Protein Family IF07068

Metagenome Isolate
104 Members
31 Samples
103 Scaffolds
339.28 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_059929|Ga0466705_059929_10959_12137
Length
392 aa
Sequence
MPRNGEANAGAPPESGVFERFRVFFIKAPRMPVPCIYPEVSMKKLFLKGGAPSAGRSRPAAAVFAALAAIVVSCSTGEAVEQILGGSAAAPVFISCRAVSPTEIDFHFSTAVRVLSLNFSPDLEAGTSSEGNMVRVSLASAAGEGARLTADLLVEDARGNTLNVLVPLRARNDRMPPFLINELRTEHSKPKTEFIELKTTGPGSLGALRLFIAGNAKQPLVYEFPPAEVKKGEYIVIHLRNIEEGTADETGADXXIXXXADAQGDARDFWIPGSGKLLHKTDAVYFLDQDDRVIDGVMLSENPDPRWKKDHFAQAAEFLHGQGAWAQIPPGDTGGAVPGPADAVHTAAVKTAMTRSVSRDETAADTNTAADWYVTATGGATPGKPNNPKRFE

📊 Sample Types

Isolate 1.0%
Metagenome 99.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 46.7%
Termitidae 23.3%
Rhinotermitidae 10.0%
Unclassified 10.0%
Termopsidae 6.7%
Blaberidae 3.3%

