Protein Family IF07002

Metagenome Isolate
194 Members
65 Samples
174 Scaffolds
352.84 Avg Length

🧬 Representative Sequence

ID
3300042611|Ga0466697_131549|Ga0466697_131549_137_1279
Length
380 aa
Sequence
MMMIKPIINIISSIAAEPWWRVFYDFSSLTQAIDEGLRNLMPPFWAVAIELVIVGILFLTFYGVIGLVLVYIERKVCAFIQNRLGPNRIGPYGIFQTVADLVKLLFKELIPIKDSDKFLFNLAPYIIITINFMIVGALPFAKGLHAIDLNIGVFYIFAISSLNVVGVLLAGWASNSKYSLIGAMRSGAMMVSYELSLGLALITMIILAGSMQLSEIIEVQRGGWLIFRGHIPAFVAFIIYLISGTAETNRGPFDLAEAESELTAGYHTEYSGMKFAFFYLSEYINMFIVASIAAIIFLGGWMPLHIGSWDGFNRIMDWIPPIVWYFGKTFFVIYLIMMFKWTFPRLRIDQLLTLEWKYLLPINLINVLIMAFIVLMGWHF

πŸ“Š Sample Types

Isolate 10.3%
Metagenome 89.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 22.2%
Kalotermitidae 22.2%
Blattidae 19.0%
Unclassified 15.9%
Termopsidae 6.3%
Rhinotermitidae 4.8%
Passalidae 4.8%
Hodotermitidae 1.6%
Hydrophilidae 1.6%
Tenebrionidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
2 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
14 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
15 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
16 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
21 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
28 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
29 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
30 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
31 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
40 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
43 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
44 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
45 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
46 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
47 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
48 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
54 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
55 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
56 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
57 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
58 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
59 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
62 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
63 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
64 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_301679 3300042612 Bacteria 30952
2 Ga0466707_411730 3300042601 Unclassified 1979
3 Ga0466713_003852 3300042602 Bacteria 1350
4 Ga0466722_098074 3300042609 Bacteria 7514
5 Ga0466722_131066 3300042609 Bacteria 10030
6 Ga0466698_364147 3300042610 Bacteria 1929
7 Ga0466690_294371 3300042590 Bacteria 12872
8 Ga0466692_119983 3300042591 Bacteria 3225
9 Ga0466701_014507 3300042598 Bacteria 3171
10 Ga0466715_104403 3300042616 Bacteria 11916
11 Ga0466715_456601 3300042616 Bacteria 5089
12 Ga0466703_148416 3300042636 Bacteria 2204
13 Ga0466703_175050 3300042636 Bacteria 4825
14 Ga0466704_293428 3300042643 Bacteria 4205
15 Ga0466709_245110 3300042648 Bacteria 22256
16 Ga0466708_290083 3300042652 Bacteria 3901
17 Ga0466733_006535 3300042659 Bacteria 7369
18 Ga0562377_0004 3300056842 Bacteria 3525959
19 Ga0466707_358506 3300042601 Bacteria 2198
