Protein Family IF07099
Metagenome
Isolate
163
Members
50
Samples
160
Scaffolds
235.36
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_112086|Ga0466705_112086_753_1481
- Length
- 218 aa
- Sequence
- MLKLESLSVFYGGIHALRGIDLEVADGKIITLIGANGAGKSTMLNTAMGLVKAAEGRILWDGVFPNLTVEENLRLGAYRRSDKAAIKADREKCYALFPRLKERQRQPAGTLSGGEQQMLAVARGIMTSPKLLMLDEPSLGLAPIISAMIFDIVRDINKTGTTVLLIEQNARAALEIADYAYVLETGVITMQDSGKTLLNDDRIRKAYLGESVSNRCAI
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.0%
Kalotermitidae
28.0%
Unclassified
10.0%
Rhinotermitidae
6.0%
Termopsidae
6.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
151
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 11 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 44 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 50 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_193451 | 3300042656 | Bacteria | 1872 |
| 2 | Ga0466732_371261 | 3300042656 | Unclassified | 2522 |
| 3 | Ga0466723_286733 | 3300042618 | Bacteria | 5385 |
| 4 | Ga0466700_359005 | 3300042600 | Bacteria | 1467 |
| 5 | Ga0466700_410389 | 3300042600 | Bacteria | 2687 |
| 6 | Ga0466707_194430 | 3300042601 | Bacteria | 1616 |
| 7 | Ga0466716_234663 | 3300042605 | Bacteria | 14955 |
| 8 | Ga0466719_190354 | 3300042606 | Bacteria | 3003 |
| 9 | Ga0466720_014023 | 3300042607 | Bacteria | 18380 |
| 10 | Ga0466720_108612 | 3300042607 | Bacteria | 122313 |
| 11 | Ga0466722_122282 | 3300042609 | Bacteria | 12959 |
| 12 | Ga0466731_376120 | 3300042622 | Bacteria | 1712 |
| 13 | Ga0466703_028252 | 3300042636 | Bacteria | 7507 |
| 14 | Ga0466703_263904 | 3300042636 | Bacteria | 5111 |
| 15 | Ga0466704_325436 | 3300042643 | Bacteria | 20045 |
| 16 | Ga0466708_379270 | 3300042652 | Bacteria | 6383 |
| 17 | Ga0466727_095368 | 3300042655 | Bacteria | 2591 |
| 18 | Ga0415639_053837 | 3300038395 | Bacteria | 1828 |
| 19 | Ga0466690_105288 | 3300042590 | Bacteria | 3653 |
| 20 | Ga0466694_047574 | 3300042594 | Bacteria | 1352 |
| 21 | Ga0466699_248609 | 3300042597 | Bacteria | 2348 |
| 22 | Ga0466699_311711 | 3300042597 | Bacteria | 2481 |
| 23 | Ga0466705_111602 | 3300042612 | Bacteria | 1323 |
| 24 | Ga0466705_112086 | 3300042612 | Bacteria | 12461 |
| 25 | Ga0123353_10336820 | 3300010167 | Bacteria | 2281 |
| 26 | Ga0123354_10025831 | 3300010882 | Bacteria | 9261 |
| 27 | Ga0466711_038297 | 3300042615 | Bacteria | 9911 |
| 28 | Ga0466723_325750 | 3300042618 | Bacteria | 3744 |
| 29 | Ga0466706_111148 | 3300042599 | Bacteria | 3029 |
| 30 | Ga0466720_172323 | 3300042607 | Unclassified | 1316 |
| 31 | Ga0466722_007465 | 3300042609 | Bacteria | 26514 |
| 32 | Ga0466703_052161 | 3300042636 | Bacteria | 3603 |
| 33 | Ga0466704_453911 | 3300042643 | Bacteria | 1471 |
| 34 | Ga0466657_290593 | 3300042582 | Bacteria | 1384 |
