Protein Family IF07002
Metagenome
Isolate
194
Members
65
Samples
174
Scaffolds
352.84
Avg Length
Representative Sequence
- ID
- 3300042611|Ga0466697_131549|Ga0466697_131549_137_1279
- Length
- 380 aa
- Sequence
- MMMIKPIINIISSIAAEPWWRVFYDFSSLTQAIDEGLRNLMPPFWAVAIELVIVGILFLTFYGVIGLVLVYIERKVCAFIQNRLGPNRIGPYGIFQTVADLVKLLFKELIPIKDSDKFLFNLAPYIIITINFMIVGALPFAKGLHAIDLNIGVFYIFAISSLNVVGVLLAGWASNSKYSLIGAMRSGAMMVSYELSLGLALITMIILAGSMQLSEIIEVQRGGWLIFRGHIPAFVAFIIYLISGTAETNRGPFDLAEAESELTAGYHTEYSGMKFAFFYLSEYINMFIVASIAAIIFLGGWMPLHIGSWDGFNRIMDWIPPIVWYFGKTFFVIYLIMMFKWTFPRLRIDQLLTLEWKYLLPINLINVLIMAFIVLMGWHF
Sample Types
Isolate
10.3%
Metagenome
89.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
22.2%
Kalotermitidae
22.2%
Blattidae
19.0%
Unclassified
15.9%
Termopsidae
6.3%
Rhinotermitidae
4.8%
Passalidae
4.8%
Hodotermitidae
1.6%
Hydrophilidae
1.6%
Tenebrionidae
1.6%
Taxonomy
Archaea
0
Bacteria
182
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 14 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 15 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 21 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 28 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 29 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 40 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 43 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 44 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 45 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 46 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 47 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 48 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 54 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 55 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 56 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 57 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 58 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 59 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 60 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 61 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 62 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 63 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 64 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 65 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_301679 | 3300042612 | Bacteria | 30952 |
| 2 | Ga0466707_411730 | 3300042601 | Unclassified | 1979 |
| 3 | Ga0466713_003852 | 3300042602 | Bacteria | 1350 |
| 4 | Ga0466722_098074 | 3300042609 | Bacteria | 7514 |
| 5 | Ga0466722_131066 | 3300042609 | Bacteria | 10030 |
| 6 | Ga0466698_364147 | 3300042610 | Bacteria | 1929 |
| 7 | Ga0466690_294371 | 3300042590 | Bacteria | 12872 |
| 8 | Ga0466692_119983 | 3300042591 | Bacteria | 3225 |
| 9 | Ga0466701_014507 | 3300042598 | Bacteria | 3171 |
| 10 | Ga0466715_104403 | 3300042616 | Bacteria | 11916 |
| 11 | Ga0466715_456601 | 3300042616 | Bacteria | 5089 |
| 12 | Ga0466703_148416 | 3300042636 | Bacteria | 2204 |
| 13 | Ga0466703_175050 | 3300042636 | Bacteria | 4825 |
| 14 | Ga0466704_293428 | 3300042643 | Bacteria | 4205 |
| 15 | Ga0466709_245110 | 3300042648 | Bacteria | 22256 |
| 16 | Ga0466708_290083 | 3300042652 | Bacteria | 3901 |
| 17 | Ga0466733_006535 | 3300042659 | Bacteria | 7369 |
| 18 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 19 | Ga0466707_358506 | 3300042601 | Bacteria | 2198 |