20 Ga0466713_130991 3300042602 Bacteria 214088
21 Ga0466714_010843 3300042603 Bacteria 1267
22 Ga0466714_061841 3300042603 Bacteria 10327
23 Ga0466714_150199 3300042603 Bacteria 149649
24 Ga0466719_280712 3300042606 Unclassified 3118
25 Ga0466698_072502 3300042610 Bacteria 1285
26 Ga0466690_149899 3300042590 Bacteria 20818
27 Ga0466691_023853 3300042593 Bacteria 11971
28 Ga0123357_10015964 3300009784 Bacteria 9862
29 Ga0123356_10431720 3300010049 Bacteria 1462
30 2227065531 2225789003 Unclassified 3379
31 Ga0123357_10001945 3300009784 Bacteria 22544
32 Ga0466711_172329 3300042615 Bacteria 9572
33 Ga0466715_240109 3300042616 Bacteria 17583
34 Ga0466726_098008 3300042619 Bacteria 12087
35 Ga0466726_101376 3300042619 Bacteria 1477
36 Ga0466729_069107 3300042621 Bacteria 4160
37 Ga0466731_137472 3300042622 Bacteria 1479
38 Ga0466703_203837 3300042636 Bacteria 13462
39 Ga0466704_186597 3300042643 Bacteria 3823
40 Ga0466709_410544 3300042648 Unclassified 4433
41 Ga0466709_414483 3300042648 Bacteria 24643
42 Ga0466697_131549 3300042611 Bacteria 1676
43 Ga0466705_335658 3300042612 Bacteria 24109
44 Ga0466705_350955 3300042612 Bacteria 6058
45 Ga0466732_005715 3300042656 Bacteria 91596
46 Ga0466733_054986 3300042659 Bacteria 147644
47 Ga0466733_086622 3300042659 Bacteria 4394
48 Ga0466706_132256 3300042599 Bacteria 31081
49 Ga0466707_068270 3300042601 Bacteria 10493
50 Ga0466707_115094 3300042601 Bacteria 2117
51 Ga0466713_027728 3300042602 Bacteria 12610
52 Ga0466713_103961 3300042602 Bacteria 6433
53 Ga0466719_221389 3300042606 Bacteria 6422
54 Ga0466690_005110 3300042590 Bacteria 14539
55 Ga0466692_192614 3300042591 Bacteria 3161
56 Ga0466696_261686 3300042596 Bacteria 3964
57 2227591289 2225789004 Bacteria 12992
58 IMNBL1DRAFT_c0001921 3300000062 Bacteria 15041
59 Ga0072941_1402549 3300005201 Bacteria 1308
60 Ga0466715_023105 3300042616 Bacteria 7276
61 Ga0466715_063088 3300042616 Unclassified 7672
62 Ga0466715_403844 3300042616 Bacteria 18417
63 Ga0466723_094954 3300042618 Bacteria 8294
64 Ga0466735_100070 3300042624 Bacteria 6650
65 Ga0466704_572231 3300042643 Bacteria 2184
66 Ga0466708_049839 3300042652 Bacteria 17940
67 Ga0466725_210063 3300042654 Bacteria 11666
68 Ga0466727_035085 3300042655 Unclassified 1184
69 Ga0466727_104023 3300042655 Bacteria 4393
70 Ga0466697_101391 3300042611 Bacteria 1453
71 Ga0466733_203605 3300042659 Bacteria 93930
72 Ga0466701_098080 3300042598 Bacteria 65896
73 Ga0466707_062128 3300042601 Bacteria 19135
74 Ga0466707_299100 3300042601 Bacteria 1380
75 Ga0466722_070620 3300042609 Bacteria 4907
76 Ga0466690_101280 3300042590 Bacteria 4655
77 Ga0466692_102850 3300042591 Bacteria 14012
78 Ga0466693_063245 3300042592 Bacteria 3291
79 Ga0466696_175794 3300042596 Bacteria 2186
80 IMNBL1DRAFT_c0008088 3300000062 Bacteria 5411
81 IMNBL1DRAFT_c0033748 3300000062 Bacteria 1829
82 Ga0068305_10037095 3300005083 Bacteria 5251
83 Ga0466728_021718 3300042620 Bacteria 3405
84 Ga0466731_010142 3300042622 Bacteria 2040
85 Ga0466703_140271 3300042636 Bacteria 55996
86 Ga0466704_142594 3300042643 Bacteria 6642
87 Ga0466704_251741 3300042643 Bacteria 19766
88 Ga0466705_032844 3300042612 Bacteria 18355
