Protein Family IF07113

Metagenome Isolate
151 Members
51 Samples
136 Scaffolds
256.74 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_146398|Ga0466705_146398_6311_7201
Length
296 aa
Sequence
MIKTIAQTIAFSCMLMEINIGTSGIKTLGTNYTFWREKMGIIEKMRLDDKKTLVTGGARGIGYTIALALAEAGADVAIVDTDGETAQKSAEDIAAATGRRTLALKTDVTQKAGVDAMIADMLKAFGRIDAAFCNAGICMNIPAEEMSLEDWNKVITINLTGVFLTAQAAGKVMIRQGGGSIINTASMSAHIVNVPQPQCSYNASKAGVIQLTKSLAVEWALKKVRVNSISPGYIGTDLIQNSPALRPLIEQWNAMAPLKRLGRPDELQAIAVYLAGDSSAFTTGSDFVIDGAFTCI

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 27.5%
Termitidae 25.5%
Blattidae 19.6%
Unclassified 9.8%
Rhinotermitidae 5.9%
Termopsidae 5.9%
Passalidae 3.9%
Penaeidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
2 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
3 2820951912 Unclassified Acidobacteria Emb289P4bin26 Isolate Unclassified
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
12 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
13 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
14 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
17 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 650716102 Treponema primitia ZAS-2 Isolate Unclassified
24 8082023105 Niallia sp. Man26 Isolate Penaeidae
25 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
39 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
40 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
41 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
42 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
43 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
44 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
48 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
49 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
50 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
51 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10908869 3300010049 Bacteria 1051
2 Ga0123353_10323189 3300010167 Bacteria 2340
3 Ga0123353_10851367 3300010167 Bacteria 1250
4 Ga0466735_072160 3300042624 Bacteria 1893
5 Ga0466735_115920 3300042624 Bacteria 8800
6 Ga0466727_159880 3300042655 Bacteria 1019
7 Ga0466715_501482 3300042616 Bacteria 4243
8 Ga0466690_261637 3300042590 Bacteria 6133
9 Ga0466690_388300 3300042590 Bacteria 1724
10 Ga0466696_327143 3300042596 Bacteria 2860
11 Ga0466716_294821 3300042605 Bacteria 7308
12 Ga0466716_470934 3300042605 Bacteria 15520
13 Ga0466722_027392 3300042609 Bacteria 6957
14 Ga0466722_066230 3300042609 Bacteria 1171
15 Ga0466722_104506 3300042609 Bacteria 4389
16 Ga0466722_172058 3300042609 Bacteria 3524
17 Ga0466705_146398 3300042612 Bacteria 14014
18 Ga0123355_10178058 3300009826 Bacteria 3162
19 Ga0123356_10000896 3300010049 Bacteria 32939
20 Ga0123356_10182259 3300010049 Bacteria 2123
21 Ga0123353_10393665 3300010167 Bacteria 2066
22 Ga0466703_075136 3300042636 Bacteria 6705
23 Ga0466704_026607 3300042643 Bacteria 1682
24 Ga0466704_051831 3300042643 Bacteria 6756
25 Ga0466724_66455 3300042649 Bacteria 1781
26 Ga0466708_143915 3300042652 Bacteria 6385
27 Ga0466727_324103 3300042655 Bacteria 10514
28 Ga0466711_131685 3300042615 Bacteria 23580
29 Ga0466715_128287 3300042616 Bacteria 12480
30 Ga0466715_172587 3300042616 Unclassified 4079
31 Ga0466656_276204 3300042550 Bacteria 1223
32 Ga0466690_105115 3300042590 Bacteria 1562
33 Ga0466707_397639 3300042601 Bacteria 8798
34 Ga0466719_561103 3300042606 Bacteria 2119
35 Ga0466722_090546 3300042609 Bacteria 4833
36 Ga0466722_220336 3300042609 Bacteria 5814