| 20 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 21 | Ga0466714_010843 | 3300042603 | Bacteria | 1267 |
| 22 | Ga0466714_061841 | 3300042603 | Bacteria | 10327 |
| 23 | Ga0466714_150199 | 3300042603 | Bacteria | 149649 |
| 24 | Ga0466719_280712 | 3300042606 | Unclassified | 3118 |
| 25 | Ga0466698_072502 | 3300042610 | Bacteria | 1285 |
| 26 | Ga0466690_149899 | 3300042590 | Bacteria | 20818 |
| 27 | Ga0466691_023853 | 3300042593 | Bacteria | 11971 |
| 28 | Ga0123357_10015964 | 3300009784 | Bacteria | 9862 |
| 29 | Ga0123356_10431720 | 3300010049 | Bacteria | 1462 |
| 30 | 2227065531 | 2225789003 | Unclassified | 3379 |
| 31 | Ga0123357_10001945 | 3300009784 | Bacteria | 22544 |
| 32 | Ga0466711_172329 | 3300042615 | Bacteria | 9572 |
| 33 | Ga0466715_240109 | 3300042616 | Bacteria | 17583 |
| 34 | Ga0466726_098008 | 3300042619 | Bacteria | 12087 |
| 35 | Ga0466726_101376 | 3300042619 | Bacteria | 1477 |
| 36 | Ga0466729_069107 | 3300042621 | Bacteria | 4160 |
| 37 | Ga0466731_137472 | 3300042622 | Bacteria | 1479 |
| 38 | Ga0466703_203837 | 3300042636 | Bacteria | 13462 |
| 39 | Ga0466704_186597 | 3300042643 | Bacteria | 3823 |
| 40 | Ga0466709_410544 | 3300042648 | Unclassified | 4433 |
| 41 | Ga0466709_414483 | 3300042648 | Bacteria | 24643 |
| 42 | Ga0466697_131549 | 3300042611 | Bacteria | 1676 |
| 43 | Ga0466705_335658 | 3300042612 | Bacteria | 24109 |
| 44 | Ga0466705_350955 | 3300042612 | Bacteria | 6058 |
| 45 | Ga0466732_005715 | 3300042656 | Bacteria | 91596 |
| 46 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 47 | Ga0466733_086622 | 3300042659 | Bacteria | 4394 |
| 48 | Ga0466706_132256 | 3300042599 | Bacteria | 31081 |
| 49 | Ga0466707_068270 | 3300042601 | Bacteria | 10493 |
| 50 | Ga0466707_115094 | 3300042601 | Bacteria | 2117 |
| 51 | Ga0466713_027728 | 3300042602 | Bacteria | 12610 |
| 52 | Ga0466713_103961 | 3300042602 | Bacteria | 6433 |
| 53 | Ga0466719_221389 | 3300042606 | Bacteria | 6422 |
| 54 | Ga0466690_005110 | 3300042590 | Bacteria | 14539 |
| 55 | Ga0466692_192614 | 3300042591 | Bacteria | 3161 |
| 56 | Ga0466696_261686 | 3300042596 | Bacteria | 3964 |
| 57 | 2227591289 | 2225789004 | Bacteria | 12992 |
| 58 | IMNBL1DRAFT_c0001921 | 3300000062 | Bacteria | 15041 |
| 59 | Ga0072941_1402549 | 3300005201 | Bacteria | 1308 |
| 60 | Ga0466715_023105 | 3300042616 | Bacteria | 7276 |
| 61 | Ga0466715_063088 | 3300042616 | Unclassified | 7672 |
| 62 | Ga0466715_403844 | 3300042616 | Bacteria | 18417 |
| 63 | Ga0466723_094954 | 3300042618 | Bacteria | 8294 |
| 64 | Ga0466735_100070 | 3300042624 | Bacteria | 6650 |
| 65 | Ga0466704_572231 | 3300042643 | Bacteria | 2184 |
| 66 | Ga0466708_049839 | 3300042652 | Bacteria | 17940 |
| 67 | Ga0466725_210063 | 3300042654 | Bacteria | 11666 |
| 68 | Ga0466727_035085 | 3300042655 | Unclassified | 1184 |
| 69 | Ga0466727_104023 | 3300042655 | Bacteria | 4393 |
| 70 | Ga0466697_101391 | 3300042611 | Bacteria | 1453 |
| 71 | Ga0466733_203605 | 3300042659 | Bacteria | 93930 |
| 72 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 73 | Ga0466707_062128 | 3300042601 | Bacteria | 19135 |
| 74 | Ga0466707_299100 | 3300042601 | Bacteria | 1380 |
| 75 | Ga0466722_070620 | 3300042609 | Bacteria | 4907 |
| 76 | Ga0466690_101280 | 3300042590 | Bacteria | 4655 |
