Protein Family IF07047

Metagenome Isolate
270 Members
104 Samples
226 Scaffolds
573.05 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_024691|Ga0466705_024691_899_2761
Length
613 aa
Sequence
MNHPVLEFKHFSFQYRSQTEPTLKDISLKVEKGEKILILGPSGSGKSTLIHCVNGLVPHAYKGTIRGEYSIMGRDGLSLDIFELSKLAGTVLQDSDGQFMGLSAAEDIAFAAENDCVPTPELQRRAAETAALVGMERYLSRSPQDLSGGQKQRVSMAGVLMDDVELLLFDEPLANLDPAAGMDAIELIDALHKNTGKTILIVEHRLEDVLHRAVDRVVLFDGGRIAADLSPAEMLASGLLPEAGIREPLYISALRYAGLPVTSRPESLETLSFEKSALVAWCDAAKAPRPETPPPLLEIRDLSFRYENADYGGFAGEIREGHENHEGRGHDCPETDSRRSAGGIERVSFFVGRGECMSLVGENGAGKSTLAKLICGFCRPDSGTICFNGEDLAPLTIMERAERIGYVMQNPNQMISFPMIYDEVAFGLRNRDVGEDEIRDRVYRALKVCGLYPFRNWPVSALSYGQKKRLTIAAILVLNPAFIIMDEPTAGQDYRHYTEFMEFLKKLNGEQGLSLLLITHDMHLMLEYTPRAAVFAGGKCLAVKETVEVLTDRGLIERARLKQTSLYDLALKTGVADPHLFIRRFIAHENRLRAANAASHDDGFAAPAAGDTV

πŸ“Š Sample Types

Isolate 16.3%
Metagenome 83.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 25.0%
Unclassified 22.0%
Kalotermitidae 14.0%
Pyralidae 5.0%
Tenebrionidae 4.0%
Rhinotermitidae 4.0%
Scarabaeidae 4.0%
Termopsidae 3.0%
Drosophilidae 2.0%
Apidae 2.0%
Bombycidae 2.0%
Passalidae 2.0%
Formicidae 2.0%
Hodotermitidae 1.0%
Hydrophilidae 1.0%
Noctuidae 1.0%
Eresidae 1.0%
Culicidae 1.0%
Elmidae 1.0%
Ocypodidae 1.0%
Curculionidae 1.0%
Blaberidae 1.0%

🌳 Taxonomy

Archaea 1
Bacteria 255
Eukaryota 0
Viruses 0
Unclassified 14

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
2 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
15 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
16 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
17 8022725327 Bacillus sp. SN10 Isolate Eresidae
18 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
19 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
28 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
29 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
30 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
31 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
32 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 2978778678 Bacillus cereus 25 Isolate Ocypodidae
35 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
36 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
39 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
40 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
41 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
43 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
44 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
47 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
48 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
49 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
50 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
51 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
52 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
53 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
54 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
55 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
56 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
57 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
58 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
59 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
60 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
61 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
62 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
63 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
64 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
65 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
66 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
67 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
68 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
71 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
72 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
73 2772190975 Treponema sp. RmG30 Isolate Blaberidae
74 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
75 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
76 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
