Protein Family IF06990

Metagenome Isolate
286 Members
86 Samples
247 Scaffolds
252 Avg Length

🧬 Representative Sequence

ID
3300042611|Ga0466697_088530|Ga0466697_088530_344_1207
Length
287 aa
Sequence
MVRINEQMLVKSPPVGDLGGFRAVIVEDEIIAAQNLQRLIAQINKDIEIIAILQSVEDSFEWFSLNPNPDLVFMDIHLSDGSSFSIFEKVKIHAPVIFTTAYDEYALKAFEVNSIDYLLKPINIKELERAIEKFSHFNKTHSSTTLTNQTQYPSNEEVIANMLSMLKKEKKVYKSYFLIPHKDRFIPLSVNDIAYIYSENKIAKIVTFDNRTYYENSSLDEIQRQIDPVKLFRANRQFIIAHKAIKDIAVWFDSKLSVNLTVAIPEKIIVSRTRASEFKAWYTEKKK

📊 Sample Types

Isolate 13.3%
Metagenome 86.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.6%
Blattidae 28.4%
Kalotermitidae 17.3%
Unclassified 9.9%
Rhinotermitidae 4.9%
Termopsidae 3.7%
Passalidae 2.5%
Armadillidiidae 2.5%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 280
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2898741527 Sphingobacterium sp. xlx-73 Isolate
3 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
4 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
5 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
6 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2896321640 Sphingobacterium sp. xlx-130 Isolate
26 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
27 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
28 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
33 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
34 2896330536 Sphingobacterium sp. xlx-96 Isolate
35 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
36 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
37 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
38 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
41 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
42 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
43 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
44 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
47 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
48 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
49 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
54 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
55 2923982719 Parabacteroides sp. 52 Isolate Blattidae
56 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
57 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
58 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
59 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
60 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
61 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
62 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
63 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
64 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
65 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
66 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
67 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
68 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
69 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
70 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
71 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
72 2896350215 Sphingobacterium sp. xlx-183 Isolate
73 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
74 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
75 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
76 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
77 3004667792 Bacteroides sp. 519 Isolate Blattidae
78 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
79 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
80 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
81 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
82 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
83 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
84 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
85 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
86 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_144082 3300042611 Bacteria 2115
2 Ga0466697_211933 3300042611 Bacteria 12508
3 Ga0466735_050877 3300042624 Unclassified 5723
4 Ga0466703_372075 3300042636 Bacteria 10378
5 Ga0466704_248984 3300042643 Bacteria 7531
6 Ga0466708_000881 3300042652 Bacteria 14731
7 Ga0466708_019575 3300042652 Unclassified 1664
8 Ga0466725_001380 3300042654 Bacteria 1544