| 77 | Ga0466692_102850 | 3300042591 | Bacteria | 14012 |
| 78 | Ga0466693_063245 | 3300042592 | Bacteria | 3291 |
| 79 | Ga0466696_175794 | 3300042596 | Bacteria | 2186 |
| 80 | IMNBL1DRAFT_c0008088 | 3300000062 | Bacteria | 5411 |
| 81 | IMNBL1DRAFT_c0033748 | 3300000062 | Bacteria | 1829 |
| 82 | Ga0068305_10037095 | 3300005083 | Bacteria | 5251 |
| 83 | Ga0466728_021718 | 3300042620 | Bacteria | 3405 |
| 84 | Ga0466731_010142 | 3300042622 | Bacteria | 2040 |
| 85 | Ga0466703_140271 | 3300042636 | Bacteria | 55996 |
| 86 | Ga0466704_142594 | 3300042643 | Bacteria | 6642 |
| 87 | Ga0466704_251741 | 3300042643 | Bacteria | 19766 |
| 88 | Ga0466705_032844 | 3300042612 | Bacteria | 18355 |
| 89 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 90 | Ga0466707_191673 | 3300042601 | Bacteria | 8925 |
| 91 | Ga0466716_442880 | 3300042605 | Bacteria | 8188 |
| 92 | Ga0466719_028262 | 3300042606 | Bacteria | 7946 |
| 93 | Ga0265387_1003798 | 3300024582 | Bacteria | 2076 |
| 94 | Ga0466696_305629 | 3300042596 | Bacteria | 12685 |
| 95 | Ga0123357_10400818 | 3300009784 | Bacteria | 1249 |
| 96 | Ga0123356_10544455 | 3300010049 | Unclassified | 1321 |
| 97 | Ga0123353_10073829 | 3300010167 | Bacteria | 5483 |
| 98 | Ga0466715_021583 | 3300042616 | Unclassified | 4112 |
| 99 | Ga0466715_285909 | 3300042616 | Bacteria | 8932 |
| 100 | Ga0466723_014215 | 3300042618 | Bacteria | 13889 |
| 101 | Ga0466726_161990 | 3300042619 | Bacteria | 1322 |
| 102 | Ga0466735_101884 | 3300042624 | Bacteria | 3918 |
| 103 | Ga0466709_231759 | 3300042648 | Bacteria | 5441 |
| 104 | Ga0466725_124439 | 3300042654 | Bacteria | 1350 |
| 105 | Ga0466697_159345 | 3300042611 | Bacteria | 1542 |
| 106 | Ga0466705_061319 | 3300042612 | Bacteria | 5992 |
| 107 | Ga0466705_156124 | 3300042612 | Bacteria | 9397 |
| 108 | Ga0466732_114982 | 3300042656 | Bacteria | 2404 |
| 109 | Ga0466707_242775 | 3300042601 | Bacteria | 11468 |
| 110 | Ga0466713_123016 | 3300042602 | Bacteria | 2509 |
| 111 | Ga0466714_091668 | 3300042603 | Bacteria | 24422 |
| 112 | Ga0466716_539568 | 3300042605 | Bacteria | 9234 |
| 113 | Ga0466719_012506 | 3300042606 | Bacteria | 11641 |
| 114 | Ga0466719_547111 | 3300042606 | Bacteria | 8384 |
| 115 | Ga0466722_230937 | 3300042609 | Bacteria | 5155 |
| 116 | Ga0466692_183944 | 3300042591 | Bacteria | 13311 |
| 117 | Ga0466691_151363 | 3300042593 | Bacteria | 11991 |
| 118 | Ga0466696_208928 | 3300042596 | Unclassified | 1645 |
| 119 | Ga0123356_10331477 | 3300010049 | Bacteria | 1639 |
| 120 | Ga0123353_10777884 | 3300010167 | Bacteria | 1326 |
| 121 | IMNBL1DRAFT_c0001104 | 3300000062 | Bacteria | 20698 |
| 122 | Ga0068302_10253998 | 3300005071 | Bacteria | 3233 |
| 123 | Ga0466711_112728 | 3300042615 | Bacteria | 2006 |
| 124 | Ga0466711_288114 | 3300042615 | Bacteria | 3449 |
| 125 | Ga0466735_012272 | 3300042624 | Bacteria | 13363 |
| 126 | Ga0466735_178283 | 3300042624 | Bacteria | 4947 |
| 127 | Ga0466735_198081 | 3300042624 | Unclassified | 3180 |
| 128 | Ga0466735_231342 | 3300042624 | Bacteria | 4048 |
| 129 | Ga0466704_096642 | 3300042643 | Bacteria | 11632 |
| 130 | Ga0466704_193235 | 3300042643 | Bacteria | 11221 |
| 131 | Ga0466705_051958 | 3300042612 | Bacteria | 7798 |
| 132 | Ga0466705_073835 | 3300042612 | Bacteria | 13642 |
| 133 | Ga0466733_029228 | 3300042659 | Bacteria | 8355 |