77 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
78 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
79 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
80 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
81 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
82 650716102 Treponema primitia ZAS-2 Isolate Unclassified
83 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
84 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
85 2537562000 Bacillus cereus HD73 Isolate Pyralidae
86 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
87 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
88 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
89 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
90 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
91 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
92 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
93 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
94 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
95 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
96 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
97 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
98 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
99 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
100 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
101 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
102 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
103 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
104 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466729_197384 3300042621 Bacteria 2863
2 Ga0466703_125329 3300042636 Bacteria 29013
3 Ga0466709_016367 3300042648 Bacteria 7361
4 Ga0466709_149889 3300042648 Bacteria 8713
5 Ga0466708_420759 3300042652 Bacteria 58319
6 Ga0466712_002425 3300042614 Unclassified 2479
7 Ga0466712_192768 3300042614 Bacteria 48341
8 Ga0466712_298328 3300042614 Bacteria 2092
9 Ga0466711_294243 3300042615 Bacteria 4910
10 Ga0466715_058779 3300042616 Bacteria 37907
11 Ga0466723_225852 3300042618 Bacteria 63792
12 Ga0466726_076007 3300042619 Bacteria 7700
13 Ga0466726_427845 3300042619 Bacteria 2769
14 Ga0466728_117830 3300042620 Bacteria 9706
15 Ga0123353_10386227 3300010167 Bacteria 2091
16 Ga0466690_005527 3300042590 Bacteria 5812
17 Ga0466690_058430 3300042590 Bacteria 6675
18 Ga0466690_082694 3300042590 Bacteria 3166
19 Ga0466690_187650 3300042590 Bacteria 9765
20 Ga0466690_383723 3300042590 Bacteria 2922
21 Ga0466692_013191 3300042591 Bacteria 6343
22 Ga0466691_058612 3300042593 Bacteria 167737
23 Ga0466691_132344 3300042593 Bacteria 5885
24 Ga0466691_203397 3300042593 Bacteria 4516
25 Ga0466699_048858 3300042597 Bacteria 31462
26 Ga0466720_155108 3300042607 Unclassified 5760
27 Ga0466722_233946 3300042609 Bacteria 21659
28 Ga0466722_235284 3300042609 Bacteria 7999
29 IMNBL1DRAFT_c0023391 3300000062 Bacteria 2421
30 CVPL010L_1000475 3300002932 Unclassified 17522
31 Ga0072941_1014433 3300005201 Bacteria 6692
32 Ga0074263_102130 3300005485 Bacteria 1995
33 Ga0466732_116734 3300042656 Bacteria 4751
34 Ga0562375_0058 3300056856 Bacteria 444736
35 Ga0466712_028589 3300042614 Bacteria 2807
36 Ga0466712_259879 3300042614 Bacteria 13634
37 Ga0466711_440263 3300042615 Bacteria 4374
38 Ga0466715_285090 3300042616 Bacteria 12088
39 Ga0466718_059207 3300042617 Bacteria 5097
40 Ga0466718_064942 3300042617 Bacteria 3894
41 Ga0466723_072326 3300042618 Bacteria 29079
42 Ga0466728_370765 3300042620 Bacteria 7459
43 Ga0264413_101916 3300024493 Bacteria 12554
44 Ga0466690_095247 3300042590 Bacteria 3290
45 Ga0466692_157647 3300042591 Bacteria 35780
46 Ga0466696_155253 3300042596 Bacteria 19714
47 Ga0466696_205181 3300042596 Bacteria 5064
48 Ga0466699_443634 3300042597 Bacteria 28955
49 Ga0466716_224521 3300042605 Bacteria 3150
50 Ga0466716_407272 3300042605 Bacteria 6127
51 Ga0466719_035069 3300042606 Bacteria 14650
52 Ga0466719_110192 3300042606 Bacteria 7789
53 Ga0466719_379308 3300042606 Bacteria 31120
