Protein Family IF07068
Metagenome
Isolate
104
Members
31
Samples
103
Scaffolds
339.28
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_059929|Ga0466705_059929_10959_12137
- Length
- 392 aa
- Sequence
- MPRNGEANAGAPPESGVFERFRVFFIKAPRMPVPCIYPEVSMKKLFLKGGAPSAGRSRPAAAVFAALAAIVVSCSTGEAVEQILGGSAAAPVFISCRAVSPTEIDFHFSTAVRVLSLNFSPDLEAGTSSEGNMVRVSLASAAGEGARLTADLLVEDARGNTLNVLVPLRARNDRMPPFLINELRTEHSKPKTEFIELKTTGPGSLGALRLFIAGNAKQPLVYEFPPAEVKKGEYIVIHLRNIEEGTADETGADXXIXXXADAQGDARDFWIPGSGKLLHKTDAVYFLDQDDRVIDGVMLSENPDPRWKKDHFAQAAEFLHGQGAWAQIPPGDTGGAVPGPADAVHTAAVKTAMTRSVSRDETAADTNTAADWYVTATGGATPGKPNNPKRFE
Sample Types
Isolate
1.0%
Metagenome
99.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
46.7%
Termitidae
23.3%
Rhinotermitidae
10.0%
Unclassified
10.0%
Termopsidae
6.7%
Blaberidae
3.3%
Taxonomy
Archaea
0
Bacteria
98
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 2 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 3 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 4 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 5 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 6 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_462329 | 3300042615 | Bacteria | 30482 |
| 2 | Ga0466715_097861 | 3300042616 | Bacteria | 28870 |
| 3 | Ga0466715_271261 | 3300042616 | Bacteria | 5364 |
| 4 | Ga0466723_062733 | 3300042618 | Bacteria | 35703 |
| 5 | Ga0466723_084546 | 3300042618 | Bacteria | 4945 |
| 6 | Ga0466726_031006 | 3300042619 | Bacteria | 20841 |
| 7 | Ga0466731_287596 | 3300042622 | Bacteria | 1615 |
| 8 | Ga0466709_035429 | 3300042648 | Bacteria | 8310 |
| 9 | Ga0466708_169734 | 3300042652 | Bacteria | 12525 |
| 10 | Ga0466727_255723 | 3300042655 | Bacteria | 1343 |
| 11 | Ga0415639_100240 | 3300038395 | Unclassified | 1331 |
| 12 | Ga0466692_204205 | 3300042591 | Bacteria | 7486 |
| 13 | Ga0466716_138544 | 3300042605 | Bacteria | 6471 |
| 14 | Ga0466722_047115 | 3300042609 | Bacteria | 2116 |
| 15 | Ga0466722_052243 | 3300042609 | Bacteria | 23183 |
| 16 | Ga0466722_072985 | 3300042609 | Bacteria | 33307 |
| 17 | Ga0466705_062540 | 3300042612 | Unclassified | 10012 |
| 18 | Ga0466705_121424 | 3300042612 | Bacteria | 14439 |
| 19 | Ga0466705_185419 | 3300042612 | Bacteria | 16741 |
| 20 | Ga0466705_238594 | 3300042612 | Bacteria | 4988 |
| 21 | Ga0466715_282627 | 3300042616 | Bacteria | 4316 |
| 22 | Ga0466726_093307 | 3300042619 | Bacteria | 3491 |
| 23 | Ga0466704_045874 | 3300042643 | Bacteria | 2356 |
| 24 | Ga0466704_179992 | 3300042643 | Bacteria | 35247 |
| 25 | Ga0466704_515376 | 3300042643 | Bacteria | 3987 |
| 26 | Ga0466704_565861 | 3300042643 | Bacteria | 62930 |
| 27 | Ga0466709_317002 | 3300042648 | Bacteria | 7009 |
| 28 | Ga0466708_038994 | 3300042652 | Bacteria | 9046 |
| 29 | Ga0466708_100401 | 3300042652 | Bacteria | 3869 |
| 30 | Ga0466708_124385 | 3300042652 | Bacteria | 5885 |
| 31 | Ga0466708_160197 | 3300042652 | Bacteria | 15593 |
| 32 | Ga0466708_368631 | 3300042652 | Bacteria | 10645 |