| 35 | Ga0466690_010693 | 3300042590 | Bacteria | 8227 |
| 36 | Ga0466693_167887 | 3300042592 | Bacteria | 10383 |
| 37 | Ga0466691_074389 | 3300042593 | Bacteria | 1820 |
| 38 | Ga0466696_358199 | 3300042596 | Bacteria | 4409 |
| 39 | Ga0466699_265434 | 3300042597 | Bacteria | 1970 |
| 40 | Ga0466699_272692 | 3300042597 | Bacteria | 13032 |
| 41 | Ga0123357_10192587 | 3300009784 | Bacteria | 2345 |
| 42 | Ga0123356_10788321 | 3300010049 | Bacteria | 1121 |
| 43 | Ga0123353_10441251 | 3300010167 | Bacteria | 1920 |
| 44 | Ga0123353_10616070 | 3300010167 | Bacteria | 1547 |
| 45 | Ga0466715_242579 | 3300042616 | Bacteria | 5390 |
| 46 | Ga0466723_017257 | 3300042618 | Unclassified | 6311 |
| 47 | Ga0466723_055406 | 3300042618 | Bacteria | 5148 |
| 48 | Ga0466723_272747 | 3300042618 | Bacteria | 5531 |
| 49 | Ga0466723_353916 | 3300042618 | Bacteria | 1579 |
| 50 | Ga0466726_125875 | 3300042619 | Bacteria | 2767 |
| 51 | Ga0466726_248737 | 3300042619 | Bacteria | 1765 |
| 52 | Ga0466726_309725 | 3300042619 | Bacteria | 2051 |
| 53 | Ga0466706_232144 | 3300042599 | Bacteria | 1614 |
| 54 | Ga0466719_078312 | 3300042606 | Unclassified | 2372 |
| 55 | Ga0466719_271470 | 3300042606 | Bacteria | 8292 |
| 56 | Ga0466720_138636 | 3300042607 | Unclassified | 1960 |
| 57 | Ga0466722_164741 | 3300042609 | Bacteria | 4327 |
| 58 | Ga0466698_071674 | 3300042610 | Bacteria | 4485 |
| 59 | Ga0466698_091773 | 3300042610 | Bacteria | 1777 |
| 60 | Ga0466698_443233 | 3300042610 | Bacteria | 1734 |
| 61 | Ga0466703_207462 | 3300042636 | Bacteria | 1880 |
| 62 | Ga0466704_129178 | 3300042643 | Unclassified | 7939 |
| 63 | Ga0466704_386575 | 3300042643 | Bacteria | 7800 |
| 64 | Ga0466709_394333 | 3300042648 | Bacteria | 6049 |
| 65 | Ga0466691_007955 | 3300042593 | Bacteria | 1798 |
| 66 | Ga0466694_222376 | 3300042594 | Bacteria | 1286 |
| 67 | Ga0466694_346821 | 3300042594 | Unclassified | 1163 |
| 68 | Ga0466705_046418 | 3300042612 | Bacteria | 4413 |
| 69 | Ga0123356_10124801 | 3300010049 | Bacteria | 2511 |
| 70 | Ga0123356_10760116 | 3300010049 | Bacteria | 1139 |
| 71 | Ga0123353_10140252 | 3300010167 | Bacteria | 3873 |
| 72 | Ga0466712_038485 | 3300042614 | Bacteria | 1047 |
| 73 | Ga0466715_025004 | 3300042616 | Bacteria | 13217 |
| 74 | Ga0466715_058114 | 3300042616 | Bacteria | 12665 |
| 75 | Ga0466718_152193 | 3300042617 | Bacteria | 1679 |
| 76 | Ga0466723_315815 | 3300042618 | Bacteria | 18792 |
| 77 | Ga0466723_331288 | 3300042618 | Bacteria | 6040 |
| 78 | Ga0466726_425451 | 3300042619 | Bacteria | 1617 |
| 79 | Ga0466729_003441 | 3300042621 | Bacteria | 1190 |
| 80 | Ga0466700_447520 | 3300042600 | Bacteria | 2063 |
| 81 | Ga0466716_193553 | 3300042605 | Unclassified | 18783 |
| 82 | Ga0466719_046955 | 3300042606 | Bacteria | 1805 |