9 Ga0123355_10044435 3300009826 Bacteria 7232
10 Ga0123356_10068780 3300010049 Bacteria 3319
11 Ga0466710_428921 3300042613 Bacteria 4030
12 Ga0466711_168631 3300042615 Bacteria 7430
13 Ga0466690_128413 3300042590 Bacteria 8934
14 Ga0466692_198726 3300042591 Bacteria 9425
15 Ga0466691_019248 3300042593 Bacteria 19420
16 Ga0466696_185064 3300042596 Bacteria 9456
17 Ga0466707_237357 3300042601 Bacteria 23620
18 Ga0466707_237777 3300042601 Bacteria 5618
19 Ga0466716_365193 3300042605 Bacteria 5819
20 Ga0466719_004987 3300042606 Bacteria 6373
21 Ga0466722_022157 3300042609 Bacteria 77437
22 Ga0466722_075036 3300042609 Bacteria 7708
23 IMNBL1DRAFT_c0027495 3300000062 Bacteria 2138
24 JGI24702J35022_10018155 3300002462 Bacteria 3838
25 Ga0068305_10136157 3300005083 Bacteria 4231
26 Ga0466697_141273 3300042611 Bacteria 1253
27 Ga0466729_285140 3300042621 Bacteria 9746
28 Ga0466704_580358 3300042643 Bacteria 2595
29 Ga0466709_334557 3300042648 Bacteria 43111
30 Ga0466709_336610 3300042648 Bacteria 9072
31 Ga0466708_098195 3300042652 Bacteria 3459
32 Ga0123356_10058066 3300010049 Bacteria 3607
33 Ga0123356_10529306 3300010049 Bacteria 1338
34 Ga0123356_10569327 3300010049 Bacteria 1295
35 Ga0123353_10078311 3300010167 Unclassified 5312
36 Ga0123353_11139025 3300010167 Bacteria 1031
37 Ga0123353_11308967 3300010167 Bacteria 940
38 Ga0466710_144235 3300042613 Bacteria 4487
39 Ga0466710_358330 3300042613 Bacteria 1070
40 Ga0466715_403061 3300042616 Bacteria 5488
41 Ga0466723_013630 3300042618 Bacteria 7358
42 Ga0466728_107992 3300042620 Bacteria 3159
43 Ga0160445_100854 3300012847 Bacteria 11028
44 Ga0466690_225246 3300042590 Bacteria 6354
45 Ga0466700_195714 3300042600 Bacteria 4794
46 Ga0466713_048760 3300042602 Bacteria 2252
47 Ga0466713_079790 3300042602 Bacteria 8736
48 Ga0466716_087407 3300042605 Bacteria 4781
49 Ga0466722_157787 3300042609 Bacteria 8128
50 Ga0466697_002276 3300042611 Bacteria 2522
51 IMNBL1DRAFT_c0000723 3300000062 Bacteria 26182
52 IMNBL1DRAFT_c0020336 3300000062 Bacteria 2691
53 JGI24702J35022_10026456 3300002462 Bacteria 3126
54 Ga0466705_028090 3300042612 Bacteria 2904
55 Ga0466734_014107 3300042623 Bacteria 1319
56 Ga0466735_071841 3300042624 Bacteria 2263
57 Ga0466703_008994 3300042636 Bacteria 8245
58 Ga0466703_057829 3300042636 Bacteria 6614
59 Ga0466709_164079 3300042648 Bacteria 14559
60 Ga0466709_240562 3300042648 Bacteria 4354
61 Ga0466708_327998 3300042652 Bacteria 5555
62 Ga0466727_089775 3300042655 Bacteria 10598
63 Ga0466727_102378 3300042655 Bacteria 9872
64 Ga0466727_254171 3300042655 Bacteria 5090
65 Ga0123356_10143044 3300010049 Bacteria 2362
66 Ga0123353_10078344 3300010167 Bacteria 5311
67 Ga0123353_10206213 3300010167 Bacteria 3088
68 Ga0123353_10842445 3300010167 Bacteria 1258
69 Ga0123354_10001977 3300010882 Bacteria 26274
70 Ga0123354_10375878 3300010882 Bacteria 1233
71 Ga0466715_016367 3300042616 Bacteria 26019
72 Ga0466715_171782 3300042616 Bacteria 25470
73 Ga0466723_057857 3300042618 Bacteria 2469
74 Ga0466723_106728 3300042618 Bacteria 8787
75 Ga0466723_305442 3300042618 Bacteria 3572
76 Ga0466728_070800 3300042620 Bacteria 1841
77 Ga0466657_223027 3300042582 Bacteria 2505
78 Ga0466657_227318 3300042582 Bacteria 10409
79 Ga0466690_083927 3300042590 Bacteria 20212
80 Ga0466691_083530 3300042593 Bacteria 8078
81 Ga0466696_039324 3300042596 Bacteria 4246
82 Ga0466696_042910 3300042596 Bacteria 2330
83 Ga0466696_239216 3300042596 Bacteria 6186
84 Ga0466706_113181 3300042599 Bacteria 2180
85 Ga0466713_044431 3300042602 Bacteria 51121
86 Ga0466713_076120 3300042602 Bacteria 2354
87 Ga0466713_087512 3300042602 Bacteria 25471
88 Ga0466713_090467 3300042602 Bacteria 29280
89 Ga0466716_164163 3300042605 Bacteria 1132
90 Ga0466719_002772 3300042606 Bacteria 5561
91 Ga0466722_100226 3300042609 Bacteria 34191
92 2227236354 2225789004 Bacteria 7287
93 IMNBL1DRAFT_c0003187 3300000062 Bacteria 10736
94 JGI24702J35022_10015145 3300002462 Bacteria 4247
95 Ga0072940_1234288 3300005200 Bacteria 3214
96 Ga0072941_1091708 3300005201 Bacteria 7109
97 Ga0466705_011060 3300042612 Bacteria 2618
98 Ga0466733_018677 3300042659 Bacteria 2900
99 Ga0466703_249699 3300042636 Bacteria 47455
100 Ga0466703_263714 3300042636 Bacteria 11839
101 Ga0466704_294751 3300042643 Bacteria 11001