| 33 | Ga0466727_311108 | 3300042655 | Bacteria | 4392 |
| 34 | Ga0466691_089028 | 3300042593 | Bacteria | 39976 |
| 35 | Ga0466711_100242 | 3300042615 | Bacteria | 5339 |
| 36 | Ga0466711_137705 | 3300042615 | Bacteria | 18389 |
| 37 | Ga0466723_015663 | 3300042618 | Bacteria | 58778 |
| 38 | Ga0466729_149324 | 3300042621 | Bacteria | 1142 |
| 39 | Ga0466731_276331 | 3300042622 | Bacteria | 3439 |
| 40 | Ga0466709_088329 | 3300042648 | Bacteria | 11205 |
| 41 | Ga0466708_137098 | 3300042652 | Bacteria | 3910 |
| 42 | Ga0466727_176254 | 3300042655 | Bacteria | 1922 |
| 43 | Ga0264413_112480 | 3300024493 | Bacteria | 7766 |
| 44 | Ga0466696_038136 | 3300042596 | Bacteria | 24965 |
| 45 | Ga0466720_023642 | 3300042607 | Bacteria | 4937 |
| 46 | Ga0466720_035397 | 3300042607 | Bacteria | 15228 |
| 47 | Ga0466722_230831 | 3300042609 | Bacteria | 11349 |
| 48 | Ga0466715_130506 | 3300042616 | Bacteria | 5014 |
| 49 | Ga0466723_260481 | 3300042618 | Bacteria | 12284 |
| 50 | Ga0466728_452306 | 3300042620 | Bacteria | 5166 |
| 51 | Ga0466704_115155 | 3300042643 | Bacteria | 14950 |
| 52 | Ga0466709_401044 | 3300042648 | Bacteria | 10574 |
| 53 | Ga0466696_391482 | 3300042596 | Bacteria | 6167 |
| 54 | Ga0466707_073684 | 3300042601 | Bacteria | 21760 |
| 55 | Ga0466719_421406 | 3300042606 | Bacteria | 13928 |
| 56 | Ga0466715_049759 | 3300042616 | Bacteria | 3541 |
| 57 | Ga0466715_270811 | 3300042616 | Bacteria | 16378 |
| 58 | Ga0466723_035164 | 3300042618 | Bacteria | 5075 |
| 59 | Ga0466726_382028 | 3300042619 | Bacteria | 14308 |
| 60 | Ga0466703_362182 | 3300042636 | Bacteria | 4742 |
| 61 | Ga0466704_112645 | 3300042643 | Bacteria | 5690 |
| 62 | Ga0466709_347446 | 3300042648 | Bacteria | 5417 |
| 63 | Ga0466696_018386 | 3300042596 | Bacteria | 22730 |
| 64 | Ga0466716_250886 | 3300042605 | Bacteria | 5695 |
| 65 | Ga0466722_205735 | 3300042609 | Bacteria | 5520 |
| 66 | Ga0466705_388098 | 3300042612 | Bacteria | 2065 |
| 67 | Ga0466711_069804 | 3300042615 | Bacteria | 1392 |
| 68 | Ga0466711_077910 | 3300042615 | Bacteria | 5629 |
| 69 | Ga0466711_124715 | 3300042615 | Bacteria | 8934 |
| 70 | Ga0466711_346755 | 3300042615 | Bacteria | 5298 |
| 71 | Ga0466723_196774 | 3300042618 | Bacteria | 9391 |
| 72 | Ga0466703_065868 | 3300042636 | Bacteria | 21346 |
| 73 | Ga0466703_390324 | 3300042636 | Bacteria | 9390 |
| 74 | Ga0466709_313719 | 3300042648 | Bacteria | 10898 |
| 75 | Ga0123353_10668910 | 3300010167 | Bacteria | 1465 |
| 76 | Ga0466696_229954 | 3300042596 | Bacteria | 12821 |
| 77 | Ga0466700_039108 | 3300042600 | Bacteria | 9355 |
| 78 | Ga0466707_091611 | 3300042601 | Bacteria | 4213 |
| 79 | Ga0466716_137405 | 3300042605 | Bacteria | 2918 |
| 80 | Ga0466722_097332 | 3300042609 | Bacteria | 6544 |
| 81 | Ga0466712_324189 | 3300042614 | Bacteria | 7264 |
| 82 | Ga0466715_038085 | 3300042616 | Bacteria | 2201 |
| 83 | Ga0466715_069049 | 3300042616 | Unclassified | 12378 |
| 84 | Ga0466723_136914 | 3300042618 | Bacteria | 3396 |