| 83 | Ga0466719_110578 | 3300042606 | Bacteria | 3917 |
| 84 | Ga0466735_135114 | 3300042624 | Bacteria | 12343 |
| 85 | Ga0466735_154543 | 3300042624 | Bacteria | 6278 |
| 86 | Ga0466703_005886 | 3300042636 | Bacteria | 7527 |
| 87 | Ga0466709_333186 | 3300042648 | Bacteria | 4660 |
| 88 | Ga0466708_424675 | 3300042652 | Bacteria | 2068 |
| 89 | Ga0466727_172213 | 3300042655 | Bacteria | 1053 |
| 90 | Ga0466691_070103 | 3300042593 | Bacteria | 31827 |
| 91 | Ga0466691_091661 | 3300042593 | Bacteria | 8865 |
| 92 | Ga0466695_060902 | 3300042595 | Bacteria | 4411 |
| 93 | JGI24695J34938_10007973 | 3300002450 | Bacteria | 6112 |
| 94 | Ga0466732_442681 | 3300042656 | Bacteria | 1063 |
| 95 | Ga0466726_036078 | 3300042619 | Bacteria | 10827 |
| 96 | Ga0466726_076659 | 3300042619 | Bacteria | 16759 |
| 97 | Ga0466728_134454 | 3300042620 | Bacteria | 1193 |
| 98 | Ga0466722_002511 | 3300042609 | Bacteria | 5232 |
| 99 | Ga0466722_168284 | 3300042609 | Bacteria | 10950 |
| 100 | Ga0466735_061748 | 3300042624 | Bacteria | 1156 |
| 101 | Ga0466703_155935 | 3300042636 | Bacteria | 32957 |
| 102 | Ga0466703_363351 | 3300042636 | Bacteria | 1600 |
| 103 | Ga0466704_115725 | 3300042643 | Bacteria | 5897 |
| 104 | Ga0466704_273404 | 3300042643 | Bacteria | 1462 |
| 105 | Ga0466709_320575 | 3300042648 | Bacteria | 2941 |
| 106 | Ga0466708_451706 | 3300042652 | Bacteria | 6484 |
| 107 | Ga0466708_455811 | 3300042652 | Bacteria | 1683 |
| 108 | Ga0466690_121622 | 3300042590 | Bacteria | 13892 |
| 109 | Ga0466694_246529 | 3300042594 | Bacteria | 4228 |
| 110 | Ga0123355_10000558 | 3300009826 | Bacteria | 49958 |
| 111 | Ga0123353_10281978 | 3300010167 | Bacteria | 2551 |
| 112 | Ga0123354_10414928 | 3300010882 | Bacteria | 1125 |
| 113 | Ga0466723_059840 | 3300042618 | Bacteria | 7293 |
| 114 | Ga0466723_150825 | 3300042618 | Bacteria | 28092 |
| 115 | Ga0466723_314596 | 3300042618 | Bacteria | 1805 |
| 116 | Ga0466722_003845 | 3300042609 | Bacteria | 10604 |
| 117 | Ga0466702_440908 | 3300042635 | Bacteria | 1547 |
| 118 | Ga0466704_077659 | 3300042643 | Unclassified | 3783 |
| 119 | Ga0466704_338636 | 3300042643 | Bacteria | 15672 |
| 120 | Ga0415639_112759 | 3300038395 | Bacteria | 2596 |
| 121 | Ga0466692_041981 | 3300042591 | Bacteria | 15626 |
| 122 | Ga0466691_149024 | 3300042593 | Unclassified | 5428 |
| 123 | Ga0466699_154356 | 3300042597 | Bacteria | 1209 |
| 124 | Nasutiter_Contig13905 | 2030936001 | Bacteria | 1325 |
| 125 | JGI24698J34947_10021210 | 3300002449 | Bacteria | 3496 |
| 126 | Ga0123353_10080188 | 3300010167 | Bacteria | 5250 |
| 127 | Ga0123353_10093508 | 3300010167 | Bacteria | 4845 |
| 128 | Ga0466715_076216 | 3300042616 | Bacteria | 5367 |
| 129 | Ga0466715_492491 | 3300042616 | Bacteria | 1824 |
| 130 | Ga0466700_050114 | 3300042600 | Bacteria | 1141 |
