Protein Family IF07041

Metagenome Isolate
102 Members
32 Samples
99 Scaffolds
614.04 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_018354|Ga0466705_018354_878_2893
Length
663 aa
Sequence
MVNSLDWAKMTIPAKLNIVGIVWYTCGEFSIEDLRKKVVRVSGSHIVDDSGRTLLLRGCNLGGGSKIPSIPXXXXLSGRPSEVSFAGRPFPLEEAEEHVGNLKRSGFGLVRLVITWEALEHSGPGIYDEAYLAYLRKLLLEAEKKDLRVIMDPHQDAWSRWTGGDGAPAWTLERLGFDLERLDAVGAAVTMERYAENHGGRAYPDMIWPVNYSLYGASTLFTLFFAGNAYAPGLTIEGESAQDWLQERYMACFRHCYRRLKNCKAIIGWEAMNEPHPGFIGCGDLNRTENRVVALGAVPSPWEAMAAASGKPVRAPVYIPWLKAPIKTGRALINPQGLSLFRPGFSCPWKVAGVWAGEGEDMRLLKKDHFALYQGRPARFNEDFLKPFMIRFFDRMREAGRPALFFVQGFPHGDPPSWSAAEGADVAHAFHCYDGPALFTKTFRPWITADEKTGRIILGRKNTAAFYSLRLKKMREWTRDKMGDMPCLLGEFGLPFDLNHRRACREKDPSKEDYRLHEEALSLYYDGIDENLLHAAIWNYTPGNTREEGDGWNGEDLSIYSGGKGRAMGGWLRPYPMATAGVPLFVRWDRRRAFFRYRFLADPAIEAPTEIYAPPEWLGPRPLLTVSEGLRGEYKEEERRIFVYNRGFEGEAEISAAPGAEEA

📊 Sample Types

Isolate 2.9%
Metagenome 97.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 45.2%
Termitidae 22.6%
Rhinotermitidae 9.7%
Termopsidae 9.7%
Unclassified 9.7%
Blaberidae 3.2%