| 85 | Ga0466709_071557 | 3300042648 | Bacteria | 14177 |
| 86 | Ga0466708_354169 | 3300042652 | Bacteria | 9019 |
| 87 | JGI24695J34938_10000080 | 3300002450 | Bacteria | 82616 |
| 88 | Ga0466696_303336 | 3300042596 | Bacteria | 19247 |
| 89 | Ga0466713_078093 | 3300042602 | Unclassified | 2358 |
| 90 | Ga0466719_077038 | 3300042606 | Unclassified | 2010 |
| 91 | Ga0466705_059929 | 3300042612 | Bacteria | 14929 |
| 92 | Ga0466711_435155 | 3300042615 | Bacteria | 4009 |
| 93 | Ga0466715_368617 | 3300042616 | Bacteria | 16621 |
| 94 | Ga0466703_388393 | 3300042636 | Bacteria | 5529 |
| 95 | Ga0466709_091133 | 3300042648 | Bacteria | 5412 |
| 96 | Ga0068305_10079296 | 3300005083 | Bacteria | 4280 |
| 97 | Ga0466690_029256 | 3300042590 | Bacteria | 4541 |
| 98 | Ga0466690_331869 | 3300042590 | Unclassified | 2862 |
| 99 | Ga0466692_060612 | 3300042591 | Bacteria | 8954 |
| 100 | Ga0466719_268321 | 3300042606 | Bacteria | 2683 |
| 101 | Ga0466719_345398 | 3300042606 | Bacteria | 10216 |
| 102 | Ga0466720_072156 | 3300042607 | Bacteria | 2848 |
| 103 | Ga0466722_067468 | 3300042609 | Bacteria | 5628 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042602 | Ga0466713_078093 | Ga0466713_078093_1448_2314 | 288 |
| 2 | 3300042601 | Ga0466707_091611 | Ga0466707_091611_77_1081 | 300 |
| 3 | 3300042622 | Ga0466731_287596 | Ga0466731_287596_581_1585 | 302 |
| 4 | 3300042622 | Ga0466731_276331 | Ga0466731_276331_2471_3388 | 305 |
| 5 | 3300042607 | Ga0466720_072156 | Ga0466720_072156_744_1751 | 307 |
| 6 | 3300042601 | Ga0466707_073684 | Ga0466707_073684_19300_20304 | 314 |
| 7 | 3300042652 | Ga0466708_354169 | Ga0466708_354169_6391_7341 | 316 |
| 8 | 3300042648 | Ga0466709_401044 | Ga0466709_401044_3800_4753 | 317 |
| 9 | 3300042655 | Ga0466727_176254 | Ga0466727_176254_320_1273 | 317 |
| 10 | 3300042616 | Ga0466715_130506 | Ga0466715_130506_3282_4238 | 318 |
| 11 | 3300042609 | Ga0466722_052243 | Ga0466722_052243_4465_5427 | 320 |
| 12 | 3300042596 | Ga0466696_229954 | Ga0466696_229954_1970_2983 | 322 |
| 13 | 3300042616 | Ga0466715_069049 | Ga0466715_069049_3595_4710 | 322 |
| 14 | 3300042609 | Ga0466722_230831 | Ga0466722_230831_2003_2983 | 326 |
| 15 | 3300042612 | Ga0466705_121424 | Ga0466705_121424_9614_10651 | 327 |
| 16 | 3300042591 | Ga0466692_204205 | Ga0466692_204205_1789_2775 | 328 |
| 17 | 3300042618 | Ga0466723_062733 | Ga0466723_062733_28935_29921 | 328 |
| 18 | 3300042655 | Ga0466727_255723 | Ga0466727_255723_312_1298 | 328 |
| 19 | 3300042618 | Ga0466723_035164 | Ga0466723_035164_3219_4271 | 329 |
| 20 | 3300042621 | Ga0466729_149324 | Ga0466729_149324_88_1113 | 329 |
| 21 | 3300010167 | Ga0123353_10668910 | Ga0123353_106689101 | 332 |
| 22 | 3300042615 | Ga0466711_124715 | Ga0466711_124715_667_1665 | 332 |
| 23 | 3300042648 | Ga0466709_035429 | Ga0466709_035429_4576_5631 | 332 |
| 24 | 3300042648 | Ga0466709_317002 | Ga0466709_317002_1016_2014 | 332 |
| 25 | 3300002450 | JGI24695J34938_10000080 | JGI24695J34938_1000008032 | 333 |