| 134 | Ga0466733_175419 | 3300042659 | Bacteria | 32803 |
| 135 | Ga0466713_037944 | 3300042602 | Bacteria | 60611 |
| 136 | Ga0466713_135454 | 3300042602 | Bacteria | 2447 |
| 137 | Ga0466714_011714 | 3300042603 | Bacteria | 47582 |
| 138 | Ga0466714_051125 | 3300042603 | Bacteria | 52861 |
| 139 | Ga0466716_035678 | 3300042605 | Bacteria | 3569 |
| 140 | Ga0466716_067660 | 3300042605 | Bacteria | 6394 |
| 141 | Ga0466716_371367 | 3300042605 | Bacteria | 12791 |
| 142 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 143 | Ga0466657_005889 | 3300042582 | Bacteria | 2059 |
| 144 | Ga0466723_087959 | 3300042618 | Bacteria | 5565 |
| 145 | Ga0466723_092051 | 3300042618 | Bacteria | 16294 |
| 146 | Ga0466735_081564 | 3300042624 | Bacteria | 3812 |
| 147 | Ga0466730_038219 | 3300042625 | Bacteria | 3031 |
| 148 | Ga0466704_082750 | 3300042643 | Bacteria | 26962 |
| 149 | Ga0466704_575107 | 3300042643 | Bacteria | 3761 |
| 150 | Ga0466733_130577 | 3300042659 | Bacteria | 17591 |
| 151 | Ga0466733_180918 | 3300042659 | Bacteria | 6230 |
| 152 | Ga0466707_127336 | 3300042601 | Bacteria | 4598 |
| 153 | Ga0466707_327841 | 3300042601 | Bacteria | 9241 |
| 154 | Ga0466713_010310 | 3300042602 | Bacteria | 41924 |
| 155 | Ga0466719_104508 | 3300042606 | Bacteria | 2465 |
| 156 | Ga0466719_319955 | 3300042606 | Bacteria | 5163 |
| 157 | Ga0466690_003078 | 3300042590 | Bacteria | 25930 |
| 158 | Ga0466690_130397 | 3300042590 | Unclassified | 4188 |
| 159 | Ga0466691_006239 | 3300042593 | Bacteria | 10188 |
| 160 | Ga0466696_026812 | 3300042596 | Bacteria | 27611 |
| 161 | Ga0123356_10015974 | 3300010049 | Bacteria | 7177 |
| 162 | 2227644078 | 2225789004 | Bacteria | 2041 |
| 163 | IMNBL1DRAFT_c0001469 | 3300000062 | Bacteria | 17624 |
| 164 | IMNBL1DRAFT_c0048563 | 3300000062 | Unclassified | 1360 |
| 165 | Ga0068305_10252352 | 3300005083 | Bacteria | 2159 |
| 166 | Ga0466715_008476 | 3300042616 | Bacteria | 2420 |
| 167 | Ga0466726_160354 | 3300042619 | Bacteria | 5014 |
| 168 | Ga0466726_214054 | 3300042619 | Bacteria | 1745 |
| 169 | Ga0466726_280553 | 3300042619 | Bacteria | 8250 |
| 170 | Ga0466729_096704 | 3300042621 | Bacteria | 15068 |
| 171 | Ga0466735_110297 | 3300042624 | Bacteria | 8315 |
| 172 | Ga0466703_305494 | 3300042636 | Bacteria | 3038 |
| 173 | Ga0466704_602482 | 3300042643 | Bacteria | 52119 |
| 174 | Ga0466727_000612 | 3300042655 | Bacteria | 11085 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042652 | Ga0466708_049839 | Ga0466708_049839_10723_11640 | 305 |
| 2 | 3300042603 | Ga0466714_061841 | Ga0466714_061841_2867_3859 | 317 |
| 3 | 3300042596 | Ga0466696_208928 | Ga0466696_208928_35_997 | 320 |
| 4 | 3300042602 | Ga0466713_010310 | Ga0466713_010310_22469_23431 | 320 |
| 5 | 3300042612 | Ga0466705_032844 | Ga0466705_032844_6717_7679 | 320 |
| 6 | 3300042612 | Ga0466705_335658 | Ga0466705_335658_19485_20447 | 320 |
| 7 | 3300042616 | Ga0466715_021583 | Ga0466715_021583_3096_4058 | 320 |
| 8 | 3300042602 | Ga0466713_003852 | Ga0466713_003852_357_1322 | 321 |
| 9 | 3300042601 | Ga0466707_299100 | Ga0466707_299100_324_1304 | 326 |
| 10 | 3300042655 | Ga0466727_035085 | Ga0466727_035085_176_1156 | 326 |
| 11 | 3300042619 | Ga0466726_280553 | Ga0466726_280553_599_1594 | 331 |
| 12 | 3300042591 | Ga0466692_183944 | Ga0466692_183944_4739_5806 | 335 |