| 131 | Ga0466707_264942 | 3300042601 | Bacteria | 4462 |
| 132 | Ga0466716_017595 | 3300042605 | Bacteria | 5705 |
| 133 | Ga0466722_073106 | 3300042609 | Bacteria | 11615 |
| 134 | Ga0466735_063319 | 3300042624 | Bacteria | 1158 |
| 135 | Ga0466709_083640 | 3300042648 | Bacteria | 2330 |
| 136 | Ga0466708_083996 | 3300042652 | Bacteria | 14281 |
| 137 | Ga0466708_142045 | 3300042652 | Bacteria | 21166 |
| 138 | Ga0466690_067746 | 3300042590 | Bacteria | 2482 |
| 139 | Ga0466692_204077 | 3300042591 | Bacteria | 6982 |
| 140 | JGI24698J34947_10000402 | 3300002449 | Bacteria | 19694 |
| 141 | Ga0466705_048026 | 3300042612 | Bacteria | 3434 |
| 142 | Ga0466705_354195 | 3300042612 | Bacteria | 15438 |
| 143 | Ga0123357_10135350 | 3300009784 | Bacteria | 3051 |
| 144 | Ga0466712_188805 | 3300042614 | Bacteria | 13038 |
| 145 | Ga0466712_299259 | 3300042614 | Bacteria | 5649 |
| 146 | Ga0466711_176079 | 3300042615 | Bacteria | 1625 |
| 147 | Ga0466714_115211 | 3300042603 | Bacteria | 3334 |
| 148 | Ga0466719_330209 | 3300042606 | Unclassified | 1245 |
| 149 | Ga0466721_391278 | 3300042608 | Bacteria | 10971 |
| 150 | Ga0466722_164416 | 3300042609 | Bacteria | 3685 |
| 151 | Ga0466698_512584 | 3300042610 | Bacteria | 1093 |
| 152 | Ga0466704_080954 | 3300042643 | Bacteria | 11536 |
| 153 | Ga0466708_327203 | 3300042652 | Bacteria | 31501 |
| 154 | Ga0466708_401033 | 3300042652 | Bacteria | 3677 |
| 155 | Ga0415639_077114 | 3300038395 | Bacteria | 3286 |
| 156 | Ga0466692_178806 | 3300042591 | Bacteria | 32596 |
| 157 | Ga0466694_269938 | 3300042594 | Unclassified | 2102 |
| 158 | Ga0466694_297402 | 3300042594 | Bacteria | 1483 |
| 159 | Ga0466696_374393 | 3300042596 | Bacteria | 19713 |
| 160 | Ga0068305_10003607 | 3300005083 | Bacteria | 4732 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042643 | Ga0466704_273404 | Ga0466704_273404_656_1267 | 203 |
| 2 | 3300042594 | Ga0466694_269938 | Ga0466694_269938_28_672 | 214 |
| 3 | 3300042594 | Ga0466694_346821 | Ga0466694_346821_502_1146 | 214 |
| 4 | 3300042612 | Ga0466705_112086 | Ga0466705_112086_753_1481 | 218 |
| 5 | 3300042652 | Ga0466708_424675 | Ga0466708_424675_1080_1772 | 230 |
| 6 | 3300042605 | Ga0466716_193553 | Ga0466716_193553_5285_5986 | 233 |
| 7 | 3300042606 | Ga0466719_110578 | Ga0466719_110578_724_1425 | 233 |
| 8 | 3300042606 | Ga0466719_190354 | Ga0466719_190354_31_732 | 233 |
| 9 | 3300042612 | Ga0466705_111602 | Ga0466705_111602_308_1009 | 233 |
| 10 | 3300042618 | Ga0466723_017257 | Ga0466723_017257_4110_4811 | 233 |
| 11 | 3300042618 | Ga0466723_325750 | Ga0466723_325750_2066_2767 | 233 |
| 12 | 3300042619 | Ga0466726_036078 | Ga0466726_036078_6734_7435 | 233 |
| 13 | 3300042619 | Ga0466726_309725 | Ga0466726_309725_581_1282 | 233 |