| 26 | 3300042609 | Ga0466722_205735 | Ga0466722_205735_550_1554 | 334 |
| 27 | 3300042615 | Ga0466711_435155 | Ga0466711_435155_2083_3087 | 334 |
| 28 | 3300024493 | Ga0264413_112480 | Ga0264413_1124806 | 335 |
| 29 | 3300042591 | Ga0466692_060612 | Ga0466692_060612_4099_5106 | 335 |
| 30 | 3300042607 | Ga0466720_023642 | Ga0466720_023642_1507_2514 | 335 |
| 31 | 3300042643 | Ga0466704_515376 | Ga0466704_515376_767_1798 | 335 |
| 32 | 3300042614 | Ga0466712_324189 | Ga0466712_324189_5502_6512 | 336 |
| 33 | 3300042616 | Ga0466715_038085 | Ga0466715_038085_132_1205 | 337 |
| 34 | 3300042618 | Ga0466723_136914 | Ga0466723_136914_293_1306 | 337 |
| 35 | 3300042606 | Ga0466719_421406 | Ga0466719_421406_8347_9363 | 338 |
| 36 | 3300042607 | Ga0466720_035397 | Ga0466720_035397_12396_13412 | 338 |
| 37 | 3300042609 | Ga0466722_067468 | Ga0466722_067468_1066_2082 | 338 |
| 38 | 3300042612 | Ga0466705_062540 | Ga0466705_062540_8360_9376 | 338 |
| 39 | 3300042615 | Ga0466711_137705 | Ga0466711_137705_4030_5046 | 338 |
| 40 | 3300042619 | Ga0466726_382028 | Ga0466726_382028_270_1286 | 338 |
| 41 | 3300042643 | Ga0466704_115155 | Ga0466704_115155_5941_6957 | 338 |
| 42 | 3300042648 | Ga0466709_071557 | Ga0466709_071557_8134_9150 | 338 |
| 43 | 3300042652 | Ga0466708_100401 | Ga0466708_100401_688_1704 | 338 |
| 44 | 3300042652 | Ga0466708_137098 | Ga0466708_137098_2305_3321 | 338 |
| 45 | iso_pr_bacteria | 2772190975 | 2773721391 | 338 |
| 46 | 3300042612 | Ga0466705_388098 | Ga0466705_388098_914_1933 | 339 |
| 47 | 3300042619 | Ga0466726_031006 | Ga0466726_031006_11464_12483 | 339 |
| 48 | 3300042652 | Ga0466708_124385 | Ga0466708_124385_2727_3746 | 339 |
| 49 | 3300042605 | Ga0466716_138544 | Ga0466716_138544_1351_2373 | 340 |
| 50 | 3300042609 | Ga0466722_097332 | Ga0466722_097332_1179_2201 | 340 |
| 51 | 3300042590 | Ga0466690_331869 | Ga0466690_331869_54_1079 | 341 |
| 52 | 3300042593 | Ga0466691_089028 | Ga0466691_089028_8472_9497 | 341 |
| 53 | 3300042596 | Ga0466696_018386 | Ga0466696_018386_20011_21036 | 341 |
| 54 | 3300042596 | Ga0466696_303336 | Ga0466696_303336_2877_3902 | 341 |
| 55 | 3300042606 | Ga0466719_345398 | Ga0466719_345398_8189_9214 | 341 |
| 56 | 3300042616 | Ga0466715_270811 | Ga0466715_270811_11595_12620 | 341 |
| 57 | 3300042618 | Ga0466723_015663 | Ga0466723_015663_43250_44275 | 341 |
| 58 | 3300042619 | Ga0466726_093307 | Ga0466726_093307_202_1227 | 341 |
| 59 | 3300042636 | Ga0466703_065868 | Ga0466703_065868_8801_9826 | 341 |
| 60 | 3300042643 | Ga0466704_045874 | Ga0466704_045874_1006_2031 | 341 |
| 61 | 3300042643 | Ga0466704_179992 | Ga0466704_179992_17024_18049 | 341 |
| 62 | 3300042652 | Ga0466708_038994 | Ga0466708_038994_3967_5061 | 341 |
| 63 | 3300042609 | Ga0466722_072985 | Ga0466722_072985_7786_8814 | 342 |
| 64 | 3300042615 | Ga0466711_069804 | Ga0466711_069804_13_1041 | 342 |
| 65 | 3300042616 | Ga0466715_282627 | Ga0466715_282627_2541_3602 | 342 |