37 2227080796 2225789004 Bacteria 41356
38 IMNBL1DRAFT_c0001391 3300000062 Bacteria 18187
39 JGI24702J35022_10102897 3300002462 Bacteria 1565
40 Ga0466705_082747 3300042612 Bacteria 9066
41 Ga0123356_10151129 3300010049 Bacteria 2305
42 Ga0466731_027736 3300042622 Bacteria 1482
43 Ga0466703_259873 3300042636 Bacteria 8541
44 Ga0466703_264323 3300042636 Bacteria 1111
45 Ga0466704_083254 3300042643 Bacteria 2463
46 Ga0466704_125093 3300042643 Bacteria 12596
47 Ga0466708_170909 3300042652 Bacteria 55846
48 Ga0466708_195641 3300042652 Bacteria 1511
49 Ga0466708_236913 3300042652 Bacteria 1731
50 Ga0466708_339144 3300042652 Bacteria 2810
51 Ga0466725_426949 3300042654 Bacteria 2565
52 Ga0466705_516535 3300042612 Bacteria 1915
53 Ga0466711_205840 3300042615 Bacteria 1498
54 Ga0466711_450331 3300042615 Bacteria 6529
55 Ga0466723_032419 3300042618 Bacteria 2833
56 Ga0466726_179551 3300042619 Bacteria 1359
57 Ga0466726_296028 3300042619 Bacteria 1226
58 Ga0466728_156664 3300042620 Bacteria 2457
59 Ga0466690_221812 3300042590 Unclassified 1349
60 Ga0466707_312162 3300042601 Bacteria 2185
61 Ga0466713_067214 3300042602 Bacteria 19076
62 Ga0466716_462024 3300042605 Bacteria 9069
63 Ga0123355_10002078 3300009826 Unclassified 28247
64 Ga0123355_10667501 3300009826 Bacteria 1207
65 Ga0123356_10286761 3300010049 Unclassified 1745
66 Ga0466703_177815 3300042636 Bacteria 53686
67 Ga0466709_136674 3300042648 Unclassified 4154
68 Ga0466727_317928 3300042655 Bacteria 2723
69 Ga0466705_495146 3300042612 Bacteria 1297
70 Ga0466711_089119 3300042615 Bacteria 5980
71 Ga0466711_159149 3300042615 Bacteria 29015
72 Ga0466726_482695 3300042619 Bacteria 2569
73 Ga0456237_0017736 3300041968 Bacteria 997
74 Ga0466691_179970 3300042593 Bacteria 1591
75 Ga0466691_181172 3300042593 Bacteria 5046
76 Ga0466696_188930 3300042596 Bacteria 8331
77 Ga0466707_159515 3300042601 Bacteria 1749
78 Ga0466716_135027 3300042605 Bacteria 10267
79 Ga0466719_202741 3300042606 Unclassified 1094
80 Ga0466705_059286 3300042612 Bacteria 1851
81 Ga0466705_110771 3300042612 Bacteria 7742
82 Ga0123357_10014646 3300009784 Bacteria 10244
83 Ga0123357_10420900 3300009784 Bacteria 1192
84 Ga0123357_10447888 3300009784 Bacteria 1123
85 Ga0466708_082191 3300042652 Bacteria 3804
86 Ga0466727_170924 3300042655 Bacteria 1780
87 Ga0466715_122371 3300042616 Bacteria 7592
88 Ga0466715_476366 3300042616 Bacteria 5243
89 Ga0466728_434391 3300042620 Bacteria 1440
90 Ga0466692_114726 3300042591 Unclassified 7993
91 Ga0466693_209989 3300042592 Bacteria 1417
92 Ga0466696_119011 3300042596 Bacteria 3102
93 Ga0466719_049577 3300042606 Bacteria 18486
94 Ga0466722_021401 3300042609 Bacteria 2075
95 Ga0466705_110822 3300042612 Bacteria 5865
96 Ga0123356_10696435 3300010049 Bacteria 1185
97 Ga0466727_265750 3300042655 Bacteria 36805
98 Ga0466711_441473 3300042615 Bacteria 41991
99 Ga0466715_011382 3300042616 Bacteria 12248
100 Ga0466726_282159 3300042619 Bacteria 1155
101 Ga0466728_230349 3300042620 Bacteria 10810
102 Ga0466728_413874 3300042620 Bacteria 1699
103 Ga0466707_304624 3300042601 Bacteria 2473
104 Ga0466713_147787 3300042602 Bacteria 1374
105 Ga0466719_055778 3300042606 Bacteria 11497
106 Ga0466719_183437 3300042606 Bacteria 10750
107 Ga0466722_018803 3300042609 Bacteria 3643
108 Ga0466722_087815 3300042609 Bacteria 1962
109 Ga0123355_10642681 3300009826 Bacteria 1241
110 Ga0123353_11032190 3300010167 Bacteria 1101
111 Ga0466703_176327 3300042636 Bacteria 10615