102 Ga0466704_317042 3300042643 Bacteria 8216
103 Ga0466704_342268 3300042643 Bacteria 3130
104 Ga0466709_064425 3300042648 Bacteria 43572
105 Ga0466709_255776 3300042648 Bacteria 24169
106 Ga0466708_108530 3300042652 Bacteria 10315
107 Ga0466727_151686 3300042655 Bacteria 12362
108 Ga0123357_10030261 3300009784 Bacteria 7340
109 Ga0123357_10367731 3300009784 Bacteria 1352
110 Ga0123353_10003337 3300010167 Bacteria 20256
111 Ga0123353_10048477 3300010167 Bacteria 6764
112 Ga0123353_10180524 3300010167 Bacteria 3342
113 Ga0466705_481418 3300042612 Bacteria 7027
114 Ga0466710_234207 3300042613 Bacteria 1641
115 Ga0466711_266669 3300042615 Bacteria 10291
116 Ga0466715_036133 3300042616 Bacteria 9019
117 Ga0466723_030006 3300042618 Bacteria 5586
118 Ga0466723_257306 3300042618 Bacteria 6308
119 Ga0466728_064502 3300042620 Bacteria 1473
120 Ga0466728_422788 3300042620 Bacteria 1319
121 Ga0160468_100143 3300012819 Bacteria 66884
122 Ga0466656_117438 3300042550 Bacteria 20246
123 Ga0466696_428939 3300042596 Bacteria 2167
124 Ga0466700_197306 3300042600 Bacteria 6844
125 Ga0466707_408160 3300042601 Bacteria 1019
126 Ga0466716_041307 3300042605 Bacteria 6429
127 Ga0466719_315329 3300042606 Bacteria 1676
128 Ga0466698_244215 3300042610 Bacteria 2610
129 Ga0466697_056567 3300042611 Bacteria 485126
130 2227272457 2225789004 Bacteria 6880
131 IMNBL1DRAFT_c0037356 3300000062 Bacteria 1684
132 Ga0466705_145807 3300042612 Bacteria 26901
133 Ga0466733_006757 3300042659 Bacteria 8323
134 Ga0466735_101457 3300042624 Unclassified 1892
135 Ga0466703_019771 3300042636 Bacteria 10207
136 Ga0466709_114343 3300042648 Bacteria 85236
137 Ga0466708_026623 3300042652 Bacteria 2928
138 Ga0123353_10595075 3300010167 Bacteria 1582
139 Ga0466711_022316 3300042615 Bacteria 5257
140 Ga0466711_292014 3300042615 Bacteria 2097
141 Ga0466728_327686 3300042620 Bacteria 44532
142 Ga0466728_332223 3300042620 Bacteria 1323
143 Ga0160445_100818 3300012847 Bacteria 11526
144 Ga0160445_101301 3300012847 Bacteria 7382
145 Ga0466690_199301 3300042590 Bacteria 6162
146 Ga0466690_368465 3300042590 Bacteria 7757
147 Ga0466691_108754 3300042593 Bacteria 2528
148 Ga0466696_049113 3300042596 Bacteria 63300
149 Ga0466696_124701 3300042596 Bacteria 3085
150 Ga0466696_130780 3300042596 Bacteria 11111
151 Ga0466706_008230 3300042599 Bacteria 32610
152 Ga0466719_333891 3300042606 Bacteria 3898
153 Ga0466719_425811 3300042606 Bacteria 1006
154 Ga0466722_020936 3300042609 Bacteria 10136
155 JGI24702J35022_10162139 3300002462 Bacteria 1260
156 Ga0072941_1067624 3300005201 Bacteria 4779
157 Ga0466697_088530 3300042611 Bacteria 1320
158 Ga0466697_162833 3300042611 Bacteria 2961
159 Ga0466697_231270 3300042611 Bacteria 1146
160 Ga0466705_379446 3300042612 Bacteria 13128
161 Ga0466733_127177 3300042659 Bacteria 3589
162 Ga0466735_132533 3300042624 Bacteria 2239
163 Ga0466703_374672 3300042636 Bacteria 5746
164 Ga0466704_061456 3300042643 Bacteria 2157
165 Ga0466709_163107 3300042648 Bacteria 19592
166 Ga0466725_010743 3300042654 Bacteria 1163
167 Ga0123356_10115525 3300010049 Bacteria 2600
168 Ga0123356_10529929 3300010049 Bacteria 1337
169 Ga0123356_10678673 3300010049 Bacteria 1198
170 Ga0123353_10000028 3300010167 Bacteria 164820
171 Ga0466705_491628 3300042612 Bacteria 1884
172 Ga0466710_131779 3300042613 Bacteria 9322
173 Ga0466712_172894 3300042614 Bacteria 4506
174 Ga0466723_006891 3300042618 Bacteria 31666
175 Ga0466723_229815 3300042618 Bacteria 11904
176 Ga0466656_274956 3300042550 Bacteria 1580
177 Ga0466691_076128 3300042593 Bacteria 5995
178 Ga0466696_014598 3300042596 Bacteria 13177
179 Ga0466696_188304 3300042596 Bacteria 24290
180 Ga0466696_254689 3300042596 Bacteria 35518
181 Ga0466696_399641 3300042596 Bacteria 27432
182 Ga0466696_481263 3300042596 Bacteria 8007
183 Ga0466696_481456 3300042596 Bacteria 8946
184 Ga0466707_060006 3300042601 Bacteria 6181
185 Ga0466707_150724 3300042601 Bacteria 2496
186 Ga0466707_221738 3300042601 Bacteria 26611
187 Ga0466698_032096 3300042610 Bacteria 1071
188 2227493793 2225789004 Bacteria 4005
189 IMNBL1DRAFT_c0008652 3300000062 Bacteria 5155
190 IMNBL1DRAFT_c0023417 3300000062 Bacteria 2419
191 Ga0068302_10112120 3300005071 Bacteria 2946
192 Ga0068305_10065818 3300005083 Bacteria 10279