🌳 Taxonomy

Archaea 0
Bacteria 100
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
2 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
3 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
17 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 2772190975 Treponema sp. RmG30 Isolate Blaberidae
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
29 650716102 Treponema primitia ZAS-2 Isolate Unclassified
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_102298 3300042601 Bacteria 8981
2 Ga0466719_253447 3300042606 Bacteria 4787
3 Ga0466690_180157 3300042590 Bacteria 5143
4 Ga0466691_058682 3300042593 Bacteria 20237
5 Ga0466691_218029 3300042593 Bacteria 2278
6 Ga0466694_098051 3300042594 Bacteria 2900
7 Ga0466696_083152 3300042596 Bacteria 12112
8 Ga0466703_140054 3300042636 Bacteria 14116
9 Ga0466704_075784 3300042643 Bacteria 14543
10 Ga0466704_099679 3300042643 Bacteria 21380
11 Ga0466709_177802 3300042648 Bacteria 13165
12 Ga0466727_219398 3300042655 Bacteria 3268
13 Ga0466705_390490 3300042612 Bacteria 10345
14 Ga0466715_097689 3300042616 Bacteria 10316
15 Ga0466715_211874 3300042616 Bacteria 8631
16 Ga0466723_207065 3300042618 Bacteria 8470
17 Ga0466705_018354 3300042612 Bacteria 3192
18 Ga0456237_0004236 3300041968 Bacteria 2308
19 Ga0456237_0004309 3300041968 Bacteria 2291
20 Ga0466690_178367 3300042590 Bacteria 11010
21 Ga0466691_143751 3300042593 Bacteria 3368
22 Ga0466708_372461 3300042652 Bacteria 2374
23 Ga0466705_470076 3300042612 Bacteria 13798
24 Ga0466723_246723 3300042618 Bacteria 18930
25 Ga0123357_10027284 3300009784 Bacteria 7717
26 Ga0123357_10056446 3300009784 Bacteria 5281
27 Ga0123353_10119423 3300010167 Bacteria 4240
28 Ga0466705_110584 3300042612 Bacteria 16648
29 Ga0466716_266025 3300042605 Bacteria 13871
30 Ga0466719_304178 3300042606 Bacteria 4909
31 Ga0466719_304455 3300042606 Bacteria 13742
32 Ga0415639_002007 3300038395 Bacteria 2554
33 Ga0466735_081516 3300042624 Bacteria 2763
34 Ga0466703_045567 3300042636 Bacteria 7609
35 Ga0466703_223272 3300042636 Bacteria 9193
36 Ga0466711_051829 3300042615 Bacteria 36835
37 Ga0466728_070857 3300042620 Bacteria 7125
38 Ga0466716_232778 3300042605 Bacteria 6036
39 Ga0466719_374938 3300042606 Bacteria 5233
40 Ga0466692_069432 3300042591 Unclassified 2961
41 Ga0466691_027630 3300042593 Bacteria 8459
42 Ga0466696_014251 3300042596 Bacteria 20610
43 Ga0466703_020542 3300042636 Bacteria 11111
44 Ga0466708_009540 3300042652 Bacteria 24875
45 Ga0466711_384782 3300042615 Bacteria 24719
46 Ga0466715_017954 3300042616 Bacteria 6763
47 Ga0072941_1011693 3300005201 Bacteria 17691
48 Ga0466722_110914 3300042609 Bacteria 2536
49 Ga0466690_153744 3300042590 Bacteria 2210
50 Ga0466690_414879 3300042590 Bacteria 4604
51 Ga0466691_000965 3300042593 Bacteria 5152
52 Ga0466694_247086 3300042594 Bacteria 13485
53 Ga0466709_203661 3300042648 Bacteria 13991
54 Ga0466708_166006 3300042652 Bacteria 9987
55 Ga0466705_448849 3300042612 Bacteria 4685
56 Ga0466711_109991 3300042615 Bacteria 6783
57 Ga0466723_063907 3300042618 Bacteria 13522
58 Ga0466723_097574 3300042618 Bacteria 6304
59 Ga0466723_260262 3300042618 Bacteria 3773
60 Ga0466723_268309 3300042618 Bacteria 19008
61 Ga0123353_10264459 3300010167 Bacteria 2654
62 Ga0466716_068911 3300042605 Bacteria 9608
63 Ga0466716_531175 3300042605 Bacteria 8586
64 Ga0466696_026596 3300042596 Bacteria 4998
65 Ga0466704_057454 3300042643 Bacteria 3716
66 Ga0466709_253311 3300042648 Bacteria 26545
67 Ga0466709_276271 3300042648 Bacteria 18152
68 Ga0466708_058470 3300042652 Bacteria 25784
69 Ga0466708_211329 3300042652 Bacteria 8406
70 Ga0466708_340529 3300042652 Bacteria 19441
71 Ga0466708_408364 3300042652 Bacteria 2054
72 Ga0466723_034676 3300042618 Bacteria 12042
73 Ga0466723_167081 3300042618 Bacteria 9309
74 Ga0466707_084962 3300042601 Bacteria 3158
75 Ga0466719_137690 3300042606 Bacteria 11186
76 Ga0466690_248419 3300042590 Bacteria 4547
77 Ga0466695_351978 3300042595 Bacteria 4749
78 Ga0466735_004662 3300042624 Bacteria 7046
79 Ga0466711_299825 3300042615 Bacteria 33971
80 Ga0466715_222242 3300042616 Bacteria 16254
81 Ga0466723_225852 3300042618 Bacteria 63792
82 Ga0466728_071487 3300042620 Bacteria 17488
83 Ga0123353_10027951 3300010167 Bacteria 8654
84 Ga0123354_10139780 3300010882 Bacteria 3003
85 Ga0466705_187456 3300042612 Unclassified 4758
86 Ga0466705_341176 3300042612 Bacteria 9923
87 Ga0466733_222460 3300042659 Bacteria 1944
88 Ga0466716_131232 3300042605 Bacteria 7467
89 Ga0466716_150573 3300042605 Bacteria 10096
90 Ga0466691_064683 3300042593 Bacteria 17448
91 Ga0466694_149074 3300042594 Bacteria 12615
92 Ga0466703_326844 3300042636 Bacteria 8617
93 Ga0466704_107222 3300042643 Bacteria 19502
94 Ga0466704_606958 3300042643 Bacteria 82552
95 Ga0466711_085379 3300042615 Bacteria 2090
96 Ga0466715_010139 3300042616 Bacteria 16775
97 Ga0466715_045338 3300042616 Bacteria 3243
98 Ga0466726_332717 3300042619 Bacteria 8555
99 Ga0123357_10146385 3300009784 Bacteria 2884