🌳 Taxonomy

Archaea 0
Bacteria 98
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
2 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
3 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
4 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
5 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
6 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2772190975 Treponema sp. RmG30 Isolate Blaberidae
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
29 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
30 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_462329 3300042615 Bacteria 30482
2 Ga0466715_097861 3300042616 Bacteria 28870
3 Ga0466715_271261 3300042616 Bacteria 5364
4 Ga0466723_062733 3300042618 Bacteria 35703
5 Ga0466723_084546 3300042618 Bacteria 4945
6 Ga0466726_031006 3300042619 Bacteria 20841
7 Ga0466731_287596 3300042622 Bacteria 1615
8 Ga0466709_035429 3300042648 Bacteria 8310
9 Ga0466708_169734 3300042652 Bacteria 12525
10 Ga0466727_255723 3300042655 Bacteria 1343
11 Ga0415639_100240 3300038395 Unclassified 1331
12 Ga0466692_204205 3300042591 Bacteria 7486
13 Ga0466716_138544 3300042605 Bacteria 6471
14 Ga0466722_047115 3300042609 Bacteria 2116
15 Ga0466722_052243 3300042609 Bacteria 23183
16 Ga0466722_072985 3300042609 Bacteria 33307
17 Ga0466705_062540 3300042612 Unclassified 10012
18 Ga0466705_121424 3300042612 Bacteria 14439
19 Ga0466705_185419 3300042612 Bacteria 16741
20 Ga0466705_238594 3300042612 Bacteria 4988
21 Ga0466715_282627 3300042616 Bacteria 4316
22 Ga0466726_093307 3300042619 Bacteria 3491
23 Ga0466704_045874 3300042643 Bacteria 2356
24 Ga0466704_179992 3300042643 Bacteria 35247
25 Ga0466704_515376 3300042643 Bacteria 3987
26 Ga0466704_565861 3300042643 Bacteria 62930
27 Ga0466709_317002 3300042648 Bacteria 7009
28 Ga0466708_038994 3300042652 Bacteria 9046
29 Ga0466708_100401 3300042652 Bacteria 3869
30 Ga0466708_124385 3300042652 Bacteria 5885
31 Ga0466708_160197 3300042652 Bacteria 15593
32 Ga0466708_368631 3300042652 Bacteria 10645
33 Ga0466727_311108 3300042655 Bacteria 4392
34 Ga0466691_089028 3300042593 Bacteria 39976
35 Ga0466711_100242 3300042615 Bacteria 5339
36 Ga0466711_137705 3300042615 Bacteria 18389
37 Ga0466723_015663 3300042618 Bacteria 58778
38 Ga0466729_149324 3300042621 Bacteria 1142
39 Ga0466731_276331 3300042622 Bacteria 3439
40 Ga0466709_088329 3300042648 Bacteria 11205
41 Ga0466708_137098 3300042652 Bacteria 3910
42 Ga0466727_176254 3300042655 Bacteria 1922
43 Ga0264413_112480 3300024493 Bacteria 7766
44 Ga0466696_038136 3300042596 Bacteria 24965
45 Ga0466720_023642 3300042607 Bacteria 4937
46 Ga0466720_035397 3300042607 Bacteria 15228
47 Ga0466722_230831 3300042609 Bacteria 11349
48 Ga0466715_130506 3300042616 Bacteria 5014
49 Ga0466723_260481 3300042618 Bacteria 12284
50 Ga0466728_452306 3300042620 Bacteria 5166
51 Ga0466704_115155 3300042643 Bacteria 14950
52 Ga0466709_401044 3300042648 Bacteria 10574
53 Ga0466696_391482 3300042596 Bacteria 6167
54 Ga0466707_073684 3300042601 Bacteria 21760
55 Ga0466719_421406 3300042606 Bacteria 13928
56 Ga0466715_049759 3300042616 Bacteria 3541
57 Ga0466715_270811 3300042616 Bacteria 16378
58 Ga0466723_035164 3300042618 Bacteria 5075
59 Ga0466726_382028 3300042619 Bacteria 14308
60 Ga0466703_362182 3300042636 Bacteria 4742
61 Ga0466704_112645 3300042643 Bacteria 5690
62 Ga0466709_347446 3300042648 Bacteria 5417
63 Ga0466696_018386 3300042596 Bacteria 22730
64 Ga0466716_250886 3300042605 Bacteria 5695
65 Ga0466722_205735 3300042609 Bacteria 5520
66 Ga0466705_388098 3300042612 Bacteria 2065
67 Ga0466711_069804 3300042615 Bacteria 1392
68 Ga0466711_077910 3300042615 Bacteria 5629
69 Ga0466711_124715 3300042615 Bacteria 8934
70 Ga0466711_346755 3300042615 Bacteria 5298
71 Ga0466723_196774 3300042618 Bacteria 9391
72 Ga0466703_065868 3300042636 Bacteria 21346
73 Ga0466703_390324 3300042636 Bacteria 9390
74 Ga0466709_313719 3300042648 Bacteria 10898
75 Ga0123353_10668910 3300010167 Bacteria 1465
76 Ga0466696_229954 3300042596 Bacteria 12821
77 Ga0466700_039108 3300042600 Bacteria 9355
78 Ga0466707_091611 3300042601 Bacteria 4213
79 Ga0466716_137405 3300042605 Bacteria 2918
80 Ga0466722_097332 3300042609 Bacteria 6544
81 Ga0466712_324189 3300042614 Bacteria 7264
82 Ga0466715_038085 3300042616 Bacteria 2201
83 Ga0466715_069049 3300042616 Unclassified 12378
84 Ga0466723_136914 3300042618 Bacteria 3396
85 Ga0466709_071557 3300042648 Bacteria 14177
86 Ga0466708_354169 3300042652 Bacteria 9019
87 JGI24695J34938_10000080 3300002450 Bacteria 82616
88 Ga0466696_303336 3300042596 Bacteria 19247
89 Ga0466713_078093 3300042602 Unclassified 2358
90 Ga0466719_077038 3300042606 Unclassified 2010
91 Ga0466705_059929 3300042612 Bacteria 14929
92 Ga0466711_435155 3300042615 Bacteria 4009
93 Ga0466715_368617 3300042616 Bacteria 16621
94 Ga0466703_388393 3300042636 Bacteria 5529
95 Ga0466709_091133 3300042648 Bacteria 5412
96 Ga0068305_10079296 3300005083 Bacteria 4280
97 Ga0466690_029256 3300042590 Bacteria 4541
98 Ga0466690_331869 3300042590 Unclassified 2862
99 Ga0466692_060612 3300042591 Bacteria 8954
100 Ga0466719_268321 3300042606 Bacteria 2683
101 Ga0466719_345398 3300042606 Bacteria 10216
102 Ga0466720_072156 3300042607 Bacteria 2848
103 Ga0466722_067468 3300042609 Bacteria 5628

