Protein Family IF07070

Metagenome Isolate
165 Members
46 Samples
157 Scaffolds
384.61 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_061419|Ga0466705_061419_203_1471
Length
422 aa
Sequence
MQYRNYGKSGFEVSALGLGCMRLPRLSTEGAASAEVDREKAYEIIRYAADHGVNYFDTAYGYHNRTSEEVLGEALEGGRREKVKIVTKQPFPVMADLKSGGGKTILENTRRNLENTLKKLRTSYLDVYLIHNIQISTWKDIKENKILEEYEKFRAEGLIRAIGFSYHGKFPCFKEVLESYDWDMCQIQQNLLDIHHEATAEGMKLAGKKGCALVIMEPLRGGGLAVPPPAVSAVYNEYPVKRSAVEWAFRHLLDYPEVSTILSGITTMEQLKEDIEIFSKPDAVPNCLSGDEKELIARVRAAYESLVSIPCTACEYCLPCPKGVNIPGVFSRFNEGAMFGNYTQSRRSYLFMTRSGQDASRCAAXXXXEKKCPQHIGIIEKLKAAHEVLKGWIEKRSVPEMRPNFQKKIFVMLKYRDLRGNN

📊 Sample Types

Isolate 4.8%
Metagenome 95.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 30.4%
Kalotermitidae 30.4%
Unclassified 21.7%
Rhinotermitidae 6.5%
Termopsidae 6.5%
Hodotermitidae 2.2%
Blaberidae 2.2%

🌳 Taxonomy

Archaea 2
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2772190975 Treponema sp. RmG30 Isolate Blaberidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
14 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
32 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
33 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
42 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_155952 3300042659 Bacteria 3813
2 JGI24698J34947_10000878 3300002449 Bacteria 15193
3 Ga0123357_10109471 3300009784 Bacteria 3529
4 Ga0123355_10062422 3300009826 Bacteria 6014
5 Ga0123353_10047247 3300010167 Bacteria 6844
6 Ga0123353_10629781 3300010167 Bacteria 1524
7 Ga0466690_339568 3300042590 Bacteria 18062
8 Ga0466691_005069 3300042593 Bacteria 11588
9 Ga0466691_126102 3300042593 Bacteria 7955
10 Ga0466691_167928 3300042593 Bacteria 7785
11 Ga0466696_104524 3300042596 Bacteria 2573
12 Ga0466716_270056 3300042605 Bacteria 2369
13 Ga0466719_188626 3300042606 Bacteria 3744
14 Ga0466703_325536 3300042636 Bacteria 19973
15 Ga0466704_209487 3300042643 Bacteria 45601
16 Ga0466709_149047 3300042648 Bacteria 3756
17 Ga0466705_412513 3300042612 Bacteria 1617
18 Ga0466712_121166 3300042614 Bacteria 6205
19 Ga0466715_324723 3300042616 Unclassified 9303
20 Ga0466718_044750 3300042617 Bacteria 14468
21 Ga0466705_213648 3300042612 Bacteria 21031
22 Ga0466705_245926 3300042612 Bacteria 20777
23 Ga0466705_319140 3300042612 Bacteria 1676
24 JGI24702J35022_10015184 3300002462 Bacteria 4241
25 JGI24702J35022_10017041 3300002462 Bacteria 3976
26 Ga0068305_10609974 3300005083 Bacteria 4716
27 Ga0123353_10109031 3300010167 Bacteria 4461
28 Ga0123353_10314782 3300010167 Archaea 2379
29 Ga0466690_190938 3300042590 Bacteria 6052
30 Ga0466690_374094 3300042590 Bacteria 5693
31 Ga0466692_022074 3300042591 Archaea 2990
32 Ga0466691_196363 3300042593 Bacteria 1652
33 Ga0466699_309471 3300042597 Bacteria 3997
34 Ga0466706_128399 3300042599 Bacteria 4282
35 Ga0466703_131763 3300042636 Bacteria 2751
36 Ga0466727_288283 3300042655 Bacteria 1570
37 Ga0466727_327552 3300042655 Bacteria 2043
38 Ga0466726_034522 3300042619 Bacteria 6769
39 Ga0466726_133516 3300042619 Bacteria 8486
40 Ga0466726_188118 3300042619 Bacteria 11542
41 Ga0466726_443730 3300042619 Bacteria 4524
42 Ga0466729_069420 3300042621 Bacteria 5933
43 Ga0466705_383579 3300042612 Bacteria 1743
44 JGI24698J34947_10004258 3300002449 Bacteria 7784
45 Ga0123353_10513910 3300010167 Unclassified 1740
46 Ga0123353_10622161 3300010167 Unclassified 1537
47 Ga0466690_092341 3300042590 Bacteria 2964
48 Ga0466716_019262 3300042605 Bacteria 2154
49 Ga0466722_094748 3300042609 Bacteria 17006
50 Ga0466722_214480 3300042609 Bacteria 10750
51 Ga0466722_214520 3300042609 Bacteria 1555
52 Ga0466703_047869 3300042636 Bacteria 58815
53 Ga0466703_256814 3300042636 Bacteria 1487
54 Ga0466708_069025 3300042652 Bacteria 81565
55 Ga0466711_435611 3300042615 Bacteria 1690
56 Ga0466715_036616 3300042616 Bacteria 7581
57 Ga0466715_476159 3300042616 Unclassified 5112
58 Ga0466718_087149 3300042617 Bacteria 122153
59 Ga0466723_192400 3300042618 Bacteria 2442
60 Ga0466728_225923 3300042620 Bacteria 8188
61 Ga0466728_280440 3300042620 Bacteria 3007
62 Ga0466705_027842 3300042612 Bacteria 1704
63 Ga0466705_061419 3300042612 Bacteria 2513
64 Ga0466705_235936 3300042612 Bacteria 4292
65 JGI24702J35022_10001722 3300002462 Bacteria 13558
66 JGI24700J35501_10929348 3300002508 Bacteria 9091
67 Ga0123357_10022095 3300009784 Bacteria 8526
68 Ga0123354_10030050 3300010882 Bacteria 8538
69 Ga0466706_176256 3300042599 Bacteria 7973
70 Ga0466719_347256 3300042606 Bacteria 5089
71 Ga0466704_391960 3300042643 Bacteria 1837
72 Ga0466704_518089 3300042643 Bacteria 4351
73 Ga0466709_075852 3300042648 Bacteria 8352
74 Ga0466709_128020 3300042648 Unclassified 8540
75 Ga0466708_179630 3300042652 Bacteria 5613
76 Ga0466727_061511 3300042655 Bacteria 10322
77 Ga0466727_152695 3300042655 Bacteria 1725
78 Ga0466712_021390 3300042614 Unclassified 3519
79 Ga0466711_013535 3300042615 Bacteria 12075
80 Ga0466711_091584 3300042615 Bacteria 27785
81 Ga0466711_135017 3300042615 Bacteria 3583
82 Ga0466723_151788 3300042618 Bacteria 2837
83 Ga0466723_258430 3300042618 Bacteria 4220
84 Ga0466705_095473 3300042612 Bacteria 6967
85 JGI24698J34947_10009268 3300002449 Bacteria 5401
86 Ga0466699_103448 3300042597 Bacteria 17010
87 Ga0466716_035812 3300042605 Bacteria 2228
88 Ga0466729_231907 3300042621 Bacteria 2096
89 Ga0466704_213067 3300042643 Bacteria 2377
90 Ga0466704_332150 3300042643 Unclassified 11613
91 Ga0466704_440761 3300042643 Bacteria 112604
92 Ga0466704_591484 3300042643 Bacteria 4593
93 Ga0466709_308001 3300042648 Bacteria 15552
94 Ga0466727_135810 3300042655 Bacteria 2829
95 Ga0466727_196397 3300042655 Bacteria 1754
96 Ga0466710_011847 3300042613 Bacteria 1351
97 Ga0466711_502192 3300042615 Bacteria 57733
98 Ga0466715_008114 3300042616 Bacteria 7710
99 Ga0466715_059303 3300042616 Bacteria 8334
100 Ga0466715_469403 3300042616 Bacteria 2681
101 Ga0466718_041192 3300042617 Bacteria 16593
102 Ga0123353_10534111 3300010167 Bacteria 1697
103 Ga0123354_10281785 3300010882 Bacteria 1612
104 Ga0466690_147226 3300042590 Bacteria 2441
105 Ga0466692_022230 3300042591 Bacteria 1050
106 Ga0466691_189017 3300042593 Bacteria 7532
107 Ga0466691_228399 3300042593 Bacteria 1509
108 Ga0466713_058963 3300042602 Bacteria 2197
109 Ga0466716_476847 3300042605 Bacteria 2047
110 Ga0466719_062853 3300042606 Bacteria 19370
111 Ga0466719_372732 3300042606 Bacteria 7345
112 Ga0466722_013230 3300042609 Bacteria 3036
113 Ga0466722_224626 3300042609 Bacteria 2509
114 Ga0466735_206367 3300042624 Bacteria 1727
115 Ga0466703_100434 3300042636 Bacteria 11690
116 Ga0466704_200355 3300042643 Bacteria 35576
117 Ga0466704_293788 3300042643 Bacteria 2974
118 Ga0466708_166069 3300042652 Bacteria 3313
119 Ga0466712_033533 3300042614 Bacteria 2645
120 Ga0466711_032117 3300042615 Bacteria 31170
121 Ga0466715_041933 3300042616 Bacteria 15732
122 Ga0466726_402645 3300042619 Bacteria 1823
123 Ga0466705_143120 3300042612 Bacteria 12823
124 Ga0123357_10055018 3300009784 Bacteria 5361
125 Ga0123355_10334292 3300009826 Bacteria 2025
126 Ga0466690_258112 3300042590 Bacteria 5554
127 Ga0466691_000578 3300042593 Bacteria 5284
128 Ga0466696_467536 3300042596 Bacteria 9719
129 Ga0466699_255361 3300042597 Bacteria 5069
130 Ga0466722_173116 3300042609 Bacteria 181242
131 Ga0466722_246924 3300042609 Bacteria 5230
132 Ga0466703_316437 3300042636 Bacteria 17841
133 Ga0466704_327973 3300042643 Bacteria 5179
134 Ga0466704_426846 3300042643 Unclassified 1717
135 Ga0466727_100764 3300042655 Bacteria 5576
136 Ga0466727_119834 3300042655 Bacteria 1606
137 Ga0466705_451117 3300042612 Bacteria 4965
138 Ga0466711_002521 3300042615 Bacteria 7076
139 Ga0466723_247202 3300042618 Bacteria 2335
140 Ga0466723_372164 3300042618 Bacteria 2718
141 Ga0466728_237173 3300042620 Bacteria 2336
142 Ga0466729_105599 3300042621 Bacteria 1762
143 JGI24702J35022_10020651 3300002462 Bacteria 3574
144 Ga0123356_10001910 3300010049 Bacteria 22568
145 Ga0466700_142770 3300042600 Bacteria 3248
146 Ga0466707_034853 3300042601 Bacteria 1586
147 Ga0466707_374457 3300042601 Bacteria 1262
148 Ga0466716_523626 3300042605 Bacteria 4022
149 Ga0466719_176218 3300042606 Bacteria 3497
150 Ga0466704_143499 3300042643 Bacteria 2501
151 Ga0466704_361283 3300042643 Bacteria 18659
152 Ga0466727_166351 3300042655 Bacteria 1792
153 Ga0466715_109543 3300042616 Bacteria 10136
154 Ga0466715_176089 3300042616 Bacteria 6006
155 Ga0466723_032252 3300042618 Bacteria 9635
156 Ga0466723_179425 3300042618 Bacteria 7519
157 Ga0466726_002893 3300042619 Bacteria 6860

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_022074 Ga0466692_022074_18_1034 338
2 3300042591 Ga0466692_022230 Ga0466692_022230_17_1033 338
3 3300042605 Ga0466716_476847 Ga0466716_476847_55_1071 338
4 3300010882 Ga0123354_10281785 Ga0123354_102817851 352
5 3300042593 Ga0466691_189017 Ga0466691_189017_1847_2941 352
6 3300042590 Ga0466690_374094 Ga0466690_374094_3903_4994 354
7 3300042605 Ga0466716_035812 Ga0466716_035812_702_1793 354
8 3300042619 Ga0466726_402645 Ga0466726_402645_474_1631 355
9 3300042612 Ga0466705_245926 Ga0466705_245926_328_1470 356
10 3300010167 Ga0123353_10622161 Ga0123353_106221612 359
11 3300042618 Ga0466723_192400 Ga0466723_192400_15_1094 359
12 3300042624 Ga0466735_206367 Ga0466735_206367_630_1715 361
13 3300042590 Ga0466690_339568 Ga0466690_339568_12669_13757 362
14 3300042618 Ga0466723_032252 Ga0466723_032252_7345_8433 362
15 3300042605 Ga0466716_019262 Ga0466716_019262_448_1539 363
16 3300042605 Ga0466716_270056 Ga0466716_270056_454_1545 363
17 3300042615 Ga0466711_013535 Ga0466711_013535_10190_11281 363
18 3300042601 Ga0466707_034853 Ga0466707_034853_36_1130 364
19 3300042615 Ga0466711_435611 Ga0466711_435611_288_1382 364
20 iso_pr_bacteria 2820271343 2820272431 364
21 3300042612 Ga0466705_213648 Ga0466705_213648_12539_13636 365
22 3300042655 Ga0466727_135810 Ga0466727_135810_1217_2314 365
23 3300042606 Ga0466719_372732 Ga0466719_372732_1962_3062 366
24 3300042636 Ga0466703_325536 Ga0466703_325536_2145_3260 371
25 3300042614 Ga0466712_021390 Ga0466712_021390_538_1656 372
26 3300042614 Ga0466712_121166 Ga0466712_121166_1129_2247 372
27 3300042612 Ga0466705_451117 Ga0466705_451117_2480_3604 374
28 3300042648 Ga0466709_075852 Ga0466709_075852_6688_7812 374
29 3300042655 Ga0466727_119834 Ga0466727_119834_41_1195 375
30 3300010167 Ga0123353_10109031 Ga0123353_101090316 377
31 3300010167 Ga0123353_10047247 Ga0123353_100472474 379
32 3300042602 Ga0466713_058963 Ga0466713_058963_450_1589 379
33 3300042619 Ga0466726_133516 Ga0466726_133516_6655_7809 379
34 3300009826 Ga0123355_10062422 Ga0123355_100624221 380
35 3300010167 Ga0123353_10314782 Ga0123353_103147822 380
36 3300042618 Ga0466723_258430 Ga0466723_258430_2631_3773 380
37 3300042620 Ga0466728_237173 Ga0466728_237173_580_1722 380
38 3300042643 Ga0466704_591484 Ga0466704_591484_3187_4329 380
39 3300002462 JGI24702J35022_10020651 JGI24702J35022_100206513 382
40 3300009784 Ga0123357_10109471 Ga0123357_101094713 382
41 3300010167 Ga0123353_10513910 Ga0123353_105139102 382
42 3300042593 Ga0466691_228399 Ga0466691_228399_289_1479 382
43 3300042609 Ga0466722_094748 Ga0466722_094748_1415_2563 382
44 3300042616 Ga0466715_008114 Ga0466715_008114_3037_4185 382
45 3300042621 Ga0466729_105599 Ga0466729_105599_158_1306 382
46 3300042590 Ga0466690_092341 Ga0466690_092341_459_1610 383
47 3300042606 Ga0466719_347256 Ga0466719_347256_2650_3801 383
48 3300042609 Ga0466722_214480 Ga0466722_214480_7768_8919 383
49 3300042609 Ga0466722_224626 Ga0466722_224626_158_1309 383
50 3300042612 Ga0466705_143120 Ga0466705_143120_3216_4367 383
51 3300042614 Ga0466712_033533 Ga0466712_033533_192_1343 383
52 3300042615 Ga0466711_002521 Ga0466711_002521_2905_4056 383
53 3300042615 Ga0466711_502192 Ga0466711_502192_9755_10906 383
54 3300042616 Ga0466715_176089 Ga0466715_176089_3883_5034 383
55 3300042618 Ga0466723_179425 Ga0466723_179425_1903_3054 383
56 3300042620 Ga0466728_225923 Ga0466728_225923_5512_6663 383
57 3300042643 Ga0466704_361283 Ga0466704_361283_8759_9910 383
58 iso_pr_bacteria 2781125696 2781441423 383
59 iso_pr_bacteria 2819994798 2819995979 383
60 3300002462 JGI24702J35022_10015184 JGI24702J35022_100151843 384
61 3300002462 JGI24702J35022_10017041 JGI24702J35022_100170415 384
62 3300002508 JGI24700J35501_10929348 JGI24700J35501_109293486 384
63 3300005083 Ga0068305_10609974 Ga0068305_106099741 384
64 3300009826 Ga0123355_10334292 Ga0123355_103342921 384
65 3300042590 Ga0466690_147226 Ga0466690_147226_469_1623 384
66 3300042600 Ga0466700_142770 Ga0466700_142770_1483_2637 384
67 3300042601 Ga0466707_374457 Ga0466707_374457_23_1177 384
68 3300042606 Ga0466719_176218 Ga0466719_176218_1056_2210 384
69 3300042609 Ga0466722_214520 Ga0466722_214520_158_1312 384
70 3300042612 Ga0466705_235936 Ga0466705_235936_2907_4061 384
71 3300042612 Ga0466705_319140 Ga0466705_319140_269_1423 384
72 3300042612 Ga0466705_412513 Ga0466705_412513_344_1498 384
73 3300042615 Ga0466711_091584 Ga0466711_091584_1780_2934 384
74 3300042616 Ga0466715_041933 Ga0466715_041933_13501_14655 384
75 3300042618 Ga0466723_247202 Ga0466723_247202_906_2060 384
76 3300042643 Ga0466704_293788 Ga0466704_293788_1759_2913 384
77 3300042643 Ga0466704_327973 Ga0466704_327973_1313_2467 384
78 3300042643 Ga0466704_332150 Ga0466704_332150_8472_9626 384
79 3300042643 Ga0466704_426846 Ga0466704_426846_437_1591 384
80 3300042643 Ga0466704_518089 Ga0466704_518089_426_1580 384
81 3300042655 Ga0466727_288283 Ga0466727_288283_210_1364 384
82 iso_pr_bacteria 2772190975 2773724215 384
83 3300042590 Ga0466690_190938 Ga0466690_190938_602_1759 385
84 3300042593 Ga0466691_000578 Ga0466691_000578_515_1672 385
85 3300042599 Ga0466706_176256 Ga0466706_176256_1519_2676 385
86 3300042609 Ga0466722_173116 Ga0466722_173116_143987_145144 385
87 3300042613 Ga0466710_011847 Ga0466710_011847_134_1291 385
88 3300042619 Ga0466726_002893 Ga0466726_002893_3568_4725 385
89 3300042619 Ga0466726_443730 Ga0466726_443730_2074_3231 385
90 3300042621 Ga0466729_069420 Ga0466729_069420_605_1762 385
91 3300042648 Ga0466709_128020 Ga0466709_128020_83_1240 385
92 3300042652 Ga0466708_166069 Ga0466708_166069_552_1709 385
93 iso_pr_bacteria 2820408893 2820409362 385
94 3300010882 Ga0123354_10030050 Ga0123354_100300503 386
95 3300042621 Ga0466729_231907 Ga0466729_231907_201_1361 386
96 3300042643 Ga0466704_440761 Ga0466704_440761_32560_33720 386
97 iso_pr_bacteria 2820348946 2820350239 386
98 3300042636 Ga0466703_100434 Ga0466703_100434_7448_8614 388
99 3300042655 Ga0466727_196397 Ga0466727_196397_97_1263 388
100 3300042612 Ga0466705_095473 Ga0466705_095473_1510_2679 389
101 3300042659 Ga0466733_155952 Ga0466733_155952_174_1349 391
102 3300042593 Ga0466691_126102 Ga0466691_126102_257_1435 392
103 3300042597 Ga0466699_103448 Ga0466699_103448_180_1358 392
104 3300042606 Ga0466719_188626 Ga0466719_188626_254_1432 392
105 3300042615 Ga0466711_032117 Ga0466711_032117_22430_23608 392
106 3300042618 Ga0466723_151788 Ga0466723_151788_765_1943 392
107 3300042620 Ga0466728_280440 Ga0466728_280440_831_2009 392
108 3300042643 Ga0466704_143499 Ga0466704_143499_714_1892 392
109 3300042648 Ga0466709_308001 Ga0466709_308001_1754_2932 392
110 3300042655 Ga0466727_061511 Ga0466727_061511_6836_8014 392
111 3300042655 Ga0466727_327552 Ga0466727_327552_36_1214 392
112 iso_pr_bacteria 2781125690 2781427811 392
113 3300002449 JGI24698J34947_10000878 JGI24698J34947_1000087816 393
114 3300002449 JGI24698J34947_10004258 JGI24698J34947_100042584 393
115 3300002449 JGI24698J34947_10009268 JGI24698J34947_100092684 393
116 3300042596 Ga0466696_467536 Ga0466696_467536_986_2167 393
117 3300042597 Ga0466699_309471 Ga0466699_309471_68_1249 393
118 3300042609 Ga0466722_246924 Ga0466722_246924_825_2006 393
119 3300042612 Ga0466705_027842 Ga0466705_027842_451_1632 393
120 3300042616 Ga0466715_324723 Ga0466715_324723_3926_5107 393
121 3300042616 Ga0466715_469403 Ga0466715_469403_381_1562 393
122 3300042617 Ga0466718_041192 Ga0466718_041192_3545_4726 393
123 3300042617 Ga0466718_044750 Ga0466718_044750_12590_13771 393
124 3300042617 Ga0466718_087149 Ga0466718_087149_56304_57485 393
125 3300042636 Ga0466703_256814 Ga0466703_256814_128_1309 393
126 3300042636 Ga0466703_316437 Ga0466703_316437_3310_4491 393
127 3300042643 Ga0466704_209487 Ga0466704_209487_8661_9842 393
128 3300042648 Ga0466709_149047 Ga0466709_149047_2114_3295 393
129 3300042652 Ga0466708_179630 Ga0466708_179630_2570_3751 393
130 3300042655 Ga0466727_100764 Ga0466727_100764_1746_2927 393
131 iso_pr_bacteria 650716099 650878428 393
132 3300002462 JGI24702J35022_10001722 JGI24702J35022_1000172215 394
133 3300009784 Ga0123357_10022095 Ga0123357_100220952 394
134 3300042593 Ga0466691_196363 Ga0466691_196363_296_1480 394
135 3300042605 Ga0466716_523626 Ga0466716_523626_650_1834 394
136 3300042612 Ga0466705_383579 Ga0466705_383579_544_1728 394
137 3300042615 Ga0466711_135017 Ga0466711_135017_388_1572 394
138 3300042616 Ga0466715_036616 Ga0466715_036616_190_1374 394
139 3300042616 Ga0466715_109543 Ga0466715_109543_939_2123 394
140 3300042643 Ga0466704_213067 Ga0466704_213067_251_1435 394
141 3300042643 Ga0466704_391960 Ga0466704_391960_199_1383 394
142 3300042655 Ga0466727_152695 Ga0466727_152695_222_1442 394
143 3300010049 Ga0123356_10001910 Ga0123356_1000191019 395
144 3300010167 Ga0123353_10534111 Ga0123353_105341112 395
145 3300042609 Ga0466722_013230 Ga0466722_013230_240_1427 395
146 3300042599 Ga0466706_128399 Ga0466706_128399_384_1580 398
147 3300042597 Ga0466699_255361 Ga0466699_255361_1427_2626 399
148 3300010167 Ga0123353_10629781 Ga0123353_106297812 400
149 3300042652 Ga0466708_069025 Ga0466708_069025_5032_6234 400
150 3300042655 Ga0466727_166351 Ga0466727_166351_239_1441 400
151 3300042590 Ga0466690_258112 Ga0466690_258112_2272_3477 401
152 3300042593 Ga0466691_005069 Ga0466691_005069_6384_7589 401
153 3300042596 Ga0466696_104524 Ga0466696_104524_843_2048 401
154 3300042606 Ga0466719_062853 Ga0466719_062853_16154_17359 401
155 3300042619 Ga0466726_034522 Ga0466726_034522_2223_3428 401
156 3300042619 Ga0466726_188118 Ga0466726_188118_8981_10186 401
157 3300042636 Ga0466703_047869 Ga0466703_047869_199_1404 401
158 3300042643 Ga0466704_200355 Ga0466704_200355_27708_28913 401
159 3300042593 Ga0466691_167928 Ga0466691_167928_6118_7326 402
160 3300009784 Ga0123357_10055018 Ga0123357_100550185 403
161 3300042616 Ga0466715_059303 Ga0466715_059303_5675_6919 414
162 3300042618 Ga0466723_372164 Ga0466723_372164_455_1699 414
163 3300042636 Ga0466703_131763 Ga0466703_131763_415_1659 414
164 3300042616 Ga0466715_476159 Ga0466715_476159_2322_3575 417
165 3300042612 Ga0466705_061419 Ga0466705_061419_203_1471 422

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00248 Aldo_ket_red Aldo/keto reductase family 16 279 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.