| 14 | 3300042636 | Ga0466703_005886 | Ga0466703_005886_5889_6590 | 233 |
| 15 | 3300042636 | Ga0466703_052161 | Ga0466703_052161_2714_3415 | 233 |
| 16 | 3300042643 | Ga0466704_077659 | Ga0466704_077659_2482_3183 | 233 |
| 17 | 3300042643 | Ga0466704_129178 | Ga0466704_129178_4008_4709 | 233 |
| 18 | 3300042652 | Ga0466708_451706 | Ga0466708_451706_4921_5622 | 233 |
| 19 | 3300010167 | Ga0123353_10080188 | Ga0123353_100801884 | 234 |
| 20 | 3300042593 | Ga0466691_149024 | Ga0466691_149024_29_733 | 234 |
| 21 | 3300042594 | Ga0466694_222376 | Ga0466694_222376_484_1188 | 234 |
| 22 | 3300042600 | Ga0466700_050114 | Ga0466700_050114_64_768 | 234 |
| 23 | 3300042600 | Ga0466700_447520 | Ga0466700_447520_344_1048 | 234 |
| 24 | 3300042610 | Ga0466698_512584 | Ga0466698_512584_123_827 | 234 |
| 25 | 3300042616 | Ga0466715_058114 | Ga0466715_058114_11800_12504 | 234 |
| 26 | 3300042618 | Ga0466723_353916 | Ga0466723_353916_182_886 | 234 |
| 27 | 3300042648 | Ga0466709_333186 | Ga0466709_333186_2728_3432 | 234 |
| 28 | 3300042648 | Ga0466709_394333 | Ga0466709_394333_4543_5247 | 234 |
| 29 | 3300042652 | Ga0466708_083996 | Ga0466708_083996_6129_6833 | 234 |
| 30 | 3300010167 | Ga0123353_10281978 | Ga0123353_102819784 | 235 |
| 31 | 3300010882 | Ga0123354_10414928 | Ga0123354_104149282 | 235 |
| 32 | 3300038395 | Ga0415639_053837 | Ga0415639_053837_445_1152 | 235 |
| 33 | 3300038395 | Ga0415639_077114 | Ga0415639_077114_1936_2643 | 235 |
| 34 | 3300042590 | Ga0466690_067746 | Ga0466690_067746_1586_2293 | 235 |
| 35 | 3300042590 | Ga0466690_105288 | Ga0466690_105288_2458_3165 | 235 |
| 36 | 3300042591 | Ga0466692_178806 | Ga0466692_178806_10979_11686 | 235 |
| 37 | 3300042593 | Ga0466691_007955 | Ga0466691_007955_603_1310 | 235 |
| 38 | 3300042593 | Ga0466691_074389 | Ga0466691_074389_757_1464 | 235 |
| 39 | 3300042593 | Ga0466691_091661 | Ga0466691_091661_5330_6037 | 235 |
| 40 | 3300042594 | Ga0466694_297402 | Ga0466694_297402_693_1400 | 235 |
| 41 | 3300042595 | Ga0466695_060902 | Ga0466695_060902_759_1466 | 235 |
| 42 | 3300042596 | Ga0466696_358199 | Ga0466696_358199_622_1329 | 235 |
| 43 | 3300042597 | Ga0466699_248609 | Ga0466699_248609_299_1006 | 235 |
| 44 | 3300042597 | Ga0466699_272692 | Ga0466699_272692_5440_6147 | 235 |
| 45 | 3300042597 | Ga0466699_311711 | Ga0466699_311711_1538_2245 | 235 |
| 46 | 3300042599 | Ga0466706_111148 | Ga0466706_111148_1889_2596 | 235 |
| 47 | 3300042599 | Ga0466706_232144 | Ga0466706_232144_863_1570 | 235 |
| 48 | 3300042600 | Ga0466700_359005 | Ga0466700_359005_66_773 | 235 |
| 49 | 3300042600 | Ga0466700_410389 | Ga0466700_410389_817_1524 | 235 |
| 50 | 3300042601 | Ga0466707_194430 | Ga0466707_194430_379_1086 | 235 |
| 51 | 3300042601 | Ga0466707_264942 | Ga0466707_264942_1271_1978 | 235 |