112 Ga0466704_002246 3300042643 Unclassified 6650
113 Ga0466709_061667 3300042648 Bacteria 4860
114 Ga0466708_055671 3300042652 Bacteria 8987
115 Ga0466708_418480 3300042652 Bacteria 4344
116 Ga0466727_023768 3300042655 Bacteria 6481
117 Ga0466727_213751 3300042655 Bacteria 1909
118 Ga0466723_038427 3300042618 Bacteria 2362
119 Ga0466723_150254 3300042618 Bacteria 4827
120 Ga0466723_268486 3300042618 Bacteria 6452
121 Ga0466726_184995 3300042619 Bacteria 12877
122 Ga0466728_019213 3300042620 Bacteria 2599
123 Ga0466701_052188 3300042598 Bacteria 1617
124 Ga0466716_047375 3300042605 Bacteria 16790
125 Ga0466733_075052 3300042659 Bacteria 2120
126 Ga0466733_194712 3300042659 Bacteria 1385
127 Ga0123357_10136766 3300009784 Bacteria 3027
128 Ga0123355_10735780 3300009826 Bacteria 1120
129 Ga0466735_013149 3300042624 Bacteria 8529
130 Ga0466704_350964 3300042643 Bacteria 1696
131 Ga0466715_139361 3300042616 Bacteria 13505
132 Ga0466726_269031 3300042619 Bacteria 10695
133 Ga0466728_233143 3300042620 Bacteria 4580
134 Ga0466696_077730 3300042596 Bacteria 3911
135 Ga0466713_126431 3300042602 Bacteria 15408
136 Ga0123357_10000611 3300009784 Bacteria 35432

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10667501 Ga0123355_106675011 221
2 3300042606 Ga0466719_055778 Ga0466719_055778_1880_2653 237
3 3300042609 Ga0466722_027392 Ga0466722_027392_5235_6011 237
4 3300042652 Ga0466708_055671 Ga0466708_055671_201_977 237
5 2225789004 2227080796 2227454301 238
6 3300042596 Ga0466696_188930 Ga0466696_188930_2127_2903 238
7 3300042643 Ga0466704_350964 Ga0466704_350964_852_1601 238
8 3300042652 Ga0466708_143915 Ga0466708_143915_2362_3138 238
9 3300009784 Ga0123357_10420900 Ga0123357_104209002 239
10 3300042612 Ga0466705_110822 Ga0466705_110822_3527_4306 240
11 3300042615 Ga0466711_159149 Ga0466711_159149_4566_5342 240
12 3300042602 Ga0466713_067214 Ga0466713_067214_6272_7039 241
13 3300009784 Ga0123357_10014646 Ga0123357_100146469 243
14 3300042612 Ga0466705_495146 Ga0466705_495146_550_1281 243
15 3300042618 Ga0466723_150254 Ga0466723_150254_3223_4011 244
16 3300042605 Ga0466716_047375 Ga0466716_047375_11499_12287 245
17 3300002462 JGI24702J35022_10102897 JGI24702J35022_101028972 246
18 3300042643 Ga0466704_051831 Ga0466704_051831_1766_2560 249
19 3300042643 Ga0466704_083254 Ga0466704_083254_546_1295 249
20 3300042602 Ga0466713_126431 Ga0466713_126431_9238_9990 250
21 3300009784 Ga0123357_10000611 Ga0123357_1000061112 251
22 3300042596 Ga0466696_327143 Ga0466696_327143_258_1034 251
23 3300042596 Ga0466696_119011 Ga0466696_119011_1892_2650 252
24 3300042620 Ga0466728_434391 Ga0466728_434391_362_1138 253
25 3300009826 Ga0123355_10642681 Ga0123355_106426811 254
26 3300042624 Ga0466735_072160 Ga0466735_072160_1106_1876 256
27 3300041968 Ga0456237_0017736 Ga0456237_0017736_77_853 258
28 3300042550 Ga0466656_276204 Ga0466656_276204_275_1051 258
29 3300042590 Ga0466690_105115 Ga0466690_105115_189_965 258
30 3300042590 Ga0466690_221812 Ga0466690_221812_139_915 258
31 3300042590 Ga0466690_388300 Ga0466690_388300_219_995 258
32 3300042591 Ga0466692_114726 Ga0466692_114726_404_1180 258
33 3300042592 Ga0466693_209989 Ga0466693_209989_515_1291 258
34 3300042593 Ga0466691_179970 Ga0466691_179970_777_1553 258
35 3300042596 Ga0466696_077730 Ga0466696_077730_1838_2614 258
36 3300042598 Ga0466701_052188 Ga0466701_052188_24_800 258
37 3300042601 Ga0466707_159515 Ga0466707_159515_515_1291 258
38 3300042601 Ga0466707_312162 Ga0466707_312162_978_1754 258