54 Ga0466720_022378 3300042607 Bacteria 4741
55 Ga0466720_160476 3300042607 Bacteria 12645
56 Ga0466722_238036 3300042609 Bacteria 3136
57 2227635718 2225789004 Unclassified 11247
58 JGI24695J34938_10000043 3300002450 Bacteria 94696
59 JGI24695J34938_10000317 3300002450 Bacteria 47269
60 Ga0466705_011217 3300042612 Bacteria 4665
61 Ga0466705_100638 3300042612 Bacteria 19365
62 Ga0466733_021955 3300042659 Bacteria 13737
63 Ga0466733_149910 3300042659 Bacteria 4587
64 Ga0562374_0635 3300057007 Unclassified 53802
65 Ga0466703_096549 3300042636 Bacteria 16006
66 Ga0466703_213847 3300042636 Bacteria 8539
67 Ga0466708_129078 3300042652 Bacteria 3910
68 Ga0466715_296841 3300042616 Bacteria 2803
69 Ga0466718_030577 3300042617 Bacteria 14715
70 Ga0466718_090959 3300042617 Bacteria 6236
71 Ga0466723_202451 3300042618 Bacteria 12166
72 Ga0466726_139110 3300042619 Bacteria 9745
73 Ga0466728_022111 3300042620 Bacteria 7109
74 Ga0264413_104632 3300024493 Bacteria 2796
75 Ga0264413_107812 3300024493 Bacteria 17404
76 Ga0466691_067093 3300042593 Bacteria 27867
77 Ga0466699_301769 3300042597 Bacteria 9667
78 Ga0466707_093019 3300042601 Bacteria 2589
79 Ga0466713_155845 3300042602 Unclassified 168359
80 Ga0466716_343928 3300042605 Bacteria 4147
81 Ga0466719_092221 3300042606 Bacteria 8565
82 Ga0466720_012994 3300042607 Bacteria 8401
83 2227080776 2225789004 Unclassified 183011
84 JGI24698J34947_10007026 3300002449 Bacteria 6188
85 JGI24695J34938_10000212 3300002450 Bacteria 55353
86 JGI24695J34938_10001404 3300002450 Bacteria 20578
87 JGI24703J35330_11748067 3300002501 Bacteria 10352
88 CVPL010L_1001473 3300002932 Unclassified 3429
89 Ga0072941_1002917 3300005201 Bacteria 19243
90 Ga0072941_1007444 3300005201 Bacteria 6851
91 Ga0466705_137155 3300042612 Unclassified 4037
92 Ga0562379_0069 3300056790 Bacteria 430601
93 Ga0466731_264621 3300042622 Bacteria 3508
94 Ga0466708_169301 3300042652 Bacteria 2414
95 Ga0466715_419971 3300042616 Bacteria 5973
96 Ga0466718_092740 3300042617 Bacteria 26065
97 Ga0466723_110051 3300042618 Bacteria 8882
98 Ga0466726_227057 3300042619 Bacteria 2983
99 Ga0123353_10089234 3300010167 Bacteria 4964
100 Ga0123353_10268879 3300010167 Bacteria 2628
101 Ga0123353_10402005 3300010167 Bacteria 2038
102 Ga0264413_100006 3300024493 Bacteria 5714
103 Ga0264413_116464 3300024493 Bacteria 10590
104 Ga0466690_050938 3300042590 Bacteria 10510
105 Ga0466691_089239 3300042593 Bacteria 12278
106 Ga0466696_160826 3300042596 Bacteria 4854
107 Ga0466699_323612 3300042597 Bacteria 4988
108 Ga0466716_176224 3300042605 Bacteria 4662
109 Ga0466720_124760 3300042607 Bacteria 31233
110 HBC_ctgsDRAFT_1000446 3300000333 Unclassified 9341
111 JGI24695J34938_10000009 3300002450 Bacteria 135235
112 Ga0072940_1044681 3300005200 Bacteria 2848
113 Ga0072941_1119663 3300005201 Bacteria 2772
114 Ga0466732_350791 3300042656 Bacteria 2846
115 Ga0466733_136445 3300042659 Bacteria 3837
116 Ga0562377_0111 3300056842 Bacteria 260589
117 Ga0466735_147008 3300042624 Bacteria 3514
118 Ga0466704_495073 3300042643 Bacteria 3501
119 Ga0466709_104383 3300042648 Bacteria 21621
120 Ga0466709_398741 3300042648 Bacteria 4675
121 Ga0466708_098623 3300042652 Bacteria 3480
122 Ga0466708_466292 3300042652 Bacteria 3381
123 Ga0466723_146995 3300042618 Bacteria 13213
124 Ga0264413_110111 3300024493 Bacteria 5600
125 Ga0466690_133639 3300042590 Bacteria 48450
126 Ga0466691_010897 3300042593 Bacteria 19539
127 Ga0466691_200520 3300042593 Bacteria 4822
128 Ga0466699_258354 3300042597 Bacteria 5387
129 Ga0466706_217296 3300042599 Bacteria 30204
130 Ga0466719_498156 3300042606 Bacteria 69594
131 Ga0466720_044669 3300042607 Bacteria 23520
132 Ga0466722_092688 3300042609 Bacteria 8912
133 2230969617 2228664004 Bacteria 10160
134 AustNasuHG_c1024297 3300000089 Bacteria 1922
135 JGI24698J34947_10012304 3300002449 Bacteria 4690
136 JGI24700J35501_10930145 3300002508 Bacteria 11699
137 Ga0063521_1000504 3300003973 Bacteria 18162
138 Ga0072941_1005800 3300005201 Bacteria 35925
139 Ga0466732_008750 3300042656 Bacteria 4117