89 Ga0466706_109799 3300042599 Bacteria 205088
90 Ga0466707_191673 3300042601 Bacteria 8925
91 Ga0466716_442880 3300042605 Bacteria 8188
92 Ga0466719_028262 3300042606 Bacteria 7946
93 Ga0265387_1003798 3300024582 Bacteria 2076
94 Ga0466696_305629 3300042596 Bacteria 12685
95 Ga0123357_10400818 3300009784 Bacteria 1249
96 Ga0123356_10544455 3300010049 Unclassified 1321
97 Ga0123353_10073829 3300010167 Bacteria 5483
98 Ga0466715_021583 3300042616 Unclassified 4112
99 Ga0466715_285909 3300042616 Bacteria 8932
100 Ga0466723_014215 3300042618 Bacteria 13889
101 Ga0466726_161990 3300042619 Bacteria 1322
102 Ga0466735_101884 3300042624 Bacteria 3918
103 Ga0466709_231759 3300042648 Bacteria 5441
104 Ga0466725_124439 3300042654 Bacteria 1350
105 Ga0466697_159345 3300042611 Bacteria 1542
106 Ga0466705_061319 3300042612 Bacteria 5992
107 Ga0466705_156124 3300042612 Bacteria 9397
108 Ga0466732_114982 3300042656 Bacteria 2404
109 Ga0466707_242775 3300042601 Bacteria 11468
110 Ga0466713_123016 3300042602 Bacteria 2509
111 Ga0466714_091668 3300042603 Bacteria 24422
112 Ga0466716_539568 3300042605 Bacteria 9234
113 Ga0466719_012506 3300042606 Bacteria 11641
114 Ga0466719_547111 3300042606 Bacteria 8384
115 Ga0466722_230937 3300042609 Bacteria 5155
116 Ga0466692_183944 3300042591 Bacteria 13311
117 Ga0466691_151363 3300042593 Bacteria 11991
118 Ga0466696_208928 3300042596 Unclassified 1645
119 Ga0123356_10331477 3300010049 Bacteria 1639
120 Ga0123353_10777884 3300010167 Bacteria 1326
121 IMNBL1DRAFT_c0001104 3300000062 Bacteria 20698
122 Ga0068302_10253998 3300005071 Bacteria 3233
123 Ga0466711_112728 3300042615 Bacteria 2006
124 Ga0466711_288114 3300042615 Bacteria 3449
125 Ga0466735_012272 3300042624 Bacteria 13363
126 Ga0466735_178283 3300042624 Bacteria 4947
127 Ga0466735_198081 3300042624 Unclassified 3180
128 Ga0466735_231342 3300042624 Bacteria 4048
129 Ga0466704_096642 3300042643 Bacteria 11632
130 Ga0466704_193235 3300042643 Bacteria 11221
131 Ga0466705_051958 3300042612 Bacteria 7798
132 Ga0466705_073835 3300042612 Bacteria 13642
133 Ga0466733_029228 3300042659 Bacteria 8355
134 Ga0466733_175419 3300042659 Bacteria 32803
135 Ga0466713_037944 3300042602 Bacteria 60611
136 Ga0466713_135454 3300042602 Bacteria 2447
137 Ga0466714_011714 3300042603 Bacteria 47582
138 Ga0466714_051125 3300042603 Bacteria 52861
139 Ga0466716_035678 3300042605 Bacteria 3569
140 Ga0466716_067660 3300042605 Bacteria 6394
141 Ga0466716_371367 3300042605 Bacteria 12791
142 Ga0466722_113613 3300042609 Bacteria 129604
143 Ga0466657_005889 3300042582 Bacteria 2059
144 Ga0466723_087959 3300042618 Bacteria 5565
145 Ga0466723_092051 3300042618 Bacteria 16294
146 Ga0466735_081564 3300042624 Bacteria 3812
147 Ga0466730_038219 3300042625 Bacteria 3031
148 Ga0466704_082750 3300042643 Bacteria 26962
149 Ga0466704_575107 3300042643 Bacteria 3761
150 Ga0466733_130577 3300042659 Bacteria 17591
151 Ga0466733_180918 3300042659 Bacteria 6230
152 Ga0466707_127336 3300042601 Bacteria 4598
153 Ga0466707_327841 3300042601 Bacteria 9241
154 Ga0466713_010310 3300042602 Bacteria 41924
155 Ga0466719_104508 3300042606 Bacteria 2465
156 Ga0466719_319955 3300042606 Bacteria 5163
