Protein Family IF07109

Metagenome Metatranscriptome Isolate
118 Members
46 Samples
113 Scaffolds
222.75 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_130950|Ga0466705_130950_2296_3075
Length
259 aa
Sequence
MSNAGERVSINELINNFIRNNRKAIFICLGILVAGLVGFIAVISITDVVRGKAIGRVEEFNRRYEALRFDIGEESKAAEVADLVRDLTAFAEKTSGYAGGRAWSIIGSIHADKKEWQEAERAFTSAGKTAAKTYLAPVVYFNAAVAAEEQGNITGAIDVYTRCVAQSAVFPAAVRAQFAIARLQETQGDREAALEAYRAVTGGWPNDAVWTNLAHSRIILLEAGGETIIAEPLASEPEAAAEGQGNPPEASGDVKPAVD

📊 Sample Types

Isolate 4.2%
Metagenome 94.1%
MAG 0.0%
Metatranscriptome 1.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.0%
Kalotermitidae 31.1%
Unclassified 11.1%
Termopsidae 8.9%
Rhinotermitidae 6.7%
Blaberidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
2 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
40 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
41 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
45 2772190975 Treponema sp. RmG30 Isolate Blaberidae
46 650716102 Treponema primitia ZAS-2 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10000746 3300002449 Bacteria 16021
2 JGI24695J34938_10003052 3300002450 Bacteria 11995
3 Ga0466691_016113 3300042593 Bacteria 13928
4 Ga0466691_085850 3300042593 Bacteria 6918
5 Ga0466691_180339 3300042593 Bacteria 4257
6 Ga0466719_047863 3300042606 Bacteria 20109
7 Ga0466715_343766 3300042616 Bacteria 2441
8 Ga0466715_419768 3300042616 Bacteria 4275
9 Ga0466726_000464 3300042619 Bacteria 14213
10 Ga0123353_10223259 3300010167 Bacteria 2944
11 Ga0123353_10402543 3300010167 Bacteria 2036
12 Ga0123353_10697782 3300010167 Bacteria 1425
13 Ga0466705_091160 3300042612 Bacteria 7851
14 JGI24695J34938_10001029 3300002450 Bacteria 25243
15 Ga0072941_1018931 3300005201 Bacteria 3270
16 Ga0466690_120106 3300042590 Bacteria 4223
17 Ga0466694_153157 3300042594 Bacteria 6281
18 Ga0466696_030377 3300042596 Unclassified 2799
19 Ga0466696_341029 3300042596 Bacteria 3097
20 Ga0466722_070241 3300042609 Bacteria 2532
21 Ga0466715_441609 3300042616 Bacteria 4640
22 Ga0466726_453369 3300042619 Bacteria 2883
23 Ga0466731_245882 3300042622 Bacteria 2126
24 Ga0466703_007784 3300042636 Bacteria 8165
25 Ga0466703_081386 3300042636 Bacteria 31630
26 Ga0466703_128607 3300042636 Bacteria 16421
27 Ga0466704_440467 3300042643 Bacteria 11523
28 Ga0466709_113668 3300042648 Bacteria 27100
29 Ga0466705_014762 3300042612 Unclassified 1626
30 Ga0466733_076691 3300042659 Bacteria 3641
31 Ga0072941_1089541 3300005201 Bacteria 10748
32 Ga0466691_202726 3300042593 Bacteria 11524
33 Ga0466696_456573 3300042596 Bacteria 20856
34 Ga0466699_037268 3300042597 Bacteria 7007
35 Ga0466700_173226 3300042600 Bacteria 2655
36 Ga0466707_007330 3300042601 Bacteria 1187
37 Ga0466707_086649 3300042601 Bacteria 1342
38 Ga0466722_226449 3300042609 Bacteria 2797
39 Ga0466715_578524 3300042616 Bacteria 4686
40 Ga0466723_187678 3300042618 Bacteria 4157
41 Ga0466726_026746 3300042619 Bacteria 13331
42 Ga0466726_078508 3300042619 Bacteria 1845
43 Ga0466726_461910 3300042619 Bacteria 1913
44 Ga0466735_077485 3300042624 Bacteria 4213
45 Ga0466703_055259 3300042636 Bacteria 10933
46 Ga0123356_10033173 3300010049 Bacteria 4828
47 Ga0466705_130950 3300042612 Bacteria 5580
48 Ga0255809_1115036 3300022820 Bacteria 869
49 Ga0415639_043091 3300038395 Bacteria 2966
50 Ga0415639_056744 3300038395 Bacteria 1632
51 Ga0466719_125359 3300042606 Bacteria 30640
52 Ga0466722_085836 3300042609 Bacteria 5856
53 Ga0466712_313356 3300042614 Bacteria 4776
54 Ga0466711_253005 3300042615 Bacteria 37030
55 Ga0466709_253914 3300042648 Bacteria 20795
56 Ga0466708_261072 3300042652 Bacteria 8511
57 Ga0466705_050176 3300042612 Bacteria 15440
58 JGI24695J34938_10003013 3300002450 Bacteria 12111
59 JGI24695J34938_10065746 3300002450 Bacteria 1531
60 Ga0072940_1035441 3300005200 Bacteria 2659
61 Ga0222431_1001617 3300021190 Bacteria 3117
62 Ga0466690_225073 3300042590 Bacteria 1817
63 Ga0466695_015501 3300042595 Bacteria 1723
64 Ga0466707_342250 3300042601 Bacteria 1074
65 Ga0466722_022288 3300042609 Bacteria 20823
66 Ga0466722_074173 3300042609 Bacteria 6630
67 Ga0466715_423323 3300042616 Bacteria 20180
68 Ga0466718_085167 3300042617 Bacteria 24752
69 Ga0466728_323641 3300042620 Bacteria 18997
70 Ga0466729_236125 3300042621 Bacteria 1439
71 Ga0466708_261169 3300042652 Bacteria 1869
72 JGI24702J35022_10017035 3300002462 Bacteria 3976
73 Ga0068302_10105398 3300005071 Bacteria 1448
74 Ga0466694_239884 3300042594 Bacteria 2238
75 Ga0466694_243078 3300042594 Bacteria 5807
76 Ga0466716_282260 3300042605 Bacteria 6533
77 Ga0466722_248753 3300042609 Bacteria 2424
78 Ga0466711_082715 3300042615 Bacteria 1719
79 Ga0466726_423363 3300042619 Bacteria 9657
80 Ga0466703_380790 3300042636 Bacteria 2193
81 Ga0466708_024982 3300042652 Bacteria 42348
82 Ga0466708_064422 3300042652 Bacteria 47318
83 Ga0466708_183742 3300042652 Bacteria 3300
84 Ga0466727_101389 3300042655 Bacteria 2254
85 Ga0123353_11191470 3300010167 Bacteria 1000
86 JGI24695J34938_10001064 3300002450 Bacteria 24848
87 Ga0466699_055892 3300042597 Bacteria 17638
88 Ga0466711_493772 3300042615 Bacteria 25744
89 Ga0466715_420362 3300042616 Bacteria 36991
90 Ga0466715_428670 3300042616 Bacteria 32474
91 Ga0466723_053260 3300042618 Bacteria 1314
92 Ga0466723_257807 3300042618 Bacteria 1979
93 Ga0466704_556212 3300042643 Bacteria 20369
94 Ga0466704_621250 3300042643 Bacteria 23591
95 Ga0466708_235833 3300042652 Bacteria 24736
96 Ga0415639_027878 3300038395 Bacteria 1861
97 Ga0466690_382777 3300042590 Bacteria 1056
98 Ga0466692_146071 3300042591 Bacteria 2390
99 Ga0466694_145572 3300042594 Bacteria 1853
100 Ga0466699_192343 3300042597 Bacteria 2436
101 Ga0466707_135039 3300042601 Bacteria 1156
102 Ga0466716_216485 3300042605 Bacteria 1111
103 Ga0466716_454359 3300042605 Bacteria 3302
104 Ga0466720_088730 3300042607 Unclassified 1352
105 Ga0466722_243243 3300042609 Bacteria 8921
106 Ga0466718_109215 3300042617 Bacteria 9195
107 Ga0466728_079556 3300042620 Bacteria 2117
108 Ga0466728_365242 3300042620 Bacteria 5789
109 Ga0466729_172982 3300042621 Bacteria 2693
110 Ga0466731_236259 3300042622 Bacteria 2521
111 Ga0466735_055890 3300042624 Bacteria 8895
112 Ga0466708_300512 3300042652 Bacteria 25602
113 Ga0466708_397974 3300042652 Bacteria 25866

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_016113 Ga0466691_016113_12335_13027 176
2 3300042612 Ga0466705_014762 Ga0466705_014762_56_748 188
3 3300042616 Ga0466715_578524 Ga0466715_578524_3681_4412 189
4 3300042596 Ga0466696_456573 Ga0466696_456573_9330_10061 193
5 3300042652 Ga0466708_261072 Ga0466708_261072_7059_7733 197
6 3300042648 Ga0466709_253914 Ga0466709_253914_1667_2344 198
7 3300042652 Ga0466708_024982 Ga0466708_024982_11124_11801 198
8 3300042617 Ga0466718_109215 Ga0466718_109215_6289_6984 206
9 3300002450 JGI24695J34938_10003013 JGI24695J34938_100030135 208
10 3300042597 Ga0466699_037268 Ga0466699_037268_4081_4779 208
11 3300042622 Ga0466731_245882 Ga0466731_245882_1226_1900 208
12 3300042643 Ga0466704_621250 Ga0466704_621250_8137_8829 208
13 3300002450 JGI24695J34938_10001029 JGI24695J34938_1000102920 209
14 3300042601 Ga0466707_135039 Ga0466707_135039_367_1071 209
15 3300042636 Ga0466703_380790 Ga0466703_380790_957_1634 210
16 3300002450 JGI24695J34938_10003052 JGI24695J34938_100030528 211
17 3300002450 JGI24695J34938_10065746 JGI24695J34938_100657461 211
18 3300042615 Ga0466711_253005 Ga0466711_253005_1434_2120 211
19 3300042622 Ga0466731_236259 Ga0466731_236259_1161_1832 211
20 3300042655 Ga0466727_101389 Ga0466727_101389_1538_2209 212
21 3300038395 Ga0415639_027878 Ga0415639_027878_1131_1808 213
22 3300042593 Ga0466691_180339 Ga0466691_180339_1242_1931 214
23 3300042616 Ga0466715_428670 Ga0466715_428670_21850_22569 214
24 3300042620 Ga0466728_365242 Ga0466728_365242_2516_3208 214
25 3300042605 Ga0466716_454359 Ga0466716_454359_2041_2736 215
26 3300038395 Ga0415639_043091 Ga0415639_043091_717_1421 218
27 3300021190 Ga0222431_1001617 Ga0222431_10016173 219
28 3300042607 Ga0466720_088730 Ga0466720_088730_47_748 219
29 3300010167 Ga0123353_10697782 Ga0123353_106977822 220
30 3300042593 Ga0466691_085850 Ga0466691_085850_1533_2225 220
31 3300042596 Ga0466696_341029 Ga0466696_341029_986_1681 220
32 3300002449 JGI24698J34947_10000746 JGI24698J34947_1000074610 221
33 3300042590 Ga0466690_120106 Ga0466690_120106_623_1348 221
34 3300042620 Ga0466728_079556 Ga0466728_079556_503_1195 221
35 3300042621 Ga0466729_236125 Ga0466729_236125_266_931 221
36 3300042600 Ga0466700_173226 Ga0466700_173226_739_1407 222
37 3300042609 Ga0466722_070241 Ga0466722_070241_267_935 222
38 3300042609 Ga0466722_226449 Ga0466722_226449_759_1427 222
39 3300042595 Ga0466695_015501 Ga0466695_015501_791_1462 223
40 3300042605 Ga0466716_282260 Ga0466716_282260_5090_5761 223
41 3300042609 Ga0466722_248753 Ga0466722_248753_130_801 223
42 3300042614 Ga0466712_313356 Ga0466712_313356_2710_3381 223
43 3300042616 Ga0466715_423323 Ga0466715_423323_18501_19172 223
44 3300042618 Ga0466723_053260 Ga0466723_053260_523_1218 223
45 3300042620 Ga0466728_323641 Ga0466728_323641_2505_3197 223
46 3300042652 Ga0466708_300512 Ga0466708_300512_16231_16902 223
47 3300042594 Ga0466694_145572 Ga0466694_145572_68_769 224
48 3300042609 Ga0466722_243243 Ga0466722_243243_2900_3649 224
49 3300042616 Ga0466715_420362 Ga0466715_420362_14168_14842 224
50 3300042617 Ga0466718_085167 Ga0466718_085167_8335_9009 224
51 3300042619 Ga0466726_078508 Ga0466726_078508_503_1177 224
52 3300042619 Ga0466726_453369 Ga0466726_453369_2038_2712 224
53 3300042619 Ga0466726_461910 Ga0466726_461910_294_968 224
54 3300010049 Ga0123356_10033173 Ga0123356_100331733 225
55 3300042590 Ga0466690_225073 Ga0466690_225073_796_1518 225
56 3300042590 Ga0466690_382777 Ga0466690_382777_319_996 225
57 3300042593 Ga0466691_202726 Ga0466691_202726_6092_6769 225
58 3300042594 Ga0466694_243078 Ga0466694_243078_4403_5080 225
59 3300042601 Ga0466707_342250 Ga0466707_342250_385_1062 225
60 3300042605 Ga0466716_216485 Ga0466716_216485_309_986 225
61 3300042606 Ga0466719_047863 Ga0466719_047863_12876_13649 225
62 3300042618 Ga0466723_187678 Ga0466723_187678_871_1548 225
63 3300042652 Ga0466708_261169 Ga0466708_261169_779_1456 225
64 3300042652 Ga0466708_397974 Ga0466708_397974_24779_25456 225