140 Ga0466703_150682 3300042636 Bacteria 44505
141 Ga0466709_086341 3300042648 Bacteria 317133
142 Ga0466727_136602 3300042655 Bacteria 7996
143 Ga0466705_449620 3300042612 Bacteria 3769
144 Ga0466712_195148 3300042614 Bacteria 34102
145 Ga0466715_510456 3300042616 Bacteria 4048
146 Ga0466715_534731 3300042616 Bacteria 6629
147 Ga0466718_042663 3300042617 Bacteria 1965
148 Ga0466728_274274 3300042620 Bacteria 22423
149 Ga0466729_140423 3300042621 Bacteria 5806
150 Ga0123355_10000441 3300009826 Bacteria 54815
151 Ga0123353_10239772 3300010167 Unclassified 2818
152 Ga0466691_201570 3300042593 Bacteria 4016
153 Ga0466699_325566 3300042597 Bacteria 17873
154 Ga0466716_009745 3300042605 Bacteria 2327
155 Ga0466716_111671 3300042605 Bacteria 3249
156 Ga0466719_033626 3300042606 Bacteria 45932
157 Ga0466719_328193 3300042606 Bacteria 5469
158 JGI24698J34947_10022868 3300002449 Bacteria 3348
159 JGI24695J34938_10000042 3300002450 Bacteria 95222
160 JGI24695J34938_10010792 3300002450 Bacteria 4968
161 JGI24702J35022_10004713 3300002462 Bacteria 8076
162 JGI24699J35502_11131491 3300002509 Bacteria 5749
163 Ga0072941_1003453 3300005201 Bacteria 10168
164 Ga0072941_1025985 3300005201 Bacteria 17479
165 Ga0466697_161787 3300042611 Bacteria 2971
166 Ga0466705_024691 3300042612 Bacteria 3419
167 Ga0466733_021704 3300042659 Bacteria 11735
168 Ga0466704_433507 3300042643 Bacteria 27110
169 Ga0466708_168232 3300042652 Bacteria 3219
170 Ga0466712_031105 3300042614 Bacteria 6966
171 Ga0466715_210659 3300042616 Bacteria 15065
172 Ga0466718_022803 3300042617 Bacteria 4483
173 Ga0466718_086242 3300042617 Bacteria 67871
174 Ga0466718_140360 3300042617 Bacteria 11801
175 Ga0466723_199080 3300042618 Bacteria 8348
176 Ga0466723_247480 3300042618 Bacteria 81364
177 Ga0466723_356060 3300042618 Unclassified 4392
178 Ga0123353_10102117 3300010167 Bacteria 4622
179 Ga0264413_104982 3300024493 Unclassified 6520
180 Ga0264413_106559 3300024493 Bacteria 4395
181 Ga0264413_115727 3300024493 Bacteria 42788
182 Ga0264413_118314 3300024493 Bacteria 3387
183 Ga0264413_137270 3300024493 Bacteria 7971
184 Ga0466693_276385 3300042592 Bacteria 14859
185 Ga0466691_118764 3300042593 Bacteria 8104
186 Ga0466716_203114 3300042605 Bacteria 6671
187 Ga0466716_341416 3300042605 Bacteria 27694
188 Ga0466719_524781 3300042606 Bacteria 29036
189 AustNasuHG_c1000153 3300000089 Bacteria 21862
190 JGI24698J34947_10011818 3300002449 Bacteria 4794
191 Ga0072940_1005931 3300005200 Bacteria 28232
192 Ga0072941_1008587 3300005201 Bacteria 6222
193 Ga0466732_208042 3300042656 Bacteria 8600
194 Ga0466729_218477 3300042621 Bacteria 1872
195 Ga0466729_302913 3300042621 Bacteria 2672
196 Ga0466735_042842 3300042624 Bacteria 4407
197 Ga0466735_220687 3300042624 Bacteria 8810
198 Ga0466702_354071 3300042635 Bacteria 21255
199 Ga0466704_325031 3300042643 Bacteria 2580
200 Ga0466709_077102 3300042648 Bacteria 85274
201 Ga0466708_021027 3300042652 Bacteria 3060
202 Ga0466708_130268 3300042652 Bacteria 12791
203 Ga0466711_045896 3300042615 Bacteria 4963
204 Ga0466715_004131 3300042616 Bacteria 27905
205 Ga0466723_010297 3300042618 Bacteria 2681
206 Ga0466723_367174 3300042618 Bacteria 4508
207 Ga0466726_094004 3300042619 Bacteria 3020
208 Ga0123355_10000351 3300009826 Bacteria 59711
209 Ga0123353_10034326 3300010167 Bacteria 7916
210 Ga0264413_104630 3300024493 Bacteria 21539
211 Ga0456237_0002987 3300041968 Archaea 2750
212 Ga0466694_026496 3300042594 Bacteria 10215
213 Ga0466700_015904 3300042600 Bacteria 2770
214 Ga0466716_232442 3300042605 Bacteria 27481
215 Ga0466719_115914 3300042606 Bacteria 4422
216 Ga0466719_534421 3300042606 Bacteria 9712
217 Ga0466720_060753 3300042607 Bacteria 13317
218 Ga0466720_095557 3300042607 Bacteria 9381
219 Ga0466722_182069 3300042609 Bacteria 5336
220 Ga0466698_059652 3300042610 Unclassified 7958
221 2227646880 2225789004 Bacteria 2025
222 AustNasuHG_c1005483 3300000089 Bacteria 4533
223 JGI24695J34938_10009471 3300002450 Bacteria 5414
224 Ga0068305_10006722 3300005083 Bacteria 6217
225 Ga0072940_1003463 3300005200 Bacteria 5093