157 Ga0466690_003078 3300042590 Bacteria 25930
158 Ga0466690_130397 3300042590 Unclassified 4188
159 Ga0466691_006239 3300042593 Bacteria 10188
160 Ga0466696_026812 3300042596 Bacteria 27611
161 Ga0123356_10015974 3300010049 Bacteria 7177
162 2227644078 2225789004 Bacteria 2041
163 IMNBL1DRAFT_c0001469 3300000062 Bacteria 17624
164 IMNBL1DRAFT_c0048563 3300000062 Unclassified 1360
165 Ga0068305_10252352 3300005083 Bacteria 2159
166 Ga0466715_008476 3300042616 Bacteria 2420
167 Ga0466726_160354 3300042619 Bacteria 5014
168 Ga0466726_214054 3300042619 Bacteria 1745
169 Ga0466726_280553 3300042619 Bacteria 8250
170 Ga0466729_096704 3300042621 Bacteria 15068
171 Ga0466735_110297 3300042624 Bacteria 8315
172 Ga0466703_305494 3300042636 Bacteria 3038
173 Ga0466704_602482 3300042643 Bacteria 52119
174 Ga0466727_000612 3300042655 Bacteria 11085

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_049839 Ga0466708_049839_10723_11640 305
2 3300042603 Ga0466714_061841 Ga0466714_061841_2867_3859 317
3 3300042596 Ga0466696_208928 Ga0466696_208928_35_997 320
4 3300042602 Ga0466713_010310 Ga0466713_010310_22469_23431 320
5 3300042612 Ga0466705_032844 Ga0466705_032844_6717_7679 320
6 3300042612 Ga0466705_335658 Ga0466705_335658_19485_20447 320
7 3300042616 Ga0466715_021583 Ga0466715_021583_3096_4058 320
8 3300042602 Ga0466713_003852 Ga0466713_003852_357_1322 321
9 3300042601 Ga0466707_299100 Ga0466707_299100_324_1304 326
10 3300042655 Ga0466727_035085 Ga0466727_035085_176_1156 326
11 3300042619 Ga0466726_280553 Ga0466726_280553_599_1594 331
12 3300042591 Ga0466692_183944 Ga0466692_183944_4739_5806 335
13 3300042603 Ga0466714_091668 Ga0466714_091668_23084_24091 335
14 3300042606 Ga0466719_547111 Ga0466719_547111_6891_7898 335
15 3300042612 Ga0466705_301679 Ga0466705_301679_18298_19305 335
16 3300042590 Ga0466690_003078 Ga0466690_003078_7618_8688 336
17 3300042593 Ga0466691_151363 Ga0466691_151363_2167_3234 336
18 3300042612 Ga0466705_156124 Ga0466705_156124_69_1079 336
19 3300042622 Ga0466731_137472 Ga0466731_137472_308_1318 336
20 3300042643 Ga0466704_251741 Ga0466704_251741_16634_17644 336
21 3300042618 Ga0466723_014215 Ga0466723_014215_1504_2571 337
22 3300042619 Ga0466726_214054 Ga0466726_214054_345_1412 337
23 3300042624 Ga0466735_231342 Ga0466735_231342_1155_2168 337
24 3300042636 Ga0466703_148416 Ga0466703_148416_603_1652 338
25 3300042609 Ga0466722_113613 Ga0466722_113613_99231_100250 339
26 3300042596 Ga0466696_026812 Ga0466696_026812_15308_16330 340
27 3300042603 Ga0466714_011714 Ga0466714_011714_40142_41164 340
28 3300042612 Ga0466705_073835 Ga0466705_073835_4913_5935 340
29 3300042615 Ga0466711_172329 Ga0466711_172329_7542_8564 340
30 3300042619 Ga0466726_098008 Ga0466726_098008_4752_5774 340
31 3300042636 Ga0466703_203837 Ga0466703_203837_5291_6313 340
32 3300042643 Ga0466704_096642 Ga0466704_096642_2674_3696 340
33 3300042643 Ga0466704_602482 Ga0466704_602482_4498_5520 340
34 3300042655 Ga0466727_000612 Ga0466727_000612_4110_5132 340
35 3300005201 Ga0072941_1402549 Ga0072941_14025491 341
36 3300042612 Ga0466705_051958 Ga0466705_051958_968_2011 341
37 3300042643 Ga0466704_142594 Ga0466704_142594_1295_2320 341
38 3300009784 Ga0123357_10001945 Ga0123357_100019453 342