193 Ga0466733_205011 3300042659 Bacteria 35496
194 Ga0466731_281136 3300042622 Bacteria 2154
195 Ga0466709_391166 3300042648 Bacteria 22805
196 Ga0466708_205462 3300042652 Bacteria 7687
197 Ga0123356_10192899 3300010049 Bacteria 2070
198 Ga0123356_10576023 3300010049 Bacteria 1289
199 Ga0123356_10675947 3300010049 Bacteria 1200
200 Ga0123353_10074702 3300010167 Bacteria 5449
201 Ga0123353_10161365 3300010167 Bacteria 3569
202 Ga0466723_137351 3300042618 Bacteria 4194
203 Ga0466657_347806 3300042582 Bacteria 1072
204 Ga0466657_377781 3300042582 Bacteria 3364
205 Ga0466690_215992 3300042590 Bacteria 8237
206 Ga0466692_048841 3300042591 Bacteria 12558
207 Ga0466693_045324 3300042592 Bacteria 2320
208 Ga0466696_342614 3300042596 Bacteria 2948
209 Ga0466696_405556 3300042596 Bacteria 12219
210 Ga0466701_078019 3300042598 Bacteria 3142
211 Ga0466713_048851 3300042602 Bacteria 6486
212 Ga0466717_037630 3300042604 Bacteria 1135
213 Ga0466719_401110 3300042606 Bacteria 1271
214 Ga0466722_017632 3300042609 Bacteria 5211
215 Ga0466697_038341 3300042611 Bacteria 1651
216 2227632951 2225789004 Bacteria 11318
217 IMNBL1DRAFT_c0004577 3300000062 Bacteria 8243
218 IMNBL1DRAFT_c0043550 3300000062 Bacteria 1485
219 JGI24695J34938_10003465 3300002450 Bacteria 11006
220 Ga0068305_10077318 3300005083 Bacteria 2630
221 Ga0068305_10455320 3300005083 Unclassified 4117
222 Ga0466735_026408 3300042624 Bacteria 1811
223 Ga0466735_084845 3300042624 Bacteria 1153
224 Ga0466709_267137 3300042648 Bacteria 107484
225 Ga0466724_65742 3300042649 Bacteria 14284
226 Ga0466708_090904 3300042652 Bacteria 64814
227 Ga0466708_141133 3300042652 Bacteria 11097
228 Ga0466725_103338 3300042654 Bacteria 13738
229 Ga0466727_086906 3300042655 Bacteria 13101
230 Ga0466727_254748 3300042655 Bacteria 6722
231 Ga0466712_314971 3300042614 Bacteria 8595
232 Ga0466723_062363 3300042618 Bacteria 3765
233 Ga0466723_234127 3300042618 Bacteria 12358
234 Ga0466656_184113 3300042550 Bacteria 2295
235 Ga0466690_186977 3300042590 Bacteria 11474
236 Ga0466690_327831 3300042590 Bacteria 7007
237 Ga0466692_203992 3300042591 Unclassified 1092
238 Ga0466693_402693 3300042592 Bacteria 1664
239 Ga0466696_296964 3300042596 Bacteria 6625
240 Ga0466696_337103 3300042596 Bacteria 10251
241 Ga0466707_240692 3300042601 Bacteria 5512
242 Ga0466713_027912 3300042602 Bacteria 47751
243 Ga0466719_082201 3300042606 Bacteria 3178
244 Ga0466722_163139 3300042609 Bacteria 3219
245 IMNBL1DRAFT_c0001424 3300000062 Bacteria 17905
246 JGI24699J35502_11134027 3300002509 Bacteria 24996
247 Ga0068305_10259996 3300005083 Bacteria 4660

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_481418 Ga0466705_481418_2216_2842 208
2 3300042618 Ga0466723_106728 Ga0466723_106728_6626_7393 216
3 3300042648 Ga0466709_064425 Ga0466709_064425_31624_32385 229
4 3300042612 Ga0466705_011060 Ga0466705_011060_1640_2395 230
5 3300042606 Ga0466719_401110 Ga0466719_401110_393_1157 232
6 3300042601 Ga0466707_408160 Ga0466707_408160_48_800 234
7 3300042655 Ga0466727_102378 Ga0466727_102378_7379_8140 234
8 3300042618 Ga0466723_305442 Ga0466723_305442_2647_3414 235
9 3300042648 Ga0466709_114343 Ga0466709_114343_60644_61405 236
10 3300042652 Ga0466708_327998 Ga0466708_327998_1278_2048 236
11 3300010167 Ga0123353_10595075 Ga0123353_105950752 237
12 3300042590 Ga0466690_327831 Ga0466690_327831_3591_4367 237
13 3300042599 Ga0466706_113181 Ga0466706_113181_1432_2169 237
14 3300042636 Ga0466703_372075 Ga0466703_372075_5994_6749 237
15 3300010167 Ga0123353_11308967 Ga0123353_113089671 238
16 3300042609 Ga0466722_022157 Ga0466722_022157_43251_44009 239
17 3300042610 Ga0466698_244215 Ga0466698_244215_1022_1786 239
18 3300010167 Ga0123353_10048477 Ga0123353_100484773 240
19 3300005201 Ga0072941_1067624 Ga0072941_10676246 241
20 3300042599 Ga0466706_008230 Ga0466706_008230_28091_28858 241
21 3300042648 Ga0466709_391166 Ga0466709_391166_19418_20179 241
22 3300042654 Ga0466725_103338 Ga0466725_103338_7927_8685 241
23 3300042643 Ga0466704_294751 Ga0466704_294751_6256_7020 242
24 3300042596 Ga0466696_039324 Ga0466696_039324_110_877 244
25 3300042596 Ga0466696_481263 Ga0466696_481263_5582_6343 244
26 3300042618 Ga0466723_229815 Ga0466723_229815_2095_2925 244
27 3300042648 Ga0466709_267137 Ga0466709_267137_69526_70296 244