226 Ga0072941_1038753 3300005201 Bacteria 4603

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_199080 Ga0466723_199080_3605_5098 468
2 3300024493 Ga0264413_100006 Ga0264413_1000063 490
3 3300042618 Ga0466723_367174 Ga0466723_367174_1490_3022 491
4 3300005083 Ga0068305_10006722 Ga0068305_100067222 495
5 3300042616 Ga0466715_210659 Ga0466715_210659_7423_9024 503
6 3300042621 Ga0466729_197384 Ga0466729_197384_461_1972 503
7 3300042612 Ga0466705_011217 Ga0466705_011217_2321_3835 504
8 3300042643 Ga0466704_495073 Ga0466704_495073_1017_2531 504
9 3300000089 AustNasuHG_c1024297 AustNasuHG_10242971 505
10 3300042621 Ga0466729_218477 Ga0466729_218477_45_1583 512
11 iso_pr_bacteria 2781125634 2781275584 519
12 3300042652 Ga0466708_168232 Ga0466708_168232_151_1728 525
13 3300042619 Ga0466726_094004 Ga0466726_094004_367_1950 527
14 3300042609 Ga0466722_238036 Ga0466722_238036_677_2281 534
15 3300042619 Ga0466726_139110 Ga0466726_139110_5570_7243 537
16 3300042636 Ga0466703_096549 Ga0466703_096549_12779_14395 538
17 3300042590 Ga0466690_133639 Ga0466690_133639_34659_36350 542
18 3300057007 Ga0562374_0635 Ga0562374_0635_12147_13844 545
19 2225789004 2227080776 2227451946 546
20 3300042602 Ga0466713_155845 Ga0466713_155845_157327_159024 546
21 3300042648 Ga0466709_086341 Ga0466709_086341_304584_306281 546
22 3300056842 Ga0562377_0111 Ga0562377_0111_202599_204296 546
23 3300000333 HBC_ctgsDRAFT_1000446 HBC_ctgsDRAFT_10004463 547
24 3300042609 Ga0466722_235284 Ga0466722_235284_1476_3119 547
25 3300002932 CVPL010L_1001473 CVPL010L_10014733 548
26 3300024493 Ga0264413_118314 Ga0264413_1183142 549
27 3300042648 Ga0466709_398741 Ga0466709_398741_1600_3309 549
28 3300042615 Ga0466711_045896 Ga0466711_045896_800_2707 550
29 3300042605 Ga0466716_009745 Ga0466716_009745_41_1699 552
30 3300003973 Ga0063521_1000504 Ga0063521_100050417 553
31 3300042593 Ga0466691_089239 Ga0466691_089239_3408_5129 554
32 3300041968 Ga0456237_0002987 Ga0456237_0002987_803_2509 555
33 iso_pr_bacteria 2781125630 2781266531 555
34 3300009826 Ga0123355_10000441 Ga0123355_1000044117 556
35 3300042620 Ga0466728_022111 Ga0466728_022111_2076_3806 556
36 3300042620 Ga0466728_274274 Ga0466728_274274_9757_11478 556
37 3300042652 Ga0466708_420759 Ga0466708_420759_1214_2968 556
38 3300042624 Ga0466735_147008 Ga0466735_147008_1046_2719 557
39 3300002449 JGI24698J34947_10012304 JGI24698J34947_100123045 558
40 3300042590 Ga0466690_187650 Ga0466690_187650_6938_8659 558
41 3300042606 Ga0466719_524781 Ga0466719_524781_19227_20903 558
42 3300042659 Ga0466733_136445 Ga0466733_136445_1950_3683 558
43 3300042614 Ga0466712_031105 Ga0466712_031105_926_2689 559
44 3300042659 Ga0466733_021704 Ga0466733_021704_5051_6784 559
45 3300010167 Ga0123353_10239772 Ga0123353_102397723 560
46 3300042593 Ga0466691_200520 Ga0466691_200520_1400_3127 560
47 3300042659 Ga0466733_021955 Ga0466733_021955_11831_13567 560
48 3300042659 Ga0466733_149910 Ga0466733_149910_2704_4431 560
49 3300042616 Ga0466715_510456 Ga0466715_510456_969_2696 561
50 3300024493 Ga0264413_110111 Ga0264413_1101112 562
51 3300042614 Ga0466712_259879 Ga0466712_259879_10012_11763 562
52 3300042615 Ga0466711_294243 Ga0466711_294243_667_2406 562
53 3300042590 Ga0466690_058430 Ga0466690_058430_2316_4043 563
54 3300042605 Ga0466716_111671 Ga0466716_111671_1322_3043 563
55 3300042616 Ga0466715_296841 Ga0466715_296841_986_2677 563
56 3300042618 Ga0466723_356060 Ga0466723_356060_1002_2729 563
57 iso_pr_bacteria 2820306284 2820307652 563
58 3300002508 JGI24700J35501_10930145 JGI24700J35501_109301456 564
59 iso_pr_bacteria 2878857142 2878858349 565
60 2225789004 2227635718 2228222369 566
61 3300042601 Ga0466707_093019 Ga0466707_093019_675_2375 566
62 3300042605 Ga0466716_203114 Ga0466716_203114_1957_3693 566
63 iso_pr_bacteria 2537562000 2539435407 566
64 iso_pr_bacteria 2563367190 2565790470 566
65 iso_pr_bacteria 2822232166 2822237634 566
66 iso_pr_bacteria 2822450720 2822456335 566
67 iso_pr_bacteria 2850695442 2850698017 566
68 iso_pr_bacteria 2864782175 2864785811 566