| 52 | 3300042605 | Ga0466716_017595 | Ga0466716_017595_1250_1957 | 235 |
| 53 | 3300042605 | Ga0466716_234663 | Ga0466716_234663_6611_7318 | 235 |
| 54 | 3300042606 | Ga0466719_046955 | Ga0466719_046955_545_1252 | 235 |
| 55 | 3300042606 | Ga0466719_078312 | Ga0466719_078312_1366_2073 | 235 |
| 56 | 3300042606 | Ga0466719_271470 | Ga0466719_271470_4131_4838 | 235 |
| 57 | 3300042606 | Ga0466719_330209 | Ga0466719_330209_514_1221 | 235 |
| 58 | 3300042608 | Ga0466721_391278 | Ga0466721_391278_9429_10136 | 235 |
| 59 | 3300042609 | Ga0466722_002511 | Ga0466722_002511_4457_5164 | 235 |
| 60 | 3300042610 | Ga0466698_071674 | Ga0466698_071674_486_1193 | 235 |
| 61 | 3300042610 | Ga0466698_443233 | Ga0466698_443233_383_1090 | 235 |
| 62 | 3300042612 | Ga0466705_046418 | Ga0466705_046418_3239_3946 | 235 |
| 63 | 3300042612 | Ga0466705_048026 | Ga0466705_048026_1245_1952 | 235 |
| 64 | 3300042612 | Ga0466705_354195 | Ga0466705_354195_4333_5040 | 235 |
| 65 | 3300042615 | Ga0466711_176079 | Ga0466711_176079_506_1213 | 235 |
| 66 | 3300042616 | Ga0466715_076216 | Ga0466715_076216_149_856 | 235 |
| 67 | 3300042616 | Ga0466715_242579 | Ga0466715_242579_3786_4493 | 235 |
| 68 | 3300042616 | Ga0466715_492491 | Ga0466715_492491_115_822 | 235 |
| 69 | 3300042617 | Ga0466718_152193 | Ga0466718_152193_400_1107 | 235 |
| 70 | 3300042618 | Ga0466723_055406 | Ga0466723_055406_1915_2622 | 235 |
| 71 | 3300042618 | Ga0466723_059840 | Ga0466723_059840_5584_6291 | 235 |
| 72 | 3300042618 | Ga0466723_272747 | Ga0466723_272747_668_1375 | 235 |
| 73 | 3300042618 | Ga0466723_286733 | Ga0466723_286733_430_1137 | 235 |
| 74 | 3300042618 | Ga0466723_314596 | Ga0466723_314596_1062_1769 | 235 |
| 75 | 3300042618 | Ga0466723_315815 | Ga0466723_315815_8704_9411 | 235 |
| 76 | 3300042618 | Ga0466723_331288 | Ga0466723_331288_1535_2242 | 235 |
| 77 | 3300042619 | Ga0466726_076659 | Ga0466726_076659_2479_3186 | 235 |
| 78 | 3300042619 | Ga0466726_248737 | Ga0466726_248737_238_945 | 235 |
| 79 | 3300042619 | Ga0466726_425451 | Ga0466726_425451_353_1060 | 235 |
| 80 | 3300042621 | Ga0466729_003441 | Ga0466729_003441_173_880 | 235 |
| 81 | 3300042624 | Ga0466735_061748 | Ga0466735_061748_63_770 | 235 |
| 82 | 3300042624 | Ga0466735_063319 | Ga0466735_063319_360_1067 | 235 |
| 83 | 3300042635 | Ga0466702_440908 | Ga0466702_440908_260_967 | 235 |
| 84 | 3300042636 | Ga0466703_155935 | Ga0466703_155935_17107_17814 | 235 |
| 85 | 3300042636 | Ga0466703_207462 | Ga0466703_207462_428_1135 | 235 |
| 86 | 3300042636 | Ga0466703_263904 | Ga0466703_263904_497_1204 | 235 |
| 87 | 3300042636 | Ga0466703_363351 | Ga0466703_363351_752_1459 | 235 |
| 88 | 3300042643 | Ga0466704_080954 | Ga0466704_080954_10776_11483 | 235 |
| 89 | 3300042643 | Ga0466704_115725 | Ga0466704_115725_3496_4203 | 235 |