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042602 Ga0466713_078093 Ga0466713_078093_1448_2314 288
2 3300042601 Ga0466707_091611 Ga0466707_091611_77_1081 300
3 3300042622 Ga0466731_287596 Ga0466731_287596_581_1585 302
4 3300042622 Ga0466731_276331 Ga0466731_276331_2471_3388 305
5 3300042607 Ga0466720_072156 Ga0466720_072156_744_1751 307
6 3300042601 Ga0466707_073684 Ga0466707_073684_19300_20304 314
7 3300042652 Ga0466708_354169 Ga0466708_354169_6391_7341 316
8 3300042648 Ga0466709_401044 Ga0466709_401044_3800_4753 317
9 3300042655 Ga0466727_176254 Ga0466727_176254_320_1273 317
10 3300042616 Ga0466715_130506 Ga0466715_130506_3282_4238 318
11 3300042609 Ga0466722_052243 Ga0466722_052243_4465_5427 320
12 3300042596 Ga0466696_229954 Ga0466696_229954_1970_2983 322
13 3300042616 Ga0466715_069049 Ga0466715_069049_3595_4710 322
14 3300042609 Ga0466722_230831 Ga0466722_230831_2003_2983 326
15 3300042612 Ga0466705_121424 Ga0466705_121424_9614_10651 327
16 3300042591 Ga0466692_204205 Ga0466692_204205_1789_2775 328
17 3300042618 Ga0466723_062733 Ga0466723_062733_28935_29921 328
18 3300042655 Ga0466727_255723 Ga0466727_255723_312_1298 328
19 3300042618 Ga0466723_035164 Ga0466723_035164_3219_4271 329
20 3300042621 Ga0466729_149324 Ga0466729_149324_88_1113 329
21 3300010167 Ga0123353_10668910 Ga0123353_106689101 332
22 3300042615 Ga0466711_124715 Ga0466711_124715_667_1665 332
23 3300042648 Ga0466709_035429 Ga0466709_035429_4576_5631 332
24 3300042648 Ga0466709_317002 Ga0466709_317002_1016_2014 332
25 3300002450 JGI24695J34938_10000080 JGI24695J34938_1000008032 333
26 3300042609 Ga0466722_205735 Ga0466722_205735_550_1554 334
27 3300042615 Ga0466711_435155 Ga0466711_435155_2083_3087 334
28 3300024493 Ga0264413_112480 Ga0264413_1124806 335
29 3300042591 Ga0466692_060612 Ga0466692_060612_4099_5106 335
30 3300042607 Ga0466720_023642 Ga0466720_023642_1507_2514 335
31 3300042643 Ga0466704_515376 Ga0466704_515376_767_1798 335
32 3300042614 Ga0466712_324189 Ga0466712_324189_5502_6512 336
33 3300042616 Ga0466715_038085 Ga0466715_038085_132_1205 337
34 3300042618 Ga0466723_136914 Ga0466723_136914_293_1306 337
35 3300042606 Ga0466719_421406 Ga0466719_421406_8347_9363 338
36 3300042607 Ga0466720_035397 Ga0466720_035397_12396_13412 338
37 3300042609 Ga0466722_067468 Ga0466722_067468_1066_2082 338
38 3300042612 Ga0466705_062540 Ga0466705_062540_8360_9376 338
39 3300042615 Ga0466711_137705 Ga0466711_137705_4030_5046 338
40 3300042619 Ga0466726_382028 Ga0466726_382028_270_1286 338
41 3300042643 Ga0466704_115155 Ga0466704_115155_5941_6957 338
42 3300042648 Ga0466709_071557 Ga0466709_071557_8134_9150 338
43 3300042652 Ga0466708_100401 Ga0466708_100401_688_1704 338
44 3300042652 Ga0466708_137098 Ga0466708_137098_2305_3321 338
45 iso_pr_bacteria 2772190975 2773721391 338
46 3300042612 Ga0466705_388098 Ga0466705_388098_914_1933 339
47 3300042619 Ga0466726_031006 Ga0466726_031006_11464_12483 339
48 3300042652 Ga0466708_124385 Ga0466708_124385_2727_3746 339
49 3300042605 Ga0466716_138544 Ga0466716_138544_1351_2373 340
50 3300042609 Ga0466722_097332 Ga0466722_097332_1179_2201 340
51 3300042590 Ga0466690_331869 Ga0466690_331869_54_1079 341
52 3300042593 Ga0466691_089028 Ga0466691_089028_8472_9497 341