39 3300042601 Ga0466707_397639 Ga0466707_397639_5075_5851 258
40 3300042605 Ga0466716_135027 Ga0466716_135027_8909_9685 258
41 3300042605 Ga0466716_294821 Ga0466716_294821_4881_5657 258
42 3300042605 Ga0466716_462024 Ga0466716_462024_6846_7622 258
43 3300042605 Ga0466716_470934 Ga0466716_470934_5084_5860 258
44 3300042606 Ga0466719_049577 Ga0466719_049577_5085_5861 258
45 3300042606 Ga0466719_183437 Ga0466719_183437_855_1631 258
46 3300042606 Ga0466719_202741 Ga0466719_202741_258_1034 258
47 3300042606 Ga0466719_561103 Ga0466719_561103_1041_1817 258
48 3300042609 Ga0466722_018803 Ga0466722_018803_2560_3336 258
49 3300042609 Ga0466722_021401 Ga0466722_021401_979_1755 258
50 3300042609 Ga0466722_066230 Ga0466722_066230_374_1150 258
51 3300042609 Ga0466722_087815 Ga0466722_087815_61_837 258
52 3300042609 Ga0466722_090546 Ga0466722_090546_1281_2057 258
53 3300042609 Ga0466722_104506 Ga0466722_104506_1048_1824 258
54 3300042609 Ga0466722_172058 Ga0466722_172058_1718_2494 258
55 3300042609 Ga0466722_220336 Ga0466722_220336_270_1046 258
56 3300042612 Ga0466705_059286 Ga0466705_059286_589_1365 258
57 3300042612 Ga0466705_516535 Ga0466705_516535_852_1628 258
58 3300042615 Ga0466711_089119 Ga0466711_089119_4936_5712 258
59 3300042615 Ga0466711_131685 Ga0466711_131685_2064_2840 258
60 3300042615 Ga0466711_205840 Ga0466711_205840_353_1129 258
61 3300042615 Ga0466711_450331 Ga0466711_450331_169_945 258
62 3300042616 Ga0466715_011382 Ga0466715_011382_4716_5492 258
63 3300042616 Ga0466715_122371 Ga0466715_122371_2100_2876 258
64 3300042616 Ga0466715_139361 Ga0466715_139361_2587_3363 258
65 3300042616 Ga0466715_172587 Ga0466715_172587_3256_4032 258
66 3300042616 Ga0466715_476366 Ga0466715_476366_3185_3961 258
67 3300042616 Ga0466715_501482 Ga0466715_501482_1788_2564 258
68 3300042618 Ga0466723_032419 Ga0466723_032419_1736_2512 258
69 3300042618 Ga0466723_268486 Ga0466723_268486_4680_5456 258
70 3300042619 Ga0466726_179551 Ga0466726_179551_342_1118 258
71 3300042619 Ga0466726_184995 Ga0466726_184995_4915_5691 258
72 3300042619 Ga0466726_269031 Ga0466726_269031_8540_9316 258
73 3300042619 Ga0466726_296028 Ga0466726_296028_180_956 258
74 3300042620 Ga0466728_019213 Ga0466728_019213_653_1429 258
75 3300042620 Ga0466728_233143 Ga0466728_233143_3545_4321 258
76 3300042620 Ga0466728_413874 Ga0466728_413874_640_1416 258
77 3300042622 Ga0466731_027736 Ga0466731_027736_346_1122 258
78 3300042624 Ga0466735_013149 Ga0466735_013149_2339_3115 258
79 3300042624 Ga0466735_115920 Ga0466735_115920_5932_6708 258
80 3300042636 Ga0466703_075136 Ga0466703_075136_2158_2934 258
81 3300042636 Ga0466703_176327 Ga0466703_176327_3031_3807 258
82 3300042636 Ga0466703_177815 Ga0466703_177815_43573_44349 258
83 3300042636 Ga0466703_259873 Ga0466703_259873_4502_5278 258
84 3300042636 Ga0466703_264323 Ga0466703_264323_161_937 258
85 3300042643 Ga0466704_026607 Ga0466704_026607_60_836 258
86 3300042643 Ga0466704_125093 Ga0466704_125093_4143_4919 258
87 3300042648 Ga0466709_061667 Ga0466709_061667_1000_1776 258
88 3300042648 Ga0466709_136674 Ga0466709_136674_1969_2745 258
89 3300042649 Ga0466724_66455 Ga0466724_66455_912_1688 258
90 3300042652 Ga0466708_082191 Ga0466708_082191_1635_2411 258
91 3300042652 Ga0466708_170909 Ga0466708_170909_18445_19221 258
92 3300042652 Ga0466708_195641 Ga0466708_195641_201_977 258
93 3300042652 Ga0466708_418480 Ga0466708_418480_391_1167 258
94 3300042654 Ga0466725_426949 Ga0466725_426949_320_1096 258
