 |
| 137 | 3300000062 | IMNBL1DRAFT_c0003200 | IMNBL1DRAFT_000320012 | 94 |
| 138 | 3300042612 | Ga0466705_186309 | Ga0466705_186309_62_352 | 96 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02604 | PhdYeFM_antitox | Antitoxin Phd_YefM, type II toxin-antitoxin system | 3 | 66 | 0.9 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.43 | 0.74 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.