65 3300010167 Ga0123353_11191470 Ga0123353_111914701 226
66 3300038395 Ga0415639_056744 Ga0415639_056744_195_914 226
67 3300042601 Ga0466707_007330 Ga0466707_007330_370_1050 226
68 3300042612 Ga0466705_091160 Ga0466705_091160_1020_1727 226
69 3300042615 Ga0466711_493772 Ga0466711_493772_13067_13747 226
70 3300042619 Ga0466726_026746 Ga0466726_026746_3992_4672 226
71 3300042636 Ga0466703_128607 Ga0466703_128607_6418_7098 226
72 3300042659 Ga0466733_076691 Ga0466733_076691_1780_2460 226
73 3300042594 Ga0466694_239884 Ga0466694_239884_1020_1721 227
74 3300042652 Ga0466708_235833 Ga0466708_235833_6083_6766 227
75 3300005071 Ga0068302_10105398 Ga0068302_101053982 228
76 3300005201 Ga0072941_1018931 Ga0072941_10189312 228
77 3300005201 Ga0072941_1089541 Ga0072941_10895418 228
78 3300010167 Ga0123353_10402543 Ga0123353_104025432 228
79 3300022820 Ga0255809_1115036 Ga0255809_11150362 228
80 3300042594 Ga0466694_153157 Ga0466694_153157_2885_3571 228
81 3300042609 Ga0466722_074173 Ga0466722_074173_2456_3142 228
82 3300042615 Ga0466711_082715 Ga0466711_082715_52_738 228
83 3300042624 Ga0466735_077485 Ga0466735_077485_3415_4170 228
84 3300042618 Ga0466723_257807 Ga0466723_257807_1200_1889 229
85 3300042621 Ga0466729_172982 Ga0466729_172982_563_1252 229
86 3300042624 Ga0466735_055890 Ga0466735_055890_2245_2934 229
87 iso_pr_bacteria 650716102 650882439 229
88 3300002462 JGI24702J35022_10017035 JGI24702J35022_100170354 230
89 3300042596 Ga0466696_030377 Ga0466696_030377_28_720 230
90 3300042612 Ga0466705_050176 Ga0466705_050176_12824_13516 230
91 3300042616 Ga0466715_343766 Ga0466715_343766_494_1186 230
92 3300042616 Ga0466715_419768 Ga0466715_419768_282_974 230
93 3300042636 Ga0466703_055259 Ga0466703_055259_769_1461 230
94 3300042636 Ga0466703_081386 Ga0466703_081386_24891_25583 230
95 3300042643 Ga0466704_440467 Ga0466704_440467_6729_7436 230
96 3300042643 Ga0466704_556212 Ga0466704_556212_1145_1837 230
97 iso_pr_bacteria 2772190975 2773722899 230
98 iso_pr_bacteria 2781125688 2781423529 230
99 3300010167 Ga0123353_10223259 Ga0123353_102232594 231
100 3300042597 Ga0466699_055892 Ga0466699_055892_2923_3618 231
101 3300042597 Ga0466699_192343 Ga0466699_192343_928_1623 231
102 3300042606 Ga0466719_125359 Ga0466719_125359_2127_2822 231
103 3300042652 Ga0466708_064422 Ga0466708_064422_24556_25251 231
104 3300042652 Ga0466708_183742 Ga0466708_183742_1764_2459 231
105 3300002450 JGI24695J34938_10001064 JGI24695J34938_1000106416 232
106 3300042591 Ga0466692_146071 Ga0466692_146071_898_1596 232
107 3300042601 Ga0466707_086649 Ga0466707_086649_475_1173 232
108 3300042619 Ga0466726_000464 Ga0466726_000464_8556_9254 232
109 3300042619 Ga0466726_423363 Ga0466726_423363_900_1598 232
110 3300042609 Ga0466722_085836 Ga0466722_085836_127_867 233
111 3300005200 Ga0072940_1035441 Ga0072940_10354412 234
112 3300042648 Ga0466709_113668 Ga0466709_113668_20116_20820 234
113 iso_pr_bacteria 2781125666 2781344222 234
114 3300042636 Ga0466703_007784 Ga0466703_007784_1115_1822 235
115 3300042609 Ga0466722_022288 Ga0466722_022288_11386_12132 240
116 3300042616 Ga0466715_441609 Ga0466715_441609_2197_2976 243
117 iso_pr_bacteria 2781125693 2781433645 243
118 3300042612 Ga0466705_130950 Ga0466705_130950_2296_3075 259

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13432 TPR_16 Tetratricopeptide repeat 142 208 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.