95 3300042655 Ga0466727_023768 Ga0466727_023768_4009_4785 258
96 3300042655 Ga0466727_170924 Ga0466727_170924_611_1387 258
97 3300042655 Ga0466727_213751 Ga0466727_213751_976_1752 258
98 3300042655 Ga0466727_265750 Ga0466727_265750_25449_26225 258
99 3300042655 Ga0466727_324103 Ga0466727_324103_1070_1846 258
100 iso_pr_bacteria 2820332331 2820333706 258
101 iso_pr_bacteria 2940230426 2940230812 258
102 iso_pr_bacteria 2940233634 2940233781 258
103 iso_pr_bacteria 2940277027 2940277929 258
104 iso_pr_bacteria 2940280053 2940281347 258
105 iso_pr_bacteria 2940283334 2940283481 258
106 iso_pr_bacteria 2940286528 2940287392 258
107 iso_pr_bacteria 2940289514 2940290913 258
108 iso_pr_bacteria 2940292506 2940294088 258
109 iso_pr_bacteria 2940295490 2940296913 258
110 iso_pr_bacteria 2944625312 2944626623 258
111 iso_pr_bacteria 650716102 650883972 258
112 iso_pr_bacteria 8082023105 8082027572 258
113 3300000062 IMNBL1DRAFT_c0001391 IMNBL1DRAFT_000139118 259
114 3300009784 Ga0123357_10447888 Ga0123357_104478881 259
115 3300009826 Ga0123355_10002078 Ga0123355_100020788 259
116 3300009826 Ga0123355_10178058 Ga0123355_101780585 259
117 3300009826 Ga0123355_10735780 Ga0123355_107357801 259
118 3300010049 Ga0123356_10000896 Ga0123356_1000089618 259
119 3300010049 Ga0123356_10151129 Ga0123356_101511292 259
120 3300010049 Ga0123356_10286761 Ga0123356_102867613 259
121 3300010049 Ga0123356_10696435 Ga0123356_106964352 259
122 3300010167 Ga0123353_10323189 Ga0123353_103231892 259
123 3300010167 Ga0123353_10393665 Ga0123353_103936653 259
124 3300010167 Ga0123353_10851367 Ga0123353_108513672 259
125 3300010167 Ga0123353_11032190 Ga0123353_110321902 259
126 3300042616 Ga0466715_128287 Ga0466715_128287_9602_10381 259
127 3300042618 Ga0466723_038427 Ga0466723_038427_1508_2287 259
128 3300042619 Ga0466726_482695 Ga0466726_482695_638_1417 259
129 3300042652 Ga0466708_339144 Ga0466708_339144_879_1658 259
130 3300042655 Ga0466727_159880 Ga0466727_159880_91_870 259
131 3300042659 Ga0466733_075052 Ga0466733_075052_509_1288 259
132 3300042659 Ga0466733_194712 Ga0466733_194712_372_1151 259
133 iso_pr_bacteria 2529293168 2531452945 259
134 iso_pr_bacteria 2820951912 2820954653 259
135 3300042593 Ga0466691_181172 Ga0466691_181172_2714_3496 260
136 3300042601 Ga0466707_304624 Ga0466707_304624_573_1355 260
137 3300042602 Ga0466713_147787 Ga0466713_147787_239_1021 260
138 3300042612 Ga0466705_110771 Ga0466705_110771_5845_6627 260
139 3300042652 Ga0466708_236913 Ga0466708_236913_207_989 260
140 3300042655 Ga0466727_317928 Ga0466727_317928_1124_1906 260
141 3300010049 Ga0123356_10908869 Ga0123356_109088691 261
142 3300042620 Ga0466728_156664 Ga0466728_156664_162_950 262
143 3300042620 Ga0466728_230349 Ga0466728_230349_3928_4716 262
144 3300042643 Ga0466704_002246 Ga0466704_002246_1818_2612 264
145 3300042612 Ga0466705_082747 Ga0466705_082747_6415_7230 271
146 3300010049 Ga0123356_10182259 Ga0123356_101822592 273
147 3300009784 Ga0123357_10136766 Ga0123357_101367663 274
148 3300042590 Ga0466690_261637 Ga0466690_261637_4186_5013 275
149 3300042619 Ga0466726_282159 Ga0466726_282159_12_842 276
150 3300042615 Ga0466711_441473 Ga0466711_441473_28232_29065 277
151 3300042612 Ga0466705_146398 Ga0466705_146398_6311_7201 296

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 58 293 0.96
PF00106 adh_short short chain dehydrogenase 51 242 0.95
PF08659 KR KR domain 53 189 0.8
PF23441 47 242 0.76

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.