| 13 | 3300042603 | Ga0466714_091668 | Ga0466714_091668_23084_24091 | 335 |
| 14 | 3300042606 | Ga0466719_547111 | Ga0466719_547111_6891_7898 | 335 |
| 15 | 3300042612 | Ga0466705_301679 | Ga0466705_301679_18298_19305 | 335 |
| 16 | 3300042590 | Ga0466690_003078 | Ga0466690_003078_7618_8688 | 336 |
| 17 | 3300042593 | Ga0466691_151363 | Ga0466691_151363_2167_3234 | 336 |
| 18 | 3300042612 | Ga0466705_156124 | Ga0466705_156124_69_1079 | 336 |
| 19 | 3300042622 | Ga0466731_137472 | Ga0466731_137472_308_1318 | 336 |
| 20 | 3300042643 | Ga0466704_251741 | Ga0466704_251741_16634_17644 | 336 |
| 21 | 3300042618 | Ga0466723_014215 | Ga0466723_014215_1504_2571 | 337 |
| 22 | 3300042619 | Ga0466726_214054 | Ga0466726_214054_345_1412 | 337 |
| 23 | 3300042624 | Ga0466735_231342 | Ga0466735_231342_1155_2168 | 337 |
| 24 | 3300042636 | Ga0466703_148416 | Ga0466703_148416_603_1652 | 338 |
| 25 | 3300042609 | Ga0466722_113613 | Ga0466722_113613_99231_100250 | 339 |
| 26 | 3300042596 | Ga0466696_026812 | Ga0466696_026812_15308_16330 | 340 |
| 27 | 3300042603 | Ga0466714_011714 | Ga0466714_011714_40142_41164 | 340 |
| 28 | 3300042612 | Ga0466705_073835 | Ga0466705_073835_4913_5935 | 340 |
| 29 | 3300042615 | Ga0466711_172329 | Ga0466711_172329_7542_8564 | 340 |
| 30 | 3300042619 | Ga0466726_098008 | Ga0466726_098008_4752_5774 | 340 |
| 31 | 3300042636 | Ga0466703_203837 | Ga0466703_203837_5291_6313 | 340 |
| 32 | 3300042643 | Ga0466704_096642 | Ga0466704_096642_2674_3696 | 340 |
| 33 | 3300042643 | Ga0466704_602482 | Ga0466704_602482_4498_5520 | 340 |
| 34 | 3300042655 | Ga0466727_000612 | Ga0466727_000612_4110_5132 | 340 |
| 35 | 3300005201 | Ga0072941_1402549 | Ga0072941_14025491 | 341 |
| 36 | 3300042612 | Ga0466705_051958 | Ga0466705_051958_968_2011 | 341 |
| 37 | 3300042643 | Ga0466704_142594 | Ga0466704_142594_1295_2320 | 341 |
| 38 | 3300009784 | Ga0123357_10001945 | Ga0123357_100019453 | 342 |
| 39 | 3300042593 | Ga0466691_006239 | Ga0466691_006239_7385_8416 | 343 |
| 40 | 3300042606 | Ga0466719_028262 | Ga0466719_028262_687_1718 | 343 |
| 41 | 3300042643 | Ga0466704_082750 | Ga0466704_082750_4732_5781 | 343 |
| 42 | 2225789004 | 2227644078 | 2228235320 | 344 |
| 43 | 3300005083 | Ga0068305_10252352 | Ga0068305_102523521 | 344 |
| 44 | 3300042606 | Ga0466719_319955 | Ga0466719_319955_3737_4804 | 346 |
| 45 | 3300042616 | Ga0466715_063088 | Ga0466715_063088_3465_4505 | 346 |
| 46 | 3300042605 | Ga0466716_067660 | Ga0466716_067660_5296_6339 | 347 |
| 47 | 3300042606 | Ga0466719_280712 | Ga0466719_280712_2022_3065 | 347 |
| 48 | 3300042616 | Ga0466715_403844 | Ga0466715_403844_664_1740 | 347 |
| 49 | 3300042648 | Ga0466709_410544 | Ga0466709_410544_3303_4346 | 347 |
| 50 | 3300010167 | Ga0123353_10073829 | Ga0123353_100738295 | 348 |
| 51 | 3300042590 | Ga0466690_101280 | Ga0466690_101280_3537_4583 | 348 |
| 52 | 3300042590 | Ga0466690_130397 | Ga0466690_130397_292_1338 | 348 |
| 53 | 3300042590 | Ga0466690_149899 | Ga0466690_149899_5410_6474 | 348 |
| 54 | 3300042601 | Ga0466707_127336 | Ga0466707_127336_2481_3581 | 348 |
| 55 | 3300042616 | Ga0466715_285909 | Ga0466715_285909_3952_5052 | 348 |
| 56 | iso_pr_bacteria | 2910959314 | 2910959459 | 348 |
| 57 | 3300042596 | Ga0466696_175794 | Ga0466696_175794_635_1684 | 349 |
| 58 | 3300042599 | Ga0466706_132256 | Ga0466706_132256_11206_12291 | 349 |