53 3300042596 Ga0466696_018386 Ga0466696_018386_20011_21036 341
54 3300042596 Ga0466696_303336 Ga0466696_303336_2877_3902 341
55 3300042606 Ga0466719_345398 Ga0466719_345398_8189_9214 341
56 3300042616 Ga0466715_270811 Ga0466715_270811_11595_12620 341
57 3300042618 Ga0466723_015663 Ga0466723_015663_43250_44275 341
58 3300042619 Ga0466726_093307 Ga0466726_093307_202_1227 341
59 3300042636 Ga0466703_065868 Ga0466703_065868_8801_9826 341
60 3300042643 Ga0466704_045874 Ga0466704_045874_1006_2031 341
61 3300042643 Ga0466704_179992 Ga0466704_179992_17024_18049 341
62 3300042652 Ga0466708_038994 Ga0466708_038994_3967_5061 341
63 3300042609 Ga0466722_072985 Ga0466722_072985_7786_8814 342
64 3300042615 Ga0466711_069804 Ga0466711_069804_13_1041 342
65 3300042616 Ga0466715_282627 Ga0466715_282627_2541_3602 342
66 3300042648 Ga0466709_313719 Ga0466709_313719_6085_7113 342
67 3300042655 Ga0466727_311108 Ga0466727_311108_2229_3257 342
68 3300042596 Ga0466696_038136 Ga0466696_038136_9313_10344 343
69 3300042596 Ga0466696_391482 Ga0466696_391482_2423_3454 343
70 3300042605 Ga0466716_137405 Ga0466716_137405_736_1767 343
71 3300042615 Ga0466711_462329 Ga0466711_462329_15275_16306 343
72 3300042618 Ga0466723_196774 Ga0466723_196774_6608_7639 343
73 3300042618 Ga0466723_260481 Ga0466723_260481_364_1395 343
74 3300042636 Ga0466703_362182 Ga0466703_362182_97_1128 343
75 3300042636 Ga0466703_388393 Ga0466703_388393_1806_2837 343
76 3300042643 Ga0466704_112645 Ga0466704_112645_3459_4490 343
77 3300042652 Ga0466708_160197 Ga0466708_160197_7835_8866 343
78 3300042652 Ga0466708_368631 Ga0466708_368631_8480_9511 343
79 3300042615 Ga0466711_077910 Ga0466711_077910_1065_2102 345
80 3300042615 Ga0466711_100242 Ga0466711_100242_473_1510 345
81 3300042616 Ga0466715_368617 Ga0466715_368617_4024_5064 346
82 3300042636 Ga0466703_390324 Ga0466703_390324_5688_6728 346
83 3300042590 Ga0466690_029256 Ga0466690_029256_156_1199 347
84 3300042606 Ga0466719_077038 Ga0466719_077038_956_1999 347
85 3300042606 Ga0466719_268321 Ga0466719_268321_1509_2552 347
86 3300042648 Ga0466709_088329 Ga0466709_088329_8400_9443 347
87 3300042652 Ga0466708_169734 Ga0466708_169734_1620_2663 347
88 3300042609 Ga0466722_047115 Ga0466722_047115_509_1555 348
89 3300042605 Ga0466716_250886 Ga0466716_250886_1041_2111 349
90 3300042620 Ga0466728_452306 Ga0466728_452306_1041_2093 350
91 3300042648 Ga0466709_347446 Ga0466709_347446_3919_4971 350
92 3300042648 Ga0466709_091133 Ga0466709_091133_4043_5140 351
93 3300042612 Ga0466705_238594 Ga0466705_238594_3137_4195 352
94 3300005083 Ga0068305_10079296 Ga0068305_100792962 353
95 3300042600 Ga0466700_039108 Ga0466700_039108_5148_6209 353
96 3300038395 Ga0415639_100240 Ga0415639_100240_244_1308 354
97 3300042615 Ga0466711_346755 Ga0466711_346755_4137_5207 356
98 3300042643 Ga0466704_565861 Ga0466704_565861_50853_51923 356
99 3300042618 Ga0466723_084546 Ga0466723_084546_2145_3227 360
100 3300042612 Ga0466705_185419 Ga0466705_185419_14599_15723 374
101 3300042616 Ga0466715_097861 Ga0466715_097861_16764_17918 384
102 3300042616 Ga0466715_271261 Ga0466715_271261_2140_3297 385
103 3300042616 Ga0466715_049759 Ga0466715_049759_866_2035 389
104 3300042612 Ga0466705_059929 Ga0466705_059929_10959_12137 392

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.