69 iso_pr_bacteria 2912849059 2912851731 566
70 iso_pr_bacteria 2978778678 2978782674 566
71 iso_pr_bacteria 643886085 644679988 566
72 iso_pr_bacteria 643886087 644667732 566
73 iso_pr_bacteria 643886090 644661613 566
74 iso_pr_bacteria 643886091 644648632 566
75 iso_pr_bacteria 650716102 650881117 566
76 iso_pr_bacteria 8017458139 8017458349 566
77 iso_pr_bacteria 8017458139 8017459225 566
78 iso_pr_bacteria 8022725327 8022730556 566
79 iso_pr_bacteria 8022781829 8022788212 566
80 iso_pr_bacteria 8061039349 8061041233 566
81 iso_pr_bacteria 8061045771 8061052327 566
82 iso_pr_bacteria 8061100935 8061103724 566
83 3300000062 IMNBL1DRAFT_c0023391 IMNBL1DRAFT_00233912 567
84 3300042606 Ga0466719_092221 Ga0466719_092221_5580_7313 567
85 3300042652 Ga0466708_130268 Ga0466708_130268_2736_4454 567
86 iso_pr_bacteria 8064531044 8064534932 567
87 3300042606 Ga0466719_115914 Ga0466719_115914_2573_4300 568
88 3300056790 Ga0562379_0069 Ga0562379_0069_11557_13263 568
89 3300056856 Ga0562375_0058 Ga0562375_0058_57091_58797 568
90 iso_pr_bacteria 2873581347 2873584180 568
91 iso_pr_bacteria 647533136 647747589 568
92 iso_pr_bacteria 8077780672 8077782491 568
93 3300002932 CVPL010L_1000475 CVPL010L_100047518 569
94 3300042593 Ga0466691_132344 Ga0466691_132344_1680_3389 569
95 3300042620 Ga0466728_117830 Ga0466728_117830_6859_8604 569
96 iso_pr_bacteria 2775507073 2777018276 569
97 iso_pr_bacteria 8018794549 8018795716 569
98 2225789004 2227646880 2228240478 570
99 3300042619 Ga0466726_076007 Ga0466726_076007_159_1871 570
100 iso_pr_bacteria 2731957677 2732688665 570
101 iso_pr_bacteria 2820272499 2820274258 570
102 iso_pr_bacteria 2997944163 2997945791 570
103 3300002501 JGI24703J35330_11748067 JGI24703J35330_117480678 571
104 3300010167 Ga0123353_10268879 Ga0123353_102688792 572
105 3300010167 Ga0123353_10402005 Ga0123353_104020051 572
106 3300042611 Ga0466697_161787 Ga0466697_161787_235_1953 572
107 3300042616 Ga0466715_285090 Ga0466715_285090_2653_4395 572
108 3300042621 Ga0466729_140423 Ga0466729_140423_786_2504 572
109 iso_pr_bacteria 2820236043 2820237011 572
110 3300002449 JGI24698J34947_10007026 JGI24698J34947_100070262 573
111 3300005200 Ga0072940_1003463 Ga0072940_10034633 573
112 3300010167 Ga0123353_10034326 Ga0123353_100343262 573
113 3300042606 Ga0466719_033626 Ga0466719_033626_36176_37897 573
114 3300042618 Ga0466723_146995 Ga0466723_146995_810_2531 573
115 3300042648 Ga0466709_077102 Ga0466709_077102_20451_22172 573
116 3300042590 Ga0466690_082694 Ga0466690_082694_407_2191 574
117 3300042605 Ga0466716_343928 Ga0466716_343928_738_2462 574
118 3300042607 Ga0466720_124760 Ga0466720_124760_5931_7655 574
119 3300042617 Ga0466718_064942 Ga0466718_064942_37_1761 574
120 3300042618 Ga0466723_225852 Ga0466723_225852_19450_21234 574
121 3300005201 Ga0072941_1002917 Ga0072941_10029179 575
122 3300005201 Ga0072941_1025985 Ga0072941_102598512 575
123 3300010167 Ga0123353_10089234 Ga0123353_100892344 575
124 3300042590 Ga0466690_050938 Ga0466690_050938_912_2639 575
125 3300042593 Ga0466691_058612 Ga0466691_058612_102727_104454 575
126 3300042596 Ga0466696_155253 Ga0466696_155253_9651_11378 575
127 3300042596 Ga0466696_160826 Ga0466696_160826_1349_3076 575
128 3300042605 Ga0466716_232442 Ga0466716_232442_10437_12164 575
129 3300042607 Ga0466720_012994 Ga0466720_012994_2263_4008 575
130 3300042612 Ga0466705_100638 Ga0466705_100638_10285_12012 575
131 3300042612 Ga0466705_137155 Ga0466705_137155_1587_3314 575
132 3300042618 Ga0466723_072326 Ga0466723_072326_16415_18142 575
133 3300042652 Ga0466708_098623 Ga0466708_098623_1049_2827 575
134 iso_pr_bacteria 2781125640 2781289161 575
135 3300042605 Ga0466716_176224 Ga0466716_176224_2037_3767 576
136 3300042607 Ga0466720_095557 Ga0466720_095557_3570_5327 576
137 3300042617 Ga0466718_030577 Ga0466718_030577_6233_7963 576
138 3300042652 Ga0466708_129078 Ga0466708_129078_465_2195 576
139 3300042652 Ga0466708_169301 Ga0466708_169301_626_2356 576
140 iso_pr_bacteria 2781125689 2781426061 576
141 3300002509 JGI24699J35502_11131491 JGI24699J35502_111314914 577