39 3300042593 Ga0466691_006239 Ga0466691_006239_7385_8416 343
40 3300042606 Ga0466719_028262 Ga0466719_028262_687_1718 343
41 3300042643 Ga0466704_082750 Ga0466704_082750_4732_5781 343
42 2225789004 2227644078 2228235320 344
43 3300005083 Ga0068305_10252352 Ga0068305_102523521 344
44 3300042606 Ga0466719_319955 Ga0466719_319955_3737_4804 346
45 3300042616 Ga0466715_063088 Ga0466715_063088_3465_4505 346
46 3300042605 Ga0466716_067660 Ga0466716_067660_5296_6339 347
47 3300042606 Ga0466719_280712 Ga0466719_280712_2022_3065 347
48 3300042616 Ga0466715_403844 Ga0466715_403844_664_1740 347
49 3300042648 Ga0466709_410544 Ga0466709_410544_3303_4346 347
50 3300010167 Ga0123353_10073829 Ga0123353_100738295 348
51 3300042590 Ga0466690_101280 Ga0466690_101280_3537_4583 348
52 3300042590 Ga0466690_130397 Ga0466690_130397_292_1338 348
53 3300042590 Ga0466690_149899 Ga0466690_149899_5410_6474 348
54 3300042601 Ga0466707_127336 Ga0466707_127336_2481_3581 348
55 3300042616 Ga0466715_285909 Ga0466715_285909_3952_5052 348
56 iso_pr_bacteria 2910959314 2910959459 348
57 3300042596 Ga0466696_175794 Ga0466696_175794_635_1684 349
58 3300042599 Ga0466706_132256 Ga0466706_132256_11206_12291 349
59 3300042605 Ga0466716_539568 Ga0466716_539568_3600_4670 349
60 3300042618 Ga0466723_087959 Ga0466723_087959_647_1696 349
61 3300009784 Ga0123357_10400818 Ga0123357_104008182 350
62 3300042615 Ga0466711_288114 Ga0466711_288114_956_2032 350
63 3300042654 Ga0466725_124439 Ga0466725_124439_227_1279 350
64 3300010049 Ga0123356_10431720 Ga0123356_104317202 351
65 3300042612 Ga0466705_061319 Ga0466705_061319_1785_2855 351
66 2225789004 2227591289 2228150868 353
67 3300010167 Ga0123353_10777884 Ga0123353_107778841 353
68 3300042591 Ga0466692_119983 Ga0466692_119983_2035_3096 353
69 3300042591 Ga0466692_192614 Ga0466692_192614_1248_2309 353
70 3300042598 Ga0466701_098080 Ga0466701_098080_48763_49824 353
71 3300042609 Ga0466722_098074 Ga0466722_098074_477_1538 353
72 3300042610 Ga0466698_072502 Ga0466698_072502_61_1122 353
73 3300042611 Ga0466697_159345 Ga0466697_159345_70_1131 353
74 3300042616 Ga0466715_104403 Ga0466715_104403_10814_11875 353
75 3300042621 Ga0466729_096704 Ga0466729_096704_7586_8647 353
76 3300042636 Ga0466703_305494 Ga0466703_305494_1064_2125 353
77 3300042643 Ga0466704_193235 Ga0466704_193235_3462_4523 353
78 iso_pr_bacteria 2820778767 2820780869 353
79 3300000062 IMNBL1DRAFT_c0001921 IMNBL1DRAFT_000192113 354
80 3300009784 Ga0123357_10015964 Ga0123357_100159642 354
81 3300024582 Ga0265387_1003798 Ga0265387_10037981 354
82 3300042591 Ga0466692_102850 Ga0466692_102850_11591_12655 354
83 3300042592 Ga0466693_063245 Ga0466693_063245_152_1216 354
84 3300042593 Ga0466691_023853 Ga0466691_023853_7270_8334 354
85 3300042601 Ga0466707_191673 Ga0466707_191673_7552_8616 354
86 3300042601 Ga0466707_327841 Ga0466707_327841_3759_4823 354
87 3300042606 Ga0466719_104508 Ga0466719_104508_588_1652 354
88 3300042609 Ga0466722_131066 Ga0466722_131066_8638_9702 354
89 3300042615 Ga0466711_112728 Ga0466711_112728_838_1902 354
90 3300042620 Ga0466728_021718 Ga0466728_021718_2297_3361 354
91 3300042621 Ga0466729_069107 Ga0466729_069107_3007_4071 354