28 3300042622 Ga0466731_281136 Ga0466731_281136_372_1133 245
29 3300042648 Ga0466709_164079 Ga0466709_164079_1894_2634 246
30 3300042596 Ga0466696_185064 Ga0466696_185064_845_1615 247
31 3300042652 Ga0466708_000881 Ga0466708_000881_1812_2555 247
32 3300042596 Ga0466696_124701 Ga0466696_124701_493_1239 248
33 3300042602 Ga0466713_027912 Ga0466713_027912_22937_23698 248
34 2225789004 2227236354 2227674213 249
35 2225789004 2227493793 2227968605 249
36 2225789004 2227632951 2228218122 249
37 3300010049 Ga0123356_10143044 Ga0123356_101430442 249
38 3300042611 Ga0466697_002276 Ga0466697_002276_1396_2145 249
39 3300042620 Ga0466728_070800 Ga0466728_070800_865_1614 249
40 3300042621 Ga0466729_285140 Ga0466729_285140_3810_4559 249
41 3300042624 Ga0466735_026408 Ga0466735_026408_722_1471 249
42 3300042624 Ga0466735_101457 Ga0466735_101457_607_1356 249
43 3300042624 Ga0466735_132533 Ga0466735_132533_1392_2141 249
44 3300042655 Ga0466727_089775 Ga0466727_089775_1414_2163 249
45 3300000062 IMNBL1DRAFT_c0000723 IMNBL1DRAFT_00007232 250
46 3300000062 IMNBL1DRAFT_c0008652 IMNBL1DRAFT_00086522 250
47 3300000062 IMNBL1DRAFT_c0027495 IMNBL1DRAFT_00274952 250
48 3300000062 IMNBL1DRAFT_c0037356 IMNBL1DRAFT_00373562 250
49 3300042590 Ga0466690_128413 Ga0466690_128413_4665_5417 250
50 3300042591 Ga0466692_203992 Ga0466692_203992_323_1075 250
51 3300042601 Ga0466707_237357 Ga0466707_237357_18024_18776 250
52 3300042601 Ga0466707_237777 Ga0466707_237777_2858_3610 250
53 3300042602 Ga0466713_087512 Ga0466713_087512_5428_6180 250
54 3300042606 Ga0466719_002772 Ga0466719_002772_4274_5026 250
55 3300042609 Ga0466722_020936 Ga0466722_020936_156_908 250
56 3300042618 Ga0466723_057857 Ga0466723_057857_941_1693 250
57 3300042620 Ga0466728_064502 Ga0466728_064502_528_1280 250
58 3300042624 Ga0466735_071841 Ga0466735_071841_1038_1790 250
59 3300042636 Ga0466703_249699 Ga0466703_249699_9665_10417 250
60 3300042636 Ga0466703_263714 Ga0466703_263714_9748_10500 250
61 3300042648 Ga0466709_240562 Ga0466709_240562_1677_2429 250
62 3300042649 Ga0466724_65742 Ga0466724_65742_5721_6473 250
63 3300042655 Ga0466727_151686 Ga0466727_151686_9797_10549 250
64 3300042655 Ga0466727_254171 Ga0466727_254171_567_1319 250
65 iso_pr_bacteria 2896321640 2896322059 250
66 iso_pr_bacteria 2896330536 2896333923 250
67 iso_pr_bacteria 2896350215 2896353461 250
68 iso_pr_bacteria 2898741527 2898742936 250
69 iso_pr_bacteria 2923982719 2923983295 250
70 iso_pr_bacteria 2940371297 2940373432 250
71 3300000062 IMNBL1DRAFT_c0023417 IMNBL1DRAFT_00234172 251
72 3300012819 Ga0160468_100143 Ga0160468_10014324 251
73 3300012847 Ga0160445_100818 Ga0160445_1008188 251
74 3300012847 Ga0160445_100854 Ga0160445_1008544 251
75 3300012847 Ga0160445_101301 Ga0160445_1013017 251
76 3300042590 Ga0466690_186977 Ga0466690_186977_7890_8645 251
77 3300042590 Ga0466690_215992 Ga0466690_215992_5633_6388 251
78 3300042590 Ga0466690_225246 Ga0466690_225246_1706_2461 251
79 3300042590 Ga0466690_368465 Ga0466690_368465_3385_4140 251
80 3300042593 Ga0466691_083530 Ga0466691_083530_589_1344 251
81 3300042596 Ga0466696_014598 Ga0466696_014598_9222_9977 251
82 3300042596 Ga0466696_130780 Ga0466696_130780_10162_10917 251
83 3300042596 Ga0466696_239216 Ga0466696_239216_2354_3109 251
84 3300042596 Ga0466696_296964 Ga0466696_296964_2359_3114 251
85 3300042601 Ga0466707_150724 Ga0466707_150724_951_1706 251
86 3300042605 Ga0466716_087407 Ga0466716_087407_3476_4231 251
87 3300042605 Ga0466716_164163 Ga0466716_164163_87_842 251
88 3300042606 Ga0466719_004987 Ga0466719_004987_1013_1768 251
89 3300042606 Ga0466719_315329 Ga0466719_315329_181_936 251
90 3300042606 Ga0466719_425811 Ga0466719_425811_204_959 251
91 3300042616 Ga0466715_016367 Ga0466715_016367_18113_18868 251
92 3300042616 Ga0466715_036133 Ga0466715_036133_1669_2424 251
93 3300042616 Ga0466715_403061 Ga0466715_403061_1313_2068 251
94 3300042618 Ga0466723_006891 Ga0466723_006891_23014_23769 251
95 3300042618 Ga0466723_030006 Ga0466723_030006_3212_3967 251
96 3300042618 Ga0466723_137351 Ga0466723_137351_808_1563 251
97 3300042618 Ga0466723_234127 Ga0466723_234127_7261_8016 251
98 3300042618 Ga0466723_257306 Ga0466723_257306_2284_3039 251
99 3300042620 Ga0466728_327686 Ga0466728_327686_38505_39260 251
100 3300042620 Ga0466728_332223 Ga0466728_332223_437_1192 251
101 3300042620 Ga0466728_422788 Ga0466728_422788_318_1073 251
102 3300042624 Ga0466735_050877 Ga0466735_050877_2375_3130 251
103 3300042636 Ga0466703_008994 Ga0466703_008994_3308_4063 251
104 3300042636 Ga0466703_019771 Ga0466703_019771_7751_8506 251
105 3300042636 Ga0466703_374672 Ga0466703_374672_3040_3795 251
106 3300042643 Ga0466704_061456 Ga0466704_061456_63_818 251
107 3300042643 Ga0466704_248984 Ga0466704_248984_2945_3700 251
108 3300042643 Ga0466704_317042 Ga0466704_317042_6893_7648 251
109 3300042652 Ga0466708_019575 Ga0466708_019575_389_1144 251
110 3300042652 Ga0466708_026623 Ga0466708_026623_1033_1788 251
111 3300042652 Ga0466708_098195 Ga0466708_098195_1191_1946 251
112 3300042652 Ga0466708_108530 Ga0466708_108530_7191_7946 251
113 3300042655 Ga0466727_086906 Ga0466727_086906_10908_11663 251
114 3300000062 IMNBL1DRAFT_c0003187 IMNBL1DRAFT_00031879 252
115 3300005071 Ga0068302_10112120 Ga0068302_101121205 252
116 3300005083 Ga0068305_10065818 Ga0068305_100658182 252
117 3300042590 Ga0466690_083927 Ga0466690_083927_13732_14490 252
118 3300042593 Ga0466691_019248 Ga0466691_019248_1820_2578 252
119 3300042606 Ga0466719_333891 Ga0466719_333891_2764_3522 252
120 3300042609 Ga0466722_075036 Ga0466722_075036_397_1155 252
121 3300042609 Ga0466722_163139 Ga0466722_163139_1973_2731 252
122 3300042615 Ga0466711_292014 Ga0466711_292014_1057_1815 252
123 3300042620 Ga0466728_107992 Ga0466728_107992_110_868 252
124 3300042648 Ga0466709_163107 Ga0466709_163107_9769_10527 252
125 iso_pr_bacteria 2820757377 2820758371 252
126 iso_pr_bacteria 2910926975 2910927832 252
127 iso_pr_bacteria 2910959314 2910961748 252
128 iso_pr_bacteria 2923982719 2923984047 252
129 iso_pr_bacteria 2940202316 2940204383 252
130 iso_pr_bacteria 2940205530 2940205553 252
131 iso_pr_bacteria 2940212447 2940212470 252
132 iso_pr_bacteria 2940298504 2940298527 252
133 iso_pr_bacteria 2940302308 2940302331 252
134 iso_pr_bacteria 2940306115 2940306460 252
135 iso_pr_bacteria 2940309933 2940310559 252
136 iso_pr_bacteria 2940313741 2940314370 252
137 iso_pr_bacteria 2940317558 2940318184 252
138 iso_pr_bacteria 2940321370 2940321714 252
139 iso_pr_bacteria 2940325180 2940325554 252
140 iso_pr_bacteria 2940328985 2940329360 252
141 iso_pr_bacteria 2940332795 2940333140 252
142 iso_pr_bacteria 2940371297 2940373729 252
143 iso_pr_bacteria 8100166142 8100169885 252
144 3300002462 JGI24702J35022_10015145 JGI24702J35022_100151453 253
145 3300002509 JGI24699J35502_11134027 JGI24699J35502_1113402712 253
146 3300042582 Ga0466657_223027 Ga0466657_223027_625_1386 253
147 3300042582 Ga0466657_227318 Ga0466657_227318_6081_6842 253
148 3300042582 Ga0466657_377781 Ga0466657_377781_2472_3233 253
149 3300042591 Ga0466692_198726 Ga0466692_198726_6330_7091 253
150 3300042592 Ga0466693_045324 Ga0466693_045324_960_1721 253
151 3300042596 Ga0466696_042910 Ga0466696_042910_1054_1815 253
152 3300042596 Ga0466696_342614 Ga0466696_342614_2023_2784 253
153 3300042601 Ga0466707_221738 Ga0466707_221738_21898_22659 253
154 3300042601 Ga0466707_240692 Ga0466707_240692_3795_4556 253
155 3300042602 Ga0466713_044431 Ga0466713_044431_45047_45808 253
156 3300042602 Ga0466713_048851 Ga0466713_048851_5275_6036 253
157 3300042602 Ga0466713_079790 Ga0466713_079790_1910_2671 253
158 3300042604 Ga0466717_037630 Ga0466717_037630_319_1080 253
159 3300042609 Ga0466722_100226 Ga0466722_100226_8186_8947 253
160 3300042610 Ga0466698_032096 Ga0466698_032096_119_880 253
161 3300042611 Ga0466697_038341 Ga0466697_038341_595_1356 253
162 3300042611 Ga0466697_056567 Ga0466697_056567_25908_26669 253
163 3300042611 Ga0466697_056567 Ga0466697_056567_350310_351071 253
164 3300042612 Ga0466705_028090 Ga0466705_028090_2091_2852 253
165 3300042612 Ga0466705_379446 Ga0466705_379446_3471_4232 253
166 3300042613 Ga0466710_144235 Ga0466710_144235_569_1330 253
167 3300042615 Ga0466711_022316 Ga0466711_022316_849_1610 253
168 3300042648 Ga0466709_255776 Ga0466709_255776_11962_12723 253
169 3300042652 Ga0466708_090904 Ga0466708_090904_32195_32956 253
170 3300042652 Ga0466708_141133 Ga0466708_141133_7744_8505 253
171 3300042654 Ga0466725_001380 Ga0466725_001380_516_1277 253
172 3300042654 Ga0466725_010743 Ga0466725_010743_196_957 253
173 3300042655 Ga0466727_254748 Ga0466727_254748_4322_5083 253
174 iso_pr_bacteria 2940195863 2940196587 253
175 iso_pr_bacteria 2940199050 2940201960 253
176 iso_pr_bacteria 2940202316 2940205300 253
177 iso_pr_bacteria 2940209341 2940212177 253
178 iso_pr_bacteria 2940346213 2940349090 253
179 3300000062 IMNBL1DRAFT_c0001424 IMNBL1DRAFT_00014242 254
180 3300000062 IMNBL1DRAFT_c0004577 IMNBL1DRAFT_00045772 254
181 3300002462 JGI24702J35022_10018155 JGI24702J35022_100181555 254
182 3300005083 Ga0068305_10077318 Ga0068305_100773182 254
183 3300005083 Ga0068305_10136157 Ga0068305_101361575 254
184 3300005083 Ga0068305_10259996 Ga0068305_102599964 254
185 3300005083 Ga0068305_10455320 Ga0068305_104553203 254
186 3300009784 Ga0123357_10030261 Ga0123357_100302613 254
187 3300009784 Ga0123357_10367731 Ga0123357_103677312 254
188 3300010049 Ga0123356_10529929 Ga0123356_105299292 254
189 3300010167 Ga0123353_10074702 Ga0123353_100747022 254
190 3300042550 Ga0466656_117438 Ga0466656_117438_15134_15898 254
191 3300042550 Ga0466656_184113 Ga0466656_184113_447_1211 254
192 3300042550 Ga0466656_274956 Ga0466656_274956_209_973 254
193 3300042590 Ga0466690_199301 Ga0466690_199301_3395_4159 254
194 3300042596 Ga0466696_049113 Ga0466696_049113_29612_30376 254
195 3300042596 Ga0466696_405556 Ga0466696_405556_5848_6612 254
196 3300042600 Ga0466700_195714 Ga0466700_195714_805_1569 254
197 3300042600 Ga0466700_197306 Ga0466700_197306_5793_6557 254
198 3300042602 Ga0466713_076120 Ga0466713_076120_931_1695 254
199 3300042605 Ga0466716_365193 Ga0466716_365193_3850_4614 254
200 3300042609 Ga0466722_017632 Ga0466722_017632_3145_3909 254
201 3300042611 Ga0466697_162833 Ga0466697_162833_1148_1912 254
202 3300042611 Ga0466697_211933 Ga0466697_211933_121_885 254
203 3300042612 Ga0466705_491628 Ga0466705_491628_18_782 254
204 3300042613 Ga0466710_234207 Ga0466710_234207_108_872 254
205 3300042614 Ga0466712_172894 Ga0466712_172894_2794_3558 254
206 3300042615 Ga0466711_266669 Ga0466711_266669_2327_3091 254
207 3300042618 Ga0466723_013630 Ga0466723_013630_775_1539 254
208 3300042636 Ga0466703_057829 Ga0466703_057829_5628_6392 254
209 3300042643 Ga0466704_342268 Ga0466704_342268_1214_1978 254
210 3300042643 Ga0466704_580358 Ga0466704_580358_130_894 254
211 3300042652 Ga0466708_205462 Ga0466708_205462_4174_4938 254
212 3300042659 Ga0466733_006757 Ga0466733_006757_4834_5598 254
213 3300042659 Ga0466733_018677 Ga0466733_018677_1720_2484 254
214 3300042659 Ga0466733_127177 Ga0466733_127177_500_1264 254
215 iso_pr_bacteria 2820797595 2820798410 254
216 iso_pr_bacteria 3004667792 3004669010 254
217 3300000062 IMNBL1DRAFT_c0020336 IMNBL1DRAFT_00203362 255
218 3300002450 JGI24695J34938_10003465 JGI24695J34938_100034652 255
219 3300002462 JGI24702J35022_10026456 JGI24702J35022_100264562 255
220 3300002462 JGI24702J35022_10162139 JGI24702J35022_101621391 255
221 3300010049 Ga0123356_10068780 Ga0123356_100687803 255
222 3300010049 Ga0123356_10192899 Ga0123356_101928992 255
223 3300010049 Ga0123356_10675947 Ga0123356_106759472 255
224 3300010167 Ga0123353_10078344 Ga0123353_100783442 255
225 3300010167 Ga0123353_10161365 Ga0123353_101613653 255
226 3300010882 Ga0123354_10375878 Ga0123354_103758782 255
227 3300042596 Ga0466696_188304 Ga0466696_188304_12668_13435 255
228 3300042596 Ga0466696_337103 Ga0466696_337103_8093_8860 255
229 3300042596 Ga0466696_481456 Ga0466696_481456_2027_2794 255
230 3300042601 Ga0466707_060006 Ga0466707_060006_5367_6134 255
231 3300042613 Ga0466710_131779 Ga0466710_131779_5847_6614 255
232 3300042613 Ga0466710_358330 Ga0466710_358330_258_1025 255
233 3300042616 Ga0466715_171782 Ga0466715_171782_7618_8385 255
234 3300042648 Ga0466709_334557 Ga0466709_334557_16687_17454 255
235 3300042659 Ga0466733_205011 Ga0466733_205011_30779_31546 255
236 iso_pr_bacteria 2695420931 2698109307 255
237 iso_pr_bacteria 2940216256 2940217399 255
238 2225789004 2227272457 2227721955 256
239 3300005200 Ga0072940_1234288 Ga0072940_12342883 256
240 3300009826 Ga0123355_10044435 Ga0123355_100444354 256
241 3300010049 Ga0123356_10115525 Ga0123356_101155252 256
242 3300010049 Ga0123356_10569327 Ga0123356_105693272 256
243 3300010167 Ga0123353_10078311 Ga0123353_100783113 256
244 3300010167 Ga0123353_10206213 Ga0123353_102062133 256
245 3300042592 Ga0466693_402693 Ga0466693_402693_56_826 256
246 3300042593 Ga0466691_108754 Ga0466691_108754_888_1658 256
247 3300042598 Ga0466701_078019 Ga0466701_078019_2087_2857 256
248 3300042602 Ga0466713_048760 Ga0466713_048760_899_1669 256
249 3300042602 Ga0466713_090467 Ga0466713_090467_12900_13670 256
250 3300042606 Ga0466719_082201 Ga0466719_082201_2371_3141 256
251 3300042613 Ga0466710_428921 Ga0466710_428921_3042_3812 256
252 3300042614 Ga0466712_314971 Ga0466712_314971_1635_2405 256
253 3300042618 Ga0466723_062363 Ga0466723_062363_499_1269 256
254 3300042648 Ga0466709_336610 Ga0466709_336610_7000_7770 256
255 iso_pr_bacteria 2820772500 2820773331 256
256 3300005201 Ga0072941_1091708 Ga0072941_10917084 257
257 3300010882 Ga0123354_10001977 Ga0123354_1000197711 257
258 3300042591 Ga0466692_048841 Ga0466692_048841_2896_3669 257
259 3300042593 Ga0466691_076128 Ga0466691_076128_4013_4786 257
260 3300042605 Ga0466716_041307 Ga0466716_041307_125_898 257
261 3300042615 Ga0466711_168631 Ga0466711_168631_2952_3725 257
262 iso_pr_bacteria 2940216256 2940217360 257
263 3300010167 Ga0123353_10003337 Ga0123353_1000333716 258
264 3300010167 Ga0123353_10842445 Ga0123353_108424452 258
265 3300010167 Ga0123353_11139025 Ga0123353_111390251 258
266 3300042609 Ga0466722_157787 Ga0466722_157787_3442_4218 258
267 iso_pr_bacteria 2820770630 2820770702 258
268 3300010049 Ga0123356_10576023 Ga0123356_105760232 259
269 3300010167 Ga0123353_10000028 Ga0123353_1000002872 259
270 3300042596 Ga0466696_254689 Ga0466696_254689_10385_11164 259
271 3300042596 Ga0466696_428939 Ga0466696_428939_1141_1947 259
272 3300042624 Ga0466735_084845 Ga0466735_084845_241_1020 259
273 3300010049 Ga0123356_10678673 Ga0123356_106786731 262
274 3300010167 Ga0123353_10180524 Ga0123353_101805242 262
275 iso_pr_bacteria 3004667792 3004668750 262
276 3300042611 Ga0466697_141273 Ga0466697_141273_451_1242 263
277 3300042582 Ga0466657_347806 Ga0466657_347806_78_875 265
278 3300042596 Ga0466696_399641 Ga0466696_399641_307_1110 267
279 3300010049 Ga0123356_10529306 Ga0123356_105293062 268
280 3300042623 Ga0466734_014107 Ga0466734_014107_146_952 268
281 3300010049 Ga0123356_10058066 Ga0123356_100580663 269
282 3300042611 Ga0466697_144082 Ga0466697_144082_534_1343 269
283 3300042611 Ga0466697_231270 Ga0466697_231270_79_888 269
284 3300000062 IMNBL1DRAFT_c0043550 IMNBL1DRAFT_00435502 276
285 3300042612 Ga0466705_145807 Ga0466705_145807_18351_19196 281
286 3300042611 Ga0466697_088530 Ga0466697_088530_344_1207 287

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04397 LytTR LytTr DNA-binding domain 183 281 0.97
PF00072 Response_reg Response regulator receiver domain 24 131 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF04397 GO:0003677 DNA binding MF
PF00072 GO:0000160 phosphorelay signal transduction system BP

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2qv0-assembly1.cif.gz_A Crystal structure of the response regulatory domain of protein mrkE from Klebsiella pneumoniae 0.876 22 140
6m8o-assembly1.cif.gz_A Crystal structure of the receiver domain of LytR from Staphylococcus aureus 0.859 22 134
3lua-assembly1.cif.gz_A Crystal structure of a Signal receiver domain of Two component Signal Transduction (Histidine Kinase) from Clostridium thermocellum 0.856 21 134
6swl-assembly2.cif.gz_B The REC domain of XynC, a response regulator from Geobacillus stearothermophilus 0.845 18 142
3d6w-assembly1.cif.gz_A LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator from Bacillus cereus. 0.843 174 283
IDDescriptionScoreStartEndSuperfamily
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8798 174 241 2.40.50.40
2qv0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8782 22 140 3.40.50.2300
3d6wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8761 174 241 2.40.50.40
af_Q2FVQ7_36_146_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.8712 172 283 2.40.50.1020
6m8oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.859 22 134 3.40.50.2300
IDDescriptionScoreStartEndGO Terms
AF-A0A6N4EAC8-F1-model_v4 Uncharacterized/unreviewed 0.9758 192 282
AF-A0A432KJE5-F1-model_v4 Uncharacterized/unreviewed 0.972 193 284

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.47 0.56 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.