142 3300005200 Ga0072940_1044681 Ga0072940_10446813 577
143 3300005485 Ga0074263_102130 Ga0074263_1021302 577
144 3300042597 Ga0466699_258354 Ga0466699_258354_1168_2901 577
145 3300042597 Ga0466699_323612 Ga0466699_323612_118_1851 577
146 3300042607 Ga0466720_160476 Ga0466720_160476_2960_4723 577
147 3300042621 Ga0466729_302913 Ga0466729_302913_105_1838 577
148 3300042597 Ga0466699_443634 Ga0466699_443634_17119_18855 578
149 3300042618 Ga0466723_202451 Ga0466723_202451_3702_5438 578
150 3300009826 Ga0123355_10000351 Ga0123355_100003514 579
151 3300042593 Ga0466691_118764 Ga0466691_118764_1081_2820 579
152 3300042593 Ga0466691_201570 Ga0466691_201570_1143_2882 579
153 3300042596 Ga0466696_205181 Ga0466696_205181_2094_3833 579
154 3300042597 Ga0466699_048858 Ga0466699_048858_19234_20973 579
155 3300042597 Ga0466699_301769 Ga0466699_301769_670_2409 579
156 3300042610 Ga0466698_059652 Ga0466698_059652_1221_2960 579
157 3300042617 Ga0466718_086242 Ga0466718_086242_35819_37558 579
158 3300042617 Ga0466718_090959 Ga0466718_090959_3422_5161 579
159 3300042624 Ga0466735_220687 Ga0466735_220687_1296_3035 579
160 3300042652 Ga0466708_466292 Ga0466708_466292_884_2623 579
161 3300002449 JGI24698J34947_10011818 JGI24698J34947_100118185 580
162 3300005200 Ga0072940_1005931 Ga0072940_10059318 580
163 3300042590 Ga0466690_383723 Ga0466690_383723_426_2168 580
164 3300042636 Ga0466703_213847 Ga0466703_213847_5552_7333 580
165 iso_pr_bacteria 2781125629 2781262640 580
166 2228664004 2230969617 2230683089 581
167 3300005201 Ga0072941_1003453 Ga0072941_10034535 581
168 3300024493 Ga0264413_101916 Ga0264413_10191610 581
169 3300024493 Ga0264413_104630 Ga0264413_10463019 581
170 3300024493 Ga0264413_104632 Ga0264413_1046323 581
171 3300024493 Ga0264413_104982 Ga0264413_1049828 581
172 3300024493 Ga0264413_106559 Ga0264413_1065593 581
173 3300024493 Ga0264413_107812 Ga0264413_1078122 581
174 3300042594 Ga0466694_026496 Ga0466694_026496_3259_5004 581
175 3300042606 Ga0466719_328193 Ga0466719_328193_1366_3198 581
176 3300042606 Ga0466719_498156 Ga0466719_498156_50790_52583 581
177 3300042607 Ga0466720_022378 Ga0466720_022378_1602_3347 581
178 3300042607 Ga0466720_044669 Ga0466720_044669_14934_16679 581
179 3300042607 Ga0466720_060753 Ga0466720_060753_8333_10078 581
180 3300042607 Ga0466720_155108 Ga0466720_155108_2123_3868 581
181 3300042614 Ga0466712_298328 Ga0466712_298328_19_1764 581
182 3300042656 Ga0466732_350791 Ga0466732_350791_921_2666 581
183 iso_pr_bacteria 2781125646 2781300612 581
184 3300002450 JGI24695J34938_10000042 JGI24695J34938_1000004218 582
185 3300024493 Ga0264413_137270 Ga0264413_13727010 582
186 3300042614 Ga0466712_192768 Ga0466712_192768_25256_27004 582
187 3300042617 Ga0466718_059207 Ga0466718_059207_1701_3449 582
188 3300042617 Ga0466718_140360 Ga0466718_140360_2266_4014 582
189 3300042619 Ga0466726_427845 Ga0466726_427845_147_1937 582
190 3300042656 Ga0466732_208042 Ga0466732_208042_2842_4590 582
191 3300002449 JGI24698J34947_10022868 JGI24698J34947_100228683 583
192 3300042618 Ga0466723_010297 Ga0466723_010297_74_1978 583
193 3300042648 Ga0466709_104383 Ga0466709_104383_19719_21470 583
194 3300000089 AustNasuHG_c1000153 AustNasuHG_10001537 584
195 3300024493 Ga0264413_115727 Ga0264413_11572722 584
196 3300042592 Ga0466693_276385 Ga0466693_276385_10429_12183 584
197 3300042618 Ga0466723_110051 Ga0466723_110051_4766_6556 584
198 3300002450 JGI24695J34938_10000043 JGI24695J34938_1000004326 585
199 3300002450 JGI24695J34938_10009471 JGI24695J34938_100094712 585
200 3300042605 Ga0466716_341416 Ga0466716_341416_21195_23015 585
201 iso_pr_bacteria 2781125650 2781308983 585
202 3300002450 JGI24695J34938_10001404 JGI24695J34938_100014043 586
203 3300010167 Ga0123353_10102117 Ga0123353_101021173 586
204 3300042617 Ga0466718_042663 Ga0466718_042663_167_1954 586
205 3300042622 Ga0466731_264621 Ga0466731_264621_947_2707 586
206 3300042648 Ga0466709_149889 Ga0466709_149889_3783_5597 586
207 3300042656 Ga0466732_116734 Ga0466732_116734_1709_3469 586