| 59 | 3300042605 | Ga0466716_539568 | Ga0466716_539568_3600_4670 | 349 |
| 60 | 3300042618 | Ga0466723_087959 | Ga0466723_087959_647_1696 | 349 |
| 61 | 3300009784 | Ga0123357_10400818 | Ga0123357_104008182 | 350 |
| 62 | 3300042615 | Ga0466711_288114 | Ga0466711_288114_956_2032 | 350 |
| 63 | 3300042654 | Ga0466725_124439 | Ga0466725_124439_227_1279 | 350 |
| 64 | 3300010049 | Ga0123356_10431720 | Ga0123356_104317202 | 351 |
| 65 | 3300042612 | Ga0466705_061319 | Ga0466705_061319_1785_2855 | 351 |
| 66 | 2225789004 | 2227591289 | 2228150868 | 353 |
| 67 | 3300010167 | Ga0123353_10777884 | Ga0123353_107778841 | 353 |
| 68 | 3300042591 | Ga0466692_119983 | Ga0466692_119983_2035_3096 | 353 |
| 69 | 3300042591 | Ga0466692_192614 | Ga0466692_192614_1248_2309 | 353 |
| 70 | 3300042598 | Ga0466701_098080 | Ga0466701_098080_48763_49824 | 353 |
| 71 | 3300042609 | Ga0466722_098074 | Ga0466722_098074_477_1538 | 353 |
| 72 | 3300042610 | Ga0466698_072502 | Ga0466698_072502_61_1122 | 353 |
| 73 | 3300042611 | Ga0466697_159345 | Ga0466697_159345_70_1131 | 353 |
| 74 | 3300042616 | Ga0466715_104403 | Ga0466715_104403_10814_11875 | 353 |
| 75 | 3300042621 | Ga0466729_096704 | Ga0466729_096704_7586_8647 | 353 |
| 76 | 3300042636 | Ga0466703_305494 | Ga0466703_305494_1064_2125 | 353 |
| 77 | 3300042643 | Ga0466704_193235 | Ga0466704_193235_3462_4523 | 353 |
| 78 | iso_pr_bacteria | 2820778767 | 2820780869 | 353 |
| 79 | 3300000062 | IMNBL1DRAFT_c0001921 | IMNBL1DRAFT_000192113 | 354 |
| 80 | 3300009784 | Ga0123357_10015964 | Ga0123357_100159642 | 354 |
| 81 | 3300024582 | Ga0265387_1003798 | Ga0265387_10037981 | 354 |
| 82 | 3300042591 | Ga0466692_102850 | Ga0466692_102850_11591_12655 | 354 |
| 83 | 3300042592 | Ga0466693_063245 | Ga0466693_063245_152_1216 | 354 |
| 84 | 3300042593 | Ga0466691_023853 | Ga0466691_023853_7270_8334 | 354 |
| 85 | 3300042601 | Ga0466707_191673 | Ga0466707_191673_7552_8616 | 354 |
| 86 | 3300042601 | Ga0466707_327841 | Ga0466707_327841_3759_4823 | 354 |
| 87 | 3300042606 | Ga0466719_104508 | Ga0466719_104508_588_1652 | 354 |
| 88 | 3300042609 | Ga0466722_131066 | Ga0466722_131066_8638_9702 | 354 |
| 89 | 3300042615 | Ga0466711_112728 | Ga0466711_112728_838_1902 | 354 |
| 90 | 3300042620 | Ga0466728_021718 | Ga0466728_021718_2297_3361 | 354 |
| 91 | 3300042621 | Ga0466729_069107 | Ga0466729_069107_3007_4071 | 354 |
| 92 | 3300042624 | Ga0466735_081564 | Ga0466735_081564_82_1146 | 354 |
| 93 | 3300042624 | Ga0466735_101884 | Ga0466735_101884_1272_2336 | 354 |
| 94 | 3300042624 | Ga0466735_178283 | Ga0466735_178283_3253_4317 | 354 |
| 95 | 3300042636 | Ga0466703_175050 | Ga0466703_175050_3749_4813 | 354 |
| 96 | 3300042648 | Ga0466709_414483 | Ga0466709_414483_18331_19395 | 354 |
| 97 | 3300042659 | Ga0466733_175419 | Ga0466733_175419_364_1428 | 354 |
| 98 | 3300042659 | Ga0466733_180918 | Ga0466733_180918_1371_2435 | 354 |
| 99 | 3300000062 | IMNBL1DRAFT_c0008088 | IMNBL1DRAFT_00080885 | 355 |
| 100 | 3300000062 | IMNBL1DRAFT_c0033748 | IMNBL1DRAFT_00337482 | 355 |
| 101 | 3300010049 | Ga0123356_10015974 | Ga0123356_100159742 | 355 |
| 102 | 3300042590 | Ga0466690_005110 | Ga0466690_005110_3588_4655 | 355 |
| 103 | 3300042596 | Ga0466696_305629 | Ga0466696_305629_98_1165 | 355 |
| 104 | 3300042598 | Ga0466701_014507 | Ga0466701_014507_510_1577 | 355 |