| 66 | 3300042648 | Ga0466709_313719 | Ga0466709_313719_6085_7113 | 342 |
| 67 | 3300042655 | Ga0466727_311108 | Ga0466727_311108_2229_3257 | 342 |
| 68 | 3300042596 | Ga0466696_038136 | Ga0466696_038136_9313_10344 | 343 |
| 69 | 3300042596 | Ga0466696_391482 | Ga0466696_391482_2423_3454 | 343 |
| 70 | 3300042605 | Ga0466716_137405 | Ga0466716_137405_736_1767 | 343 |
| 71 | 3300042615 | Ga0466711_462329 | Ga0466711_462329_15275_16306 | 343 |
| 72 | 3300042618 | Ga0466723_196774 | Ga0466723_196774_6608_7639 | 343 |
| 73 | 3300042618 | Ga0466723_260481 | Ga0466723_260481_364_1395 | 343 |
| 74 | 3300042636 | Ga0466703_362182 | Ga0466703_362182_97_1128 | 343 |
| 75 | 3300042636 | Ga0466703_388393 | Ga0466703_388393_1806_2837 | 343 |
| 76 | 3300042643 | Ga0466704_112645 | Ga0466704_112645_3459_4490 | 343 |
| 77 | 3300042652 | Ga0466708_160197 | Ga0466708_160197_7835_8866 | 343 |
| 78 | 3300042652 | Ga0466708_368631 | Ga0466708_368631_8480_9511 | 343 |
| 79 | 3300042615 | Ga0466711_077910 | Ga0466711_077910_1065_2102 | 345 |
| 80 | 3300042615 | Ga0466711_100242 | Ga0466711_100242_473_1510 | 345 |
| 81 | 3300042616 | Ga0466715_368617 | Ga0466715_368617_4024_5064 | 346 |
| 82 | 3300042636 | Ga0466703_390324 | Ga0466703_390324_5688_6728 | 346 |
| 83 | 3300042590 | Ga0466690_029256 | Ga0466690_029256_156_1199 | 347 |
| 84 | 3300042606 | Ga0466719_077038 | Ga0466719_077038_956_1999 | 347 |
| 85 | 3300042606 | Ga0466719_268321 | Ga0466719_268321_1509_2552 | 347 |
| 86 | 3300042648 | Ga0466709_088329 | Ga0466709_088329_8400_9443 | 347 |
| 87 | 3300042652 | Ga0466708_169734 | Ga0466708_169734_1620_2663 | 347 |
| 88 | 3300042609 | Ga0466722_047115 | Ga0466722_047115_509_1555 | 348 |
| 89 | 3300042605 | Ga0466716_250886 | Ga0466716_250886_1041_2111 | 349 |
| 90 | 3300042620 | Ga0466728_452306 | Ga0466728_452306_1041_2093 | 350 |
| 91 | 3300042648 | Ga0466709_347446 | Ga0466709_347446_3919_4971 | 350 |
| 92 | 3300042648 | Ga0466709_091133 | Ga0466709_091133_4043_5140 | 351 |
| 93 | 3300042612 | Ga0466705_238594 | Ga0466705_238594_3137_4195 | 352 |
| 94 | 3300005083 | Ga0068305_10079296 | Ga0068305_100792962 | 353 |
| 95 | 3300042600 | Ga0466700_039108 | Ga0466700_039108_5148_6209 | 353 |
| 96 | 3300038395 | Ga0415639_100240 | Ga0415639_100240_244_1308 | 354 |
| 97 | 3300042615 | Ga0466711_346755 | Ga0466711_346755_4137_5207 | 356 |
| 98 | 3300042643 | Ga0466704_565861 | Ga0466704_565861_50853_51923 | 356 |
| 99 | 3300042618 | Ga0466723_084546 | Ga0466723_084546_2145_3227 | 360 |
| 100 | 3300042612 | Ga0466705_185419 | Ga0466705_185419_14599_15723 | 374 |
| 101 | 3300042616 | Ga0466715_097861 | Ga0466715_097861_16764_17918 | 384 |
| 102 | 3300042616 | Ga0466715_271261 | Ga0466715_271261_2140_3297 | 385 |
| 103 | 3300042616 | Ga0466715_049759 | Ga0466715_049759_866_2035 | 389 |
| 104 | 3300042612 | Ga0466705_059929 | Ga0466705_059929_10959_12137 | 392 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.76 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.