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_211874 Ga0466715_211874_159_1778 539
2 3300042616 Ga0466715_097689 Ga0466715_097689_5502_7160 542
3 3300042612 Ga0466705_470076 Ga0466705_470076_11139_12812 547
4 3300042590 Ga0466690_414879 Ga0466690_414879_1122_2867 568
5 3300042636 Ga0466703_045567 Ga0466703_045567_4307_6025 572
6 3300042616 Ga0466715_010139 Ga0466715_010139_12132_13877 573
7 3300042643 Ga0466704_075784 Ga0466704_075784_10870_12624 576
8 3300042648 Ga0466709_177802 Ga0466709_177802_1181_2911 576
9 3300042593 Ga0466691_027630 Ga0466691_027630_3148_4941 577
10 3300042593 Ga0466691_064683 Ga0466691_064683_2867_4603 578
11 3300042612 Ga0466705_390490 Ga0466705_390490_899_2650 583
12 3300042618 Ga0466723_246723 Ga0466723_246723_11519_13312 583
13 3300042636 Ga0466703_140054 Ga0466703_140054_12173_13966 583
14 3300042643 Ga0466704_107222 Ga0466704_107222_15623_17416 583
15 3300042616 Ga0466715_045338 Ga0466715_045338_565_2364 584
16 3300042636 Ga0466703_020542 Ga0466703_020542_6465_8219 584
17 3300042606 Ga0466719_304178 Ga0466719_304178_166_1959 587
18 3300042615 Ga0466711_109991 Ga0466711_109991_3493_5256 587
19 3300041968 Ga0456237_0004236 Ga0456237_0004236_304_2070 588
20 3300042590 Ga0466690_180157 Ga0466690_180157_607_2424 589
21 3300042596 Ga0466696_014251 Ga0466696_014251_7147_8916 589
22 3300042596 Ga0466696_083152 Ga0466696_083152_8459_10228 589
23 3300042606 Ga0466719_253447 Ga0466719_253447_1931_3766 590
24 3300042593 Ga0466691_000965 Ga0466691_000965_2472_4280 602
25 3300042594 Ga0466694_149074 Ga0466694_149074_4050_5861 603
26 3300042618 Ga0466723_063907 Ga0466723_063907_2270_4126 605
27 3300042615 Ga0466711_299825 Ga0466711_299825_26103_27929 608
28 3300042636 Ga0466703_223272 Ga0466703_223272_4011_5837 608
29 3300042643 Ga0466704_606958 Ga0466704_606958_59860_61686 608
30 3300042620 Ga0466728_070857 Ga0466728_070857_5250_7082 610
31 3300042590 Ga0466690_178367 Ga0466690_178367_1230_3065 611
32 3300042655 Ga0466727_219398 Ga0466727_219398_260_2095 611
33 3300042593 Ga0466691_143751 Ga0466691_143751_78_1916 612
34 3300042605 Ga0466716_131232 Ga0466716_131232_1460_3301 613
35 3300042616 Ga0466715_222242 Ga0466715_222242_2543_4384 613
36 3300042652 Ga0466708_408364 Ga0466708_408364_200_2041 613
37 3300042596 Ga0466696_026596 Ga0466696_026596_1693_3537 614
38 3300042605 Ga0466716_531175 Ga0466716_531175_5890_7734 614
39 3300042618 Ga0466723_167081 Ga0466723_167081_5436_7280 614
40 3300042652 Ga0466708_340529 Ga0466708_340529_9100_10944 614
41 3300010167 Ga0123353_10264459 Ga0123353_102644592 615
42 3300038395 Ga0415639_002007 Ga0415639_002007_651_2498 615
43 3300042618 Ga0466723_225852 Ga0466723_225852_5450_7330 615
44 3300042636 Ga0466703_326844 Ga0466703_326844_932_2800 615
45 3300042601 Ga0466707_084962 Ga0466707_084962_203_2089 616
46 3300042606 Ga0466719_137690 Ga0466719_137690_146_2017 616
47 3300042612 Ga0466705_341176 Ga0466705_341176_1052_2923 616
48 3300005201 Ga0072941_1011693 Ga0072941_101169310 617
49 3300041968 Ga0456237_0004309 Ga0456237_0004309_180_2033 617
50 3300042612 Ga0466705_187456 Ga0466705_187456_2382_4256 617
51 3300042648 Ga0466709_276271 Ga0466709_276271_2906_4759 617
52 3300042652 Ga0466708_009540 Ga0466708_009540_15560_17437 618