| 105 | 3300042601 | Ga0466707_062128 | Ga0466707_062128_17662_18729 | 355 |
| 106 | 3300042601 | Ga0466707_115094 | Ga0466707_115094_303_1370 | 355 |
| 107 | 3300042601 | Ga0466707_411730 | Ga0466707_411730_708_1775 | 355 |
| 108 | 3300042602 | Ga0466713_123016 | Ga0466713_123016_500_1621 | 355 |
| 109 | 3300042603 | Ga0466714_010843 | Ga0466714_010843_157_1224 | 355 |
| 110 | 3300042605 | Ga0466716_371367 | Ga0466716_371367_471_1538 | 355 |
| 111 | 3300042609 | Ga0466722_230937 | Ga0466722_230937_2342_3409 | 355 |
| 112 | 3300042610 | Ga0466698_364147 | Ga0466698_364147_209_1276 | 355 |
| 113 | 3300042618 | Ga0466723_094954 | Ga0466723_094954_1651_2718 | 355 |
| 114 | 3300042619 | Ga0466726_160354 | Ga0466726_160354_455_1522 | 355 |
| 115 | 3300042619 | Ga0466726_161990 | Ga0466726_161990_180_1247 | 355 |
| 116 | 3300042624 | Ga0466735_100070 | Ga0466735_100070_2926_3993 | 355 |
| 117 | 3300042624 | Ga0466735_110297 | Ga0466735_110297_859_1926 | 355 |
| 118 | 3300042643 | Ga0466704_293428 | Ga0466704_293428_2883_3950 | 355 |
| 119 | 3300042648 | Ga0466709_231759 | Ga0466709_231759_759_1826 | 355 |
| 120 | 3300042648 | Ga0466709_245110 | Ga0466709_245110_19664_20731 | 355 |
| 121 | 3300042652 | Ga0466708_290083 | Ga0466708_290083_139_1206 | 355 |
| 122 | 3300042655 | Ga0466727_104023 | Ga0466727_104023_3128_4195 | 355 |
| 123 | 3300042659 | Ga0466733_130577 | Ga0466733_130577_10809_11876 | 355 |
| 124 | iso_pr_bacteria | 2940216256 | 2940217634 | 355 |
| 125 | 3300042590 | Ga0466690_294371 | Ga0466690_294371_7572_8642 | 356 |
| 126 | 3300042596 | Ga0466696_261686 | Ga0466696_261686_632_1702 | 356 |
| 127 | 3300042601 | Ga0466707_242775 | Ga0466707_242775_1240_2310 | 356 |
| 128 | 3300042601 | Ga0466707_358506 | Ga0466707_358506_214_1284 | 356 |
| 129 | 3300042602 | Ga0466713_027728 | Ga0466713_027728_10977_12047 | 356 |
| 130 | 3300042611 | Ga0466697_101391 | Ga0466697_101391_154_1224 | 356 |
| 131 | 3300042616 | Ga0466715_240109 | Ga0466715_240109_11688_12758 | 356 |
| 132 | 3300042616 | Ga0466715_456601 | Ga0466715_456601_3821_4891 | 356 |
| 133 | 3300042622 | Ga0466731_010142 | Ga0466731_010142_956_2026 | 356 |
| 134 | 3300042636 | Ga0466703_140271 | Ga0466703_140271_12380_13450 | 356 |
| 135 | 3300000062 | IMNBL1DRAFT_c0001104 | IMNBL1DRAFT_000110413 | 357 |
| 136 | 3300042624 | Ga0466735_012272 | Ga0466735_012272_1113_2186 | 357 |
| 137 | iso_pr_bacteria | 2820762746 | 2820763180 | 357 |
| 138 | 3300042599 | Ga0466706_109799 | Ga0466706_109799_188942_190018 | 358 |
| 139 | 3300042602 | Ga0466713_037944 | Ga0466713_037944_20351_21427 | 358 |
| 140 | 3300042602 | Ga0466713_135454 | Ga0466713_135454_153_1229 | 358 |
| 141 | 3300042603 | Ga0466714_051125 | Ga0466714_051125_15178_16254 | 358 |
| 142 | 3300042603 | Ga0466714_150199 | Ga0466714_150199_33063_34139 | 358 |
| 143 | 3300042605 | Ga0466716_035678 | Ga0466716_035678_861_1937 | 358 |
| 144 | 3300042606 | Ga0466719_012506 | Ga0466719_012506_7611_8687 | 358 |
| 145 | 3300042616 | Ga0466715_023105 | Ga0466715_023105_5382_6458 | 358 |
| 146 | 3300042618 | Ga0466723_092051 | Ga0466723_092051_6564_7640 | 358 |
| 147 | 3300042643 | Ga0466704_186597 | Ga0466704_186597_2532_3608 | 358 |
| 148 | 3300042654 | Ga0466725_210063 | Ga0466725_210063_7761_8837 | 358 |
| 149 | 3300005071 | Ga0068302_10253998 | Ga0068302_102539982 | 359 |