208 iso_pr_bacteria 2772190975 2773721706 586
209 iso_pr_bacteria 2781125647 2781302784 586
210 3300002450 JGI24695J34938_10000317 JGI24695J34938_1000031714 587
211 3300024493 Ga0264413_116464 Ga0264413_1164646 587
212 3300042655 Ga0466727_136602 Ga0466727_136602_2648_4507 587
213 3300042590 Ga0466690_095247 Ga0466690_095247_902_2668 588
214 3300042591 Ga0466692_157647 Ga0466692_157647_10364_12130 588
215 3300042656 Ga0466732_008750 Ga0466732_008750_1042_2808 588
216 3300002450 JGI24695J34938_10010792 JGI24695J34938_100107925 589
217 3300042593 Ga0466691_067093 Ga0466691_067093_25355_27124 589
218 3300042600 Ga0466700_015904 Ga0466700_015904_20_1789 589
219 3300042605 Ga0466716_407272 Ga0466716_407272_2216_3985 589
220 3300042609 Ga0466722_182069 Ga0466722_182069_393_2162 589
221 iso_pr_bacteria 2781125692 2781431175 589
222 3300005201 Ga0072941_1014433 Ga0072941_10144332 591
223 3300042593 Ga0466691_010897 Ga0466691_010897_9290_11065 591
224 3300042597 Ga0466699_325566 Ga0466699_325566_11210_12985 591
225 3300042617 Ga0466718_022803 Ga0466718_022803_1237_3012 591
226 3300000089 AustNasuHG_c1005483 AustNasuHG_10054832 592
227 3300042590 Ga0466690_005527 Ga0466690_005527_3936_5714 592
228 3300042614 Ga0466712_002425 Ga0466712_002425_577_2355 592
229 3300042614 Ga0466712_195148 Ga0466712_195148_12868_14646 592
230 3300042617 Ga0466718_092740 Ga0466718_092740_2964_4742 592
231 3300042635 Ga0466702_354071 Ga0466702_354071_2109_3887 592
232 iso_pr_bacteria 2781125644 2781295783 592
233 3300002450 JGI24695J34938_10000212 JGI24695J34938_1000021239 593
234 3300005201 Ga0072941_1005800 Ga0072941_100580023 593
235 3300005201 Ga0072941_1007444 Ga0072941_10074443 593
236 3300005201 Ga0072941_1119663 Ga0072941_11196632 593
237 3300042606 Ga0466719_534421 Ga0466719_534421_2019_3845 593
238 3300042643 Ga0466704_325031 Ga0466704_325031_645_2426 593
239 3300010167 Ga0123353_10386227 Ga0123353_103862271 594
240 3300042616 Ga0466715_419971 Ga0466715_419971_1055_2839 594
241 iso_pr_bacteria 650716099 650878763 594
242 3300002450 JGI24695J34938_10000009 JGI24695J34938_10000009123 595
243 3300042591 Ga0466692_013191 Ga0466692_013191_1848_3635 595
244 3300042606 Ga0466719_035069 Ga0466719_035069_507_2294 595
245 3300042614 Ga0466712_028589 Ga0466712_028589_125_1912 595
246 3300042616 Ga0466715_534731 Ga0466715_534731_606_2393 595
247 3300005201 Ga0072941_1038753 Ga0072941_10387535 597
248 3300042605 Ga0466716_224521 Ga0466716_224521_590_2383 597
249 3300042624 Ga0466735_042842 Ga0466735_042842_1513_3333 597
250 3300042615 Ga0466711_440263 Ga0466711_440263_655_2451 598
251 3300042636 Ga0466703_125329 Ga0466703_125329_22794_24590 598
252 3300042652 Ga0466708_021027 Ga0466708_021027_770_2566 598
253 3300042593 Ga0466691_203397 Ga0466691_203397_1773_3572 599
254 3300042606 Ga0466719_379308 Ga0466719_379308_13044_14843 599
255 3300042618 Ga0466723_247480 Ga0466723_247480_9139_10941 600
256 3300002462 JGI24702J35022_10004713 JGI24702J35022_100047138 601
257 3300042599 Ga0466706_217296 Ga0466706_217296_12220_14040 601
258 3300042616 Ga0466715_004131 Ga0466715_004131_976_2829 602
259 3300042609 Ga0466722_092688 Ga0466722_092688_5547_7361 604
260 3300042616 Ga0466715_058779 Ga0466715_058779_1959_3773 604
261 3300042609 Ga0466722_233946 Ga0466722_233946_8812_10629 605
262 3300005201 Ga0072941_1008587 Ga0072941_10085872 606
263 3300042636 Ga0466703_150682 Ga0466703_150682_34819_36639 606
264 3300042619 Ga0466726_227057 Ga0466726_227057_789_2615 608
265 3300042620 Ga0466728_370765 Ga0466728_370765_4580_6406 608
266 3300042606 Ga0466719_110192 Ga0466719_110192_4491_6320 609
267 3300042648 Ga0466709_016367 Ga0466709_016367_1309_3138 609
268 3300042612 Ga0466705_449620 Ga0466705_449620_668_2500 610
269 3300042643 Ga0466704_433507 Ga0466704_433507_23221_25053 610
270 3300042612 Ga0466705_024691 Ga0466705_024691_899_2761 613

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 345 490 0.94
PF12558 DUF3744 ATP-binding cassette cobalt transporter 238 304 0.91

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.