92 3300042624 Ga0466735_081564 Ga0466735_081564_82_1146 354
93 3300042624 Ga0466735_101884 Ga0466735_101884_1272_2336 354
94 3300042624 Ga0466735_178283 Ga0466735_178283_3253_4317 354
95 3300042636 Ga0466703_175050 Ga0466703_175050_3749_4813 354
96 3300042648 Ga0466709_414483 Ga0466709_414483_18331_19395 354
97 3300042659 Ga0466733_175419 Ga0466733_175419_364_1428 354
98 3300042659 Ga0466733_180918 Ga0466733_180918_1371_2435 354
99 3300000062 IMNBL1DRAFT_c0008088 IMNBL1DRAFT_00080885 355
100 3300000062 IMNBL1DRAFT_c0033748 IMNBL1DRAFT_00337482 355
101 3300010049 Ga0123356_10015974 Ga0123356_100159742 355
102 3300042590 Ga0466690_005110 Ga0466690_005110_3588_4655 355
103 3300042596 Ga0466696_305629 Ga0466696_305629_98_1165 355
104 3300042598 Ga0466701_014507 Ga0466701_014507_510_1577 355
105 3300042601 Ga0466707_062128 Ga0466707_062128_17662_18729 355
106 3300042601 Ga0466707_115094 Ga0466707_115094_303_1370 355
107 3300042601 Ga0466707_411730 Ga0466707_411730_708_1775 355
108 3300042602 Ga0466713_123016 Ga0466713_123016_500_1621 355
109 3300042603 Ga0466714_010843 Ga0466714_010843_157_1224 355
110 3300042605 Ga0466716_371367 Ga0466716_371367_471_1538 355
111 3300042609 Ga0466722_230937 Ga0466722_230937_2342_3409 355
112 3300042610 Ga0466698_364147 Ga0466698_364147_209_1276 355
113 3300042618 Ga0466723_094954 Ga0466723_094954_1651_2718 355
114 3300042619 Ga0466726_160354 Ga0466726_160354_455_1522 355
115 3300042619 Ga0466726_161990 Ga0466726_161990_180_1247 355
116 3300042624 Ga0466735_100070 Ga0466735_100070_2926_3993 355
117 3300042624 Ga0466735_110297 Ga0466735_110297_859_1926 355
118 3300042643 Ga0466704_293428 Ga0466704_293428_2883_3950 355
119 3300042648 Ga0466709_231759 Ga0466709_231759_759_1826 355
120 3300042648 Ga0466709_245110 Ga0466709_245110_19664_20731 355
121 3300042652 Ga0466708_290083 Ga0466708_290083_139_1206 355
122 3300042655 Ga0466727_104023 Ga0466727_104023_3128_4195 355
123 3300042659 Ga0466733_130577 Ga0466733_130577_10809_11876 355
124 iso_pr_bacteria 2940216256 2940217634 355
125 3300042590 Ga0466690_294371 Ga0466690_294371_7572_8642 356
126 3300042596 Ga0466696_261686 Ga0466696_261686_632_1702 356
127 3300042601 Ga0466707_242775 Ga0466707_242775_1240_2310 356
128 3300042601 Ga0466707_358506 Ga0466707_358506_214_1284 356
129 3300042602 Ga0466713_027728 Ga0466713_027728_10977_12047 356
130 3300042611 Ga0466697_101391 Ga0466697_101391_154_1224 356
131 3300042616 Ga0466715_240109 Ga0466715_240109_11688_12758 356
132 3300042616 Ga0466715_456601 Ga0466715_456601_3821_4891 356
133 3300042622 Ga0466731_010142 Ga0466731_010142_956_2026 356
134 3300042636 Ga0466703_140271 Ga0466703_140271_12380_13450 356
135 3300000062 IMNBL1DRAFT_c0001104 IMNBL1DRAFT_000110413 357
136 3300042624 Ga0466735_012272 Ga0466735_012272_1113_2186 357
137 iso_pr_bacteria 2820762746 2820763180 357
138 3300042599 Ga0466706_109799 Ga0466706_109799_188942_190018 358
139 3300042602 Ga0466713_037944 Ga0466713_037944_20351_21427 358
140 3300042602 Ga0466713_135454 Ga0466713_135454_153_1229 358
141 3300042603 Ga0466714_051125 Ga0466714_051125_15178_16254 358
142 3300042603 Ga0466714_150199 Ga0466714_150199_33063_34139 358