53 3300042652 Ga0466708_372461 Ga0466708_372461_343_2229 618
54 3300042595 Ga0466695_351978 Ga0466695_351978_2297_4156 619
55 3300042615 Ga0466711_384782 Ga0466711_384782_2191_4053 620
56 3300042618 Ga0466723_034676 Ga0466723_034676_7601_9463 620
57 3300042593 Ga0466691_058682 Ga0466691_058682_15647_17512 621
58 3300042643 Ga0466704_099679 Ga0466704_099679_19268_21133 621
59 iso_pr_bacteria 650716099 650880222 621
60 3300010882 Ga0123354_10139780 Ga0123354_101397804 622
61 3300042601 Ga0466707_102298 Ga0466707_102298_4406_6274 622
62 3300042615 Ga0466711_085379 Ga0466711_085379_88_1956 622
63 3300042616 Ga0466715_017954 Ga0466715_017954_1712_3601 622
64 3300042652 Ga0466708_058470 Ga0466708_058470_18522_20390 622
65 3300042605 Ga0466716_150573 Ga0466716_150573_2032_3903 623
66 3300042612 Ga0466705_110584 Ga0466705_110584_4664_6535 623
67 3300042618 Ga0466723_268309 Ga0466723_268309_13003_14874 623
68 3300042619 Ga0466726_332717 Ga0466726_332717_3833_5710 625
69 3300042594 Ga0466694_247086 Ga0466694_247086_6747_8651 626
70 3300042615 Ga0466711_051829 Ga0466711_051829_616_2529 626
71 3300042593 Ga0466691_218029 Ga0466691_218029_58_1944 628
72 3300042605 Ga0466716_068911 Ga0466716_068911_724_2610 628
73 3300042618 Ga0466723_207065 Ga0466723_207065_4883_6796 628
74 iso_pr_bacteria 650716102 650884132 628
75 3300009784 Ga0123357_10027284 Ga0123357_100272842 629
76 3300010167 Ga0123353_10027951 Ga0123353_100279516 629
77 iso_pr_bacteria 2772190975 2773724565 629
78 3300042620 Ga0466728_071487 Ga0466728_071487_3031_4923 630
79 3300042591 Ga0466692_069432 Ga0466692_069432_25_1956 631
80 3300042606 Ga0466719_374938 Ga0466719_374938_1432_3327 631
81 3300042652 Ga0466708_166006 Ga0466708_166006_5262_7157 631
82 3300009784 Ga0123357_10056446 Ga0123357_100564464 632
83 3300042659 Ga0466733_222460 Ga0466733_222460_20_1918 632
84 3300042605 Ga0466716_266025 Ga0466716_266025_5503_7404 633
85 3300042609 Ga0466722_110914 Ga0466722_110914_507_2429 633
86 3300042590 Ga0466690_248419 Ga0466690_248419_1547_3451 634
87 3300042605 Ga0466716_232778 Ga0466716_232778_534_2441 635
88 3300042618 Ga0466723_097574 Ga0466723_097574_3708_5615 635
89 3300042618 Ga0466723_260262 Ga0466723_260262_1271_3181 636
90 3300042606 Ga0466719_304455 Ga0466719_304455_8998_10911 637
91 3300042612 Ga0466705_448849 Ga0466705_448849_2225_4138 637
92 3300009784 Ga0123357_10146385 Ga0123357_101463851 639
93 3300042590 Ga0466690_153744 Ga0466690_153744_64_1983 639
94 3300042624 Ga0466735_081516 Ga0466735_081516_338_2269 643
95 3300042648 Ga0466709_203661 Ga0466709_203661_1041_2972 643
96 3300042648 Ga0466709_253311 Ga0466709_253311_16219_18150 643
97 3300042652 Ga0466708_211329 Ga0466708_211329_131_2062 643
98 3300042624 Ga0466735_004662 Ga0466735_004662_3263_5203 646
99 3300010167 Ga0123353_10119423 Ga0123353_101194233 653
100 3300042594 Ga0466694_098051 Ga0466694_098051_18_2021 656
101 3300042612 Ga0466705_018354 Ga0466705_018354_878_2893 663
102 3300042643 Ga0466704_057454 Ga0466704_057454_1092_3131 668

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 96 161 0.84
PF18564 Glyco_hydro_5_C Glycoside hydrolase family 5 C-terminal domain 573 651 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.