| 150 | 3300005083 | Ga0068305_10037095 | Ga0068305_100370955 | 359 |
| 151 | iso_pr_bacteria | 2820789850 | 2820791663 | 359 |
| 152 | 3300010049 | Ga0123356_10544455 | Ga0123356_105444552 | 360 |
| 153 | 3300056842 | Ga0562377_0004 | Ga0562377_0004_3336744_3337826 | 360 |
| 154 | 3300042656 | Ga0466732_005715 | Ga0466732_005715_68475_69560 | 361 |
| 155 | iso_pr_bacteria | 2820776227 | 2820777191 | 364 |
| 156 | iso_pr_bacteria | 2910949487 | 2910951831 | 364 |
| 157 | 3300042606 | Ga0466719_221389 | Ga0466719_221389_1535_2632 | 365 |
| 158 | 3300042582 | Ga0466657_005889 | Ga0466657_005889_702_1802 | 366 |
| 159 | 3300042609 | Ga0466722_070620 | Ga0466722_070620_2742_3842 | 366 |
| 160 | 3300042656 | Ga0466732_114982 | Ga0466732_114982_626_1726 | 366 |
| 161 | 3300010049 | Ga0123356_10331477 | Ga0123356_103314772 | 367 |
| 162 | iso_pr_bacteria | 2940193328 | 2940195433 | 367 |
| 163 | iso_pr_bacteria | 2940336608 | 2940338707 | 367 |
| 164 | 3300042601 | Ga0466707_068270 | Ga0466707_068270_6181_7287 | 368 |
| 165 | 3300042602 | Ga0466713_130991 | Ga0466713_130991_190018_191124 | 368 |
| 166 | 3300042605 | Ga0466716_442880 | Ga0466716_442880_5967_7073 | 368 |
| 167 | 3300042643 | Ga0466704_572231 | Ga0466704_572231_1016_2122 | 368 |
| 168 | 3300042659 | Ga0466733_029228 | Ga0466733_029228_5067_6173 | 368 |
| 169 | iso_pr_bacteria | 2910930387 | 2910930862 | 368 |
| 170 | iso_pr_bacteria | 2910942425 | 2910945727 | 368 |
| 171 | iso_pr_bacteria | 2940244548 | 2940248364 | 368 |
| 172 | iso_pr_bacteria | 2940248789 | 2940252549 | 368 |
| 173 | iso_pr_bacteria | 2940253009 | 2940256761 | 368 |
| 174 | iso_pr_bacteria | 2940257232 | 2940260907 | 368 |
| 175 | 2225789003 | 2227065531 | 2227422511 | 369 |
| 176 | 3300042616 | Ga0466715_008476 | Ga0466715_008476_1141_2250 | 369 |
| 177 | 3300042624 | Ga0466735_198081 | Ga0466735_198081_235_1344 | 369 |
| 178 | 3300042625 | Ga0466730_038219 | Ga0466730_038219_692_1801 | 369 |
| 179 | 3300042659 | Ga0466733_054986 | Ga0466733_054986_81837_82946 | 369 |
| 180 | 3300000062 | IMNBL1DRAFT_c0001469 | IMNBL1DRAFT_00014695 | 370 |
| 181 | 3300000062 | IMNBL1DRAFT_c0048563 | IMNBL1DRAFT_00485632 | 370 |
| 182 | 3300042619 | Ga0466726_101376 | Ga0466726_101376_59_1171 | 370 |
| 183 | iso_pr_bacteria | 2910926975 | 2910927141 | 371 |
| 184 | iso_pr_bacteria | 2695420931 | 2698111066 | 372 |
| 185 | 3300042602 | Ga0466713_103961 | Ga0466713_103961_4403_5524 | 373 |
| 186 | 3300042643 | Ga0466704_575107 | Ga0466704_575107_2493_3614 | 373 |
| 187 | 3300042659 | Ga0466733_086622 | Ga0466733_086622_80_1201 | 373 |
| 188 | iso_pr_bacteria | 2695420314 | 2695472615 | 373 |
| 189 | iso_pr_bacteria | 2695420317 | 2695483569 | 373 |
| 190 | iso_pr_bacteria | 2873610414 | 2873612143 | 373 |
| 191 | 3300042659 | Ga0466733_203605 | Ga0466733_203605_65230_66354 | 374 |
| 192 | 3300042612 | Ga0466705_350955 | Ga0466705_350955_1351_2481 | 376 |
| 193 | 3300042659 | Ga0466733_006535 | Ga0466733_006535_2247_3383 | 378 |
| 194 | 3300042611 | Ga0466697_131549 | Ga0466697_131549_137_1279 | 380 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00146 | NADHdh | NADH dehydrogenase | 56 | 371 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00146 | GO:0016020 | membrane | CC |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.