Protein Family IF06961

Metagenome Isolate
125 Members
47 Samples
123 Scaffolds
258.08 Avg Length

🧬 Representative Sequence

ID
3300042610|Ga0466698_449876|Ga0466698_449876_168_1067
Length
299 aa
Sequence
MGQSLCWRLQGRIVAQIATGEKKIKRQAKDASRSRQQRGQSAMKIRMLSWNVNGLRAISAKPEWSWFKNSAADIVALQETKAAPEQLASELRAPAGWHAGWSSSVVKKGYSