Protein Family IF07046

Metagenome Isolate
112 Members
33 Samples
107 Scaffolds
460.17 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_024148|Ga0466705_024148_4708_6321
Length
537 aa
Sequence
MRRFSLAACLVFFALGLLPLWGQTADSGEESAAGSPSAESGIFAPEGEGEPVAAGPAPITGVEAVIDSAEELAGELEQTIAPGETLWNYAGRMGIALGIIAVQALIIWVFWRHFFKFITRKTVGYFGERIKPLTIKKLRILSTKQIIGLIVFGIKIVKYIFTVFLLVFTIPVVFALFPGTRDLAVTLFGYIFNPFKNIVFGTIAYIPNLITIAVIIVVTRYVLRALKFFAIQIEREKLVIPGFYADWANPTFNILRVLLYAFTVAIIYPYLPGSDSRIFQGVSVLVGVIFSLGSSSAIGNLVAGLVITYMRPFKIGDRIKINDVTGFVVEKTLMVIRLKTHKNEYVTFPNLMILNSSVVNYHTSSDEDEEGLVLYATVTFGYGTPWQTVQEILINAALSTSHILKNPKPFVLQTALNDFYANYQVNCYSKEIDRVPRIYSELYQHIQEGFRAAGIDMTAPQFRINMPYEDPFPVKISSPRPRGRVVQKQAIPAQPVDSADSGAGLKDAAPEISAEPGPANTRKAPVRRRSKSTPPSP

📊 Sample Types

Isolate 4.5%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.6%
Termitidae 25.0%
Unclassified 18.8%
Termopsidae 9.4%
Rhinotermitidae 6.2%

🌳 Taxonomy

Archaea 0
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
22 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
32 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_077908 3300042612 Bacteria 11680
2 Ga0466705_232051 3300042612 Bacteria 14272
3 Ga0466692_152387 3300042591 Bacteria 29225
4 Ga0466694_187026 3300042594 Bacteria 18469
5 Ga0466696_027634 3300042596 Bacteria 23130
6 Ga0466696_342909 3300042596 Bacteria 12307
7 Ga0466715_077254 3300042616 Bacteria 24143
8 Ga0466718_134009 3300042617 Bacteria 4780
9 Ga0466723_010496 3300042618 Bacteria 9348
10 Ga0466728_090686 3300042620 Bacteria 6917
11 Ga0466716_197566 3300042605 Bacteria 4135
12 Ga0466720_026420 3300042607 Bacteria 22729
13 Ga0466703_057057 3300042636 Bacteria 18027
14 Ga0466703_239566 3300042636 Bacteria 29253
15 Ga0466704_160027 3300042643 Bacteria 29575
16 Ga0466704_493462 3300042643 Unclassified 1543
17 Ga0466708_034220 3300042652 Bacteria 21029
18 Ga0466708_105112 3300042652 Bacteria 2378
19 Ga0466705_100876 3300042612 Bacteria 24455
20 Ga0466705_140924 3300042612 Bacteria 10301
21 Ga0068302_10077748 3300005071 Bacteria 2650
22 Ga0466690_137839 3300042590 Bacteria 4093
23 Ga0466715_364611 3300042616 Bacteria 6005
24 Ga0466728_053260 3300042620 Bacteria 9497
25 Ga0466707_098000 3300042601 Bacteria 2280
26 Ga0466716_052896 3300042605 Bacteria 3022
27 Ga0466703_035757 3300042636 Bacteria 2334
28 Ga0466708_157489 3300042652 Bacteria 3376
29 Ga0466708_174298 3300042652 Bacteria 4857
30 Ga0466727_162803 3300042655 Bacteria 8707
31 Ga0466705_010388 3300042612 Bacteria 6412
32 Ga0466705_060007 3300042612 Bacteria 8177
33 Ga0466732_248977 3300042656 Bacteria 20366
34 Ga0466728_204507 3300042620 Bacteria 2960
35 Ga0466722_120548 3300042609 Bacteria 6323
36 Ga0123353_10075402 3300010167 Bacteria 5420
37 Ga0466705_024148 3300042612 Bacteria 8680
38 JGI24698J34947_10015487 3300002449 Bacteria 4149
39 JGI24695J34938_10000137 3300002450 Bacteria 66242
40 Ga0466718_122701 3300042617 Bacteria 9837
41 Ga0466728_033874 3300042620 Bacteria 17572
42 Ga0466728_080341 3300042620 Bacteria 4321
43 Ga0466728_120589 3300042620 Bacteria 4191
44 Ga0466716_069741 3300042605 Bacteria 8666
45 Ga0466716_204379 3300042605 Bacteria 3610
46 Ga0466703_100281 3300042636 Bacteria 6606
47 Ga0466704_264549 3300042643 Bacteria 13510
48 Ga0466704_428013 3300042643 Bacteria 23996
49 Ga0466708_015554 3300042652 Bacteria 30533
50 Ga0466727_318735 3300042655 Bacteria 3455
51 Ga0466705_061823 3300042612 Bacteria 3204
52 Ga0466705_340117 3300042612 Bacteria 13635
53 Ga0466694_043334 3300042594 Bacteria 6214
54 Ga0466696_210225 3300042596 Bacteria 27277
55 Ga0466711_383554 3300042615 Bacteria 20506
56 Ga0466715_015169 3300042616 Bacteria 13317
57 Ga0466723_055854 3300042618 Bacteria 8501
58 Ga0466723_163359 3300042618 Bacteria 4331
59 Ga0466703_136148 3300042636 Bacteria 13546
60 Ga0466703_204530 3300042636 Bacteria 2673
61 Ga0466703_333259 3300042636 Bacteria 21872
62 Ga0466708_160776 3300042652 Bacteria 7921
63 Ga0466690_359453 3300042590 Bacteria 3545
64 Ga0466696_013382 3300042596 Bacteria 35562
65 Ga0466711_465990 3300042615 Bacteria 11790
66 Ga0466715_054399 3300042616 Bacteria 7080
67 Ga0466715_612056 3300042616 Bacteria 3892
68 Ga0466723_218471 3300042618 Bacteria 5002
69 Ga0466728_020291 3300042620 Bacteria 11173
70 Ga0466716_458646 3300042605 Bacteria 28728
71 Ga0466719_472322 3300042606 Bacteria 1852
72 Ga0466722_158251 3300042609 Bacteria 2926
73 Ga0466703_231435 3300042636 Bacteria 27613
74 Ga0466704_088959 3300042643 Bacteria 8055
75 Ga0466704_134875 3300042643 Bacteria 11065
76 Ga0466705_284019 3300042612 Bacteria 3705
77 JGI24698J34947_10012514 3300002449 Bacteria 4649
78 Ga0466690_150462 3300042590 Bacteria 3957
79 Ga0466692_114466 3300042591 Bacteria 2016
80 Ga0466728_448237 3300042620 Bacteria 5956
81 Ga0466719_149063 3300042606 Bacteria 15996
82 Ga0466719_307289 3300042606 Bacteria 3494
83 Ga0466722_255003 3300042609 Bacteria 12062
84 Ga0466735_217604 3300042624 Bacteria 6456
85 Ga0466703_317506 3300042636 Bacteria 4950
86 Ga0466703_330124 3300042636 Bacteria 6556
87 Ga0466703_413621 3300042636 Bacteria 8368
88 Ga0466704_126982 3300042643 Bacteria 13499
89 Ga0466704_404880 3300042643 Bacteria 9656
90 Ga0466709_093376 3300042648 Bacteria 8279
91 Ga0466708_047578 3300042652 Bacteria 2785
92 Ga0466727_240936 3300042655 Bacteria 2156
93 Ga0466705_003041 3300042612 Bacteria 14560
94 JGI24695J34938_10003827 3300002450 Bacteria 10221
95 JGI24705J35276_12210089 3300002504 Bacteria 1815
96 Ga0264413_117243 3300024493 Bacteria 11479
97 Ga0466692_177158 3300042591 Bacteria 17341
98 Ga0466694_075570 3300042594 Bacteria 6141
99 Ga0466705_409626 3300042612 Bacteria 4773
100 Ga0466723_225559 3300042618 Bacteria 5093
101 Ga0466723_301396 3300042618 Bacteria 4055
102 Ga0466716_116894 3300042605 Bacteria 1731
103 Ga0466716_314219 3300042605 Bacteria 7681
104 Ga0466703_339673 3300042636 Bacteria 5130
105 Ga0466704_028522 3300042643 Bacteria 14017
106 Ga0466704_111914 3300042643 Bacteria 32572
107 Ga0466709_399285 3300042648 Bacteria 22927

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002450 JGI24695J34938_10003827 JGI24695J34938_100038276 430
2 3300005071 Ga0068302_10077748 Ga0068302_100777482 430
3 3300042617 Ga0466718_134009 Ga0466718_134009_3032_4405 430
4 3300042620 Ga0466728_090686 Ga0466728_090686_2187_3533 430
5 3300042591 Ga0466692_152387 Ga0466692_152387_816_2144 431
6 3300042636 Ga0466703_057057 Ga0466703_057057_15929_17392 431
7 3300042636 Ga0466703_339673 Ga0466703_339673_269_1708 431
8 3300042643 Ga0466704_134875 Ga0466704_134875_4499_5986 431
9 3300042609 Ga0466722_120548 Ga0466722_120548_1644_3038 432
10 3300042612 Ga0466705_232051 Ga0466705_232051_10376_11830 432
11 3300042620 Ga0466728_204507 Ga0466728_204507_447_1799 432
12 3300042643 Ga0466704_264549 Ga0466704_264549_7695_9191 432
13 3300042648 Ga0466709_399285 Ga0466709_399285_19233_20624 432
14 3300002449 JGI24698J34947_10012514 JGI24698J34947_100125142 433
15 3300042605 Ga0466716_116894 Ga0466716_116894_215_1516 433
16 3300042615 Ga0466711_465990 Ga0466711_465990_9464_10768 434
17 3300002449 JGI24698J34947_10015487 JGI24698J34947_100154872 435
18 3300042594 Ga0466694_043334 Ga0466694_043334_1993_3333 435
19 3300010167 Ga0123353_10075402 Ga0123353_100754024 436
20 3300042590 Ga0466690_150462 Ga0466690_150462_2616_3929 437
21 3300042591 Ga0466692_177158 Ga0466692_177158_14874_16298 437
22 3300042620 Ga0466728_020291 Ga0466728_020291_4446_5957 437
23 3300042606 Ga0466719_472322 Ga0466719_472322_408_1724 438
24 3300042624 Ga0466735_217604 Ga0466735_217604_3935_5515 438
25 3300042601 Ga0466707_098000 Ga0466707_098000_734_2098 439
26 3300042616 Ga0466715_077254 Ga0466715_077254_2330_3691 439
27 3300042636 Ga0466703_231435 Ga0466703_231435_11611_13011 440
28 3300042655 Ga0466727_162803 Ga0466727_162803_4676_6181 440
29 3300042612 Ga0466705_100876 Ga0466705_100876_3217_4614 441
30 3300042617 Ga0466718_122701 Ga0466718_122701_3415_4755 441
31 3300042618 Ga0466723_055854 Ga0466723_055854_2500_3885 441
32 3300042612 Ga0466705_340117 Ga0466705_340117_2072_3403 443
33 3300042643 Ga0466704_028522 Ga0466704_028522_4714_6045 443
34 3300042643 Ga0466704_404880 Ga0466704_404880_8271_9602 443
35 3300042596 Ga0466696_013382 Ga0466696_013382_28616_30103 444
36 3300042652 Ga0466708_047578 Ga0466708_047578_1206_2771 444
37 3300042605 Ga0466716_069741 Ga0466716_069741_2628_4097 445
38 3300042596 Ga0466696_210225 Ga0466696_210225_15652_17163 446
39 3300042609 Ga0466722_255003 Ga0466722_255003_8504_10018 446
40 3300042612 Ga0466705_077908 Ga0466705_077908_3116_4510 446
41 3300024493 Ga0264413_117243 Ga0264413_1172432 447
42 3300042594 Ga0466694_075570 Ga0466694_075570_1764_3107 447
43 3300042636 Ga0466703_239566 Ga0466703_239566_16334_17803 447
44 3300042618 Ga0466723_010496 Ga0466723_010496_462_1937 448
45 3300042636 Ga0466703_136148 Ga0466703_136148_6416_7903 449
46 3300042612 Ga0466705_061823 Ga0466705_061823_314_1744 450
47 3300042652 Ga0466708_157489 Ga0466708_157489_608_2146 451
48 iso_pr_bacteria 2781125693 2781432750 451
49 3300042607 Ga0466720_026420 Ga0466720_026420_5820_7301 452
50 3300042612 Ga0466705_140924 Ga0466705_140924_3945_5405 453
51 3300042594 Ga0466694_187026 Ga0466694_187026_9534_10901 455
52 3300042609 Ga0466722_158251 Ga0466722_158251_1377_2744 455
53 3300042652 Ga0466708_015554 Ga0466708_015554_15834_17444 455
54 3300042591 Ga0466692_114466 Ga0466692_114466_508_1974 456
55 3300042643 Ga0466704_111914 Ga0466704_111914_8564_10030 457
56 3300042605 Ga0466716_052896 Ga0466716_052896_397_1773 458
57 3300002504 JGI24705J35276_12210089 JGI24705J35276_122100891 462
58 iso_pr_bacteria 2781125651 2781309724 462