| 90 | 3300042643 | Ga0466704_325436 | Ga0466704_325436_15192_15899 | 235 |
| 91 | 3300042643 | Ga0466704_386575 | Ga0466704_386575_2113_2820 | 235 |
| 92 | 3300042648 | Ga0466709_083640 | Ga0466709_083640_1450_2157 | 235 |
| 93 | 3300042648 | Ga0466709_320575 | Ga0466709_320575_400_1107 | 235 |
| 94 | 3300042652 | Ga0466708_327203 | Ga0466708_327203_30511_31218 | 235 |
| 95 | 3300042652 | Ga0466708_401033 | Ga0466708_401033_35_742 | 235 |
| 96 | 3300042652 | Ga0466708_455811 | Ga0466708_455811_651_1358 | 235 |
| 97 | 3300042655 | Ga0466727_095368 | Ga0466727_095368_237_944 | 235 |
| 98 | 3300042655 | Ga0466727_172213 | Ga0466727_172213_306_1013 | 235 |
| 99 | 3300042656 | Ga0466732_371261 | Ga0466732_371261_1620_2327 | 235 |
| 100 | 3300042656 | Ga0466732_442681 | Ga0466732_442681_54_761 | 235 |
| 101 | 2030936001 | Nasutiter_Contig13905 | Nasutiterm_1515790 | 236 |
| 102 | 3300002449 | JGI24698J34947_10000402 | JGI24698J34947_100004028 | 236 |
| 103 | 3300005083 | Ga0068305_10003607 | Ga0068305_100036074 | 236 |
| 104 | 3300009784 | Ga0123357_10192587 | Ga0123357_101925872 | 236 |
| 105 | 3300010167 | Ga0123353_10336820 | Ga0123353_103368203 | 236 |
| 106 | 3300010167 | Ga0123353_10441251 | Ga0123353_104412512 | 236 |
| 107 | 3300010167 | Ga0123353_10616070 | Ga0123353_106160702 | 236 |
| 108 | 3300038395 | Ga0415639_112759 | Ga0415639_112759_1831_2541 | 236 |
| 109 | 3300042582 | Ga0466657_290593 | Ga0466657_290593_408_1118 | 236 |
| 110 | 3300042590 | Ga0466690_010693 | Ga0466690_010693_4318_5028 | 236 |
| 111 | 3300042591 | Ga0466692_041981 | Ga0466692_041981_10437_11147 | 236 |
| 112 | 3300042591 | Ga0466692_204077 | Ga0466692_204077_3719_4429 | 236 |
| 113 | 3300042593 | Ga0466691_070103 | Ga0466691_070103_7355_8065 | 236 |
| 114 | 3300042594 | Ga0466694_246529 | Ga0466694_246529_943_1653 | 236 |
| 115 | 3300042597 | Ga0466699_154356 | Ga0466699_154356_162_872 | 236 |
| 116 | 3300042597 | Ga0466699_265434 | Ga0466699_265434_418_1128 | 236 |
| 117 | 3300042603 | Ga0466714_115211 | Ga0466714_115211_17_727 | 236 |
| 118 | 3300042607 | Ga0466720_014023 | Ga0466720_014023_321_1031 | 236 |
| 119 | 3300042607 | Ga0466720_108612 | Ga0466720_108612_97763_98473 | 236 |
| 120 | 3300042607 | Ga0466720_138636 | Ga0466720_138636_984_1694 | 236 |
| 121 | 3300042607 | Ga0466720_172323 | Ga0466720_172323_158_868 | 236 |
| 122 | 3300042609 | Ga0466722_007465 | Ga0466722_007465_21712_22422 | 236 |
| 123 | 3300042609 | Ga0466722_073106 | Ga0466722_073106_6520_7230 | 236 |
| 124 | 3300042609 | Ga0466722_164416 | Ga0466722_164416_327_1037 | 236 |
| 125 | 3300042614 | Ga0466712_299259 | Ga0466712_299259_2073_2783 | 236 |
| 126 | 3300042615 | Ga0466711_038297 | Ga0466711_038297_5465_6175 | 236 |
| 127 | 3300042616 | Ga0466715_025004 | Ga0466715_025004_4324_5034 | 236 |