143 3300042605 Ga0466716_035678 Ga0466716_035678_861_1937 358
144 3300042606 Ga0466719_012506 Ga0466719_012506_7611_8687 358
145 3300042616 Ga0466715_023105 Ga0466715_023105_5382_6458 358
146 3300042618 Ga0466723_092051 Ga0466723_092051_6564_7640 358
147 3300042643 Ga0466704_186597 Ga0466704_186597_2532_3608 358
148 3300042654 Ga0466725_210063 Ga0466725_210063_7761_8837 358
149 3300005071 Ga0068302_10253998 Ga0068302_102539982 359
150 3300005083 Ga0068305_10037095 Ga0068305_100370955 359
151 iso_pr_bacteria 2820789850 2820791663 359
152 3300010049 Ga0123356_10544455 Ga0123356_105444552 360
153 3300056842 Ga0562377_0004 Ga0562377_0004_3336744_3337826 360
154 3300042656 Ga0466732_005715 Ga0466732_005715_68475_69560 361
155 iso_pr_bacteria 2820776227 2820777191 364
156 iso_pr_bacteria 2910949487 2910951831 364
157 3300042606 Ga0466719_221389 Ga0466719_221389_1535_2632 365
158 3300042582 Ga0466657_005889 Ga0466657_005889_702_1802 366
159 3300042609 Ga0466722_070620 Ga0466722_070620_2742_3842 366
160 3300042656 Ga0466732_114982 Ga0466732_114982_626_1726 366
161 3300010049 Ga0123356_10331477 Ga0123356_103314772 367
162 iso_pr_bacteria 2940193328 2940195433 367
163 iso_pr_bacteria 2940336608 2940338707 367
164 3300042601 Ga0466707_068270 Ga0466707_068270_6181_7287 368
165 3300042602 Ga0466713_130991 Ga0466713_130991_190018_191124 368
166 3300042605 Ga0466716_442880 Ga0466716_442880_5967_7073 368
167 3300042643 Ga0466704_572231 Ga0466704_572231_1016_2122 368
168 3300042659 Ga0466733_029228 Ga0466733_029228_5067_6173 368
169 iso_pr_bacteria 2910930387 2910930862 368
170 iso_pr_bacteria 2910942425 2910945727 368
171 iso_pr_bacteria 2940244548 2940248364 368
172 iso_pr_bacteria 2940248789 2940252549 368
173 iso_pr_bacteria 2940253009 2940256761 368
174 iso_pr_bacteria 2940257232 2940260907 368
175 2225789003 2227065531 2227422511 369
176 3300042616 Ga0466715_008476 Ga0466715_008476_1141_2250 369
177 3300042624 Ga0466735_198081 Ga0466735_198081_235_1344 369
178 3300042625 Ga0466730_038219 Ga0466730_038219_692_1801 369
179 3300042659 Ga0466733_054986 Ga0466733_054986_81837_82946 369
180 3300000062 IMNBL1DRAFT_c0001469 IMNBL1DRAFT_00014695 370
181 3300000062 IMNBL1DRAFT_c0048563 IMNBL1DRAFT_00485632 370
182 3300042619 Ga0466726_101376 Ga0466726_101376_59_1171 370
183 iso_pr_bacteria 2910926975 2910927141 371
184 iso_pr_bacteria 2695420931 2698111066 372
185 3300042602 Ga0466713_103961 Ga0466713_103961_4403_5524 373
186 3300042643 Ga0466704_575107 Ga0466704_575107_2493_3614 373
187 3300042659 Ga0466733_086622 Ga0466733_086622_80_1201 373
188 iso_pr_bacteria 2695420314 2695472615 373
189 iso_pr_bacteria 2695420317 2695483569 373
190 iso_pr_bacteria 2873610414 2873612143 373
191 3300042659 Ga0466733_203605 Ga0466733_203605_65230_66354 374
192 3300042612 Ga0466705_350955 Ga0466705_350955_1351_2481 376
193 3300042659 Ga0466733_006535 Ga0466733_006535_2247_3383 378
194 3300042611 Ga0466697_131549 Ga0466697_131549_137_1279 380

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00146 NADHdh NADH dehydrogenase 56 371 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00146 GO:0016020 membrane CC

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.