59 3300042612 Ga0466705_003041 Ga0466705_003041_5908_7416 463
60 3300042636 Ga0466703_413621 Ga0466703_413621_3782_5299 463
61 iso_pr_bacteria 2781125631 2781269301 463
62 3300042652 Ga0466708_034220 Ga0466708_034220_1307_2761 465
63 3300002450 JGI24695J34938_10000137 JGI24695J34938_1000013713 467
64 3300042605 Ga0466716_204379 Ga0466716_204379_341_1909 467
65 3300042616 Ga0466715_054399 Ga0466715_054399_3314_4816 467
66 3300042636 Ga0466703_035757 Ga0466703_035757_538_1941 467
67 3300042606 Ga0466719_149063 Ga0466719_149063_11233_12669 468
68 3300042612 Ga0466705_284019 Ga0466705_284019_286_1848 468
69 3300042616 Ga0466715_015169 Ga0466715_015169_5464_6984 468
70 3300042616 Ga0466715_364611 Ga0466715_364611_2094_3557 468
71 3300042652 Ga0466708_160776 Ga0466708_160776_4445_6004 468
72 iso_pr_bacteria 2781125689 2781424912 468
73 3300042618 Ga0466723_225559 Ga0466723_225559_2219_3658 469
74 3300042643 Ga0466704_160027 Ga0466704_160027_22959_24440 469
75 3300042590 Ga0466690_137839 Ga0466690_137839_1229_2641 470
76 3300042643 Ga0466704_428013 Ga0466704_428013_8058_9554 471
77 3300042636 Ga0466703_317506 Ga0466703_317506_2043_3608 472
78 3300042643 Ga0466704_493462 Ga0466704_493462_108_1529 473
79 3300042648 Ga0466709_093376 Ga0466709_093376_459_1880 473
80 3300042656 Ga0466732_248977 Ga0466732_248977_17473_18921 474
81 3300042596 Ga0466696_027634 Ga0466696_027634_21279_22763 475
82 3300042612 Ga0466705_409626 Ga0466705_409626_3161_4588 475
83 iso_pr_bacteria 2820020240 2820020779 476
84 3300042618 Ga0466723_163359 Ga0466723_163359_521_1996 477
85 3300042618 Ga0466723_218471 Ga0466723_218471_1688_3256 479
86 3300042618 Ga0466723_301396 Ga0466723_301396_1889_3373 479
87 3300042636 Ga0466703_330124 Ga0466703_330124_2931_4427 479
88 3300042616 Ga0466715_612056 Ga0466715_612056_1044_2489 481
89 3300042590 Ga0466690_359453 Ga0466690_359453_1519_3000 482
90 3300042605 Ga0466716_458646 Ga0466716_458646_26003_27502 482
91 3300042636 Ga0466703_100281 Ga0466703_100281_4206_5759 482
92 3300042652 Ga0466708_105112 Ga0466708_105112_536_2038 482
93 3300042620 Ga0466728_120589 Ga0466728_120589_2537_4171 483
94 3300042652 Ga0466708_174298 Ga0466708_174298_2046_3527 483
95 3300042655 Ga0466727_240936 Ga0466727_240936_460_1968 483
96 3300042655 Ga0466727_318735 Ga0466727_318735_180_1631 483
97 3300042636 Ga0466703_333259 Ga0466703_333259_6495_8030 486
98 3300042606 Ga0466719_307289 Ga0466719_307289_640_2265 487
99 3300042636 Ga0466703_204530 Ga0466703_204530_582_2105 487
100 3300042605 Ga0466716_314219 Ga0466716_314219_2116_3582 488
101 3300042620 Ga0466728_080341 Ga0466728_080341_2138_3607 489
102 3300042605 Ga0466716_197566 Ga0466716_197566_177_1697 490
103 3300042615 Ga0466711_383554 Ga0466711_383554_13634_15187 491
104 3300042612 Ga0466705_010388 Ga0466705_010388_4217_5695 492
105 3300042612 Ga0466705_060007 Ga0466705_060007_517_1995 492
106 3300042620 Ga0466728_033874 Ga0466728_033874_15637_17286 492
107 3300042620 Ga0466728_053260 Ga0466728_053260_4938_6647 492
108 3300042620 Ga0466728_448237 Ga0466728_448237_2128_3753 495
109 3300042596 Ga0466696_342909 Ga0466696_342909_5164_6684 497
110 3300042643 Ga0466704_126982 Ga0466704_126982_4269_5768 499
111 3300042643 Ga0466704_088959 Ga0466704_088959_4392_5924 510
112 3300042612 Ga0466705_024148 Ga0466705_024148_4708_6321 537

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF21082 MS_channel_3rd Mechanosensitive ion channel MscS, C-terminal 377 457 0.98
PF00924 MS_channel_2nd Mechanosensitive ion channel, beta-domain 298 362 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.39 0.56 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.