| 128 | 3300042618 | Ga0466723_150825 | Ga0466723_150825_13016_13726 | 236 |
| 129 | 3300042622 | Ga0466731_376120 | Ga0466731_376120_610_1320 | 236 |
| 130 | 3300042652 | Ga0466708_142045 | Ga0466708_142045_18252_18962 | 236 |
| 131 | 3300042656 | Ga0466732_193451 | Ga0466732_193451_153_863 | 236 |
| 132 | iso_pr_bacteria | 2781125655 | 2781316983 | 236 |
| 133 | iso_pr_bacteria | 2781125687 | 2781419998 | 236 |
| 134 | iso_pr_bacteria | 2781125692 | 2781432302 | 236 |
| 135 | 3300002449 | JGI24698J34947_10021210 | JGI24698J34947_100212102 | 237 |
| 136 | 3300009826 | Ga0123355_10000558 | Ga0123355_1000055815 | 237 |
| 137 | 3300010167 | Ga0123353_10093508 | Ga0123353_100935085 | 237 |
| 138 | 3300010167 | Ga0123353_10140252 | Ga0123353_101402524 | 237 |
| 139 | 3300010882 | Ga0123354_10025831 | Ga0123354_100258315 | 237 |
| 140 | 3300042624 | Ga0466735_135114 | Ga0466735_135114_3877_4590 | 237 |
| 141 | 3300042636 | Ga0466703_028252 | Ga0466703_028252_4931_5644 | 237 |
| 142 | 3300010049 | Ga0123356_10124801 | Ga0123356_101248012 | 238 |
| 143 | 3300010049 | Ga0123356_10788321 | Ga0123356_107883211 | 238 |
| 144 | 3300042592 | Ga0466693_167887 | Ga0466693_167887_4704_5420 | 238 |
| 145 | 3300042614 | Ga0466712_038485 | Ga0466712_038485_191_907 | 238 |
| 146 | 3300042624 | Ga0466735_154543 | Ga0466735_154543_4292_5008 | 238 |
| 147 | 3300002450 | JGI24695J34938_10007973 | JGI24695J34938_100079733 | 239 |
| 148 | 3300009784 | Ga0123357_10135350 | Ga0123357_101353502 | 239 |
| 149 | 3300042609 | Ga0466722_003845 | Ga0466722_003845_1134_1853 | 239 |
| 150 | 3300042609 | Ga0466722_164741 | Ga0466722_164741_2867_3586 | 239 |
| 151 | 3300042609 | Ga0466722_168284 | Ga0466722_168284_2245_2964 | 239 |
| 152 | 3300042643 | Ga0466704_338636 | Ga0466704_338636_2535_3254 | 239 |
| 153 | 3300042643 | Ga0466704_453911 | Ga0466704_453911_740_1459 | 239 |
| 154 | 3300010049 | Ga0123356_10760116 | Ga0123356_107601162 | 240 |
| 155 | 3300042590 | Ga0466690_121622 | Ga0466690_121622_3553_4275 | 240 |
| 156 | 3300042610 | Ga0466698_091773 | Ga0466698_091773_766_1488 | 240 |
| 157 | 3300042614 | Ga0466712_188805 | Ga0466712_188805_6161_6886 | 241 |
| 158 | 3300042619 | Ga0466726_125875 | Ga0466726_125875_684_1409 | 241 |
| 159 | 3300042620 | Ga0466728_134454 | Ga0466728_134454_73_798 | 241 |
| 160 | 3300042609 | Ga0466722_122282 | Ga0466722_122282_7880_8611 | 243 |
| 161 | 3300042652 | Ga0466708_379270 | Ga0466708_379270_1427_2176 | 249 |
| 162 | 3300042596 | Ga0466696_374393 | Ga0466696_374393_15848_16621 | 257 |
| 163 | 3300042594 | Ga0466694_047574 | Ga0466694_047574_371_1147 | 258 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 17 | 62 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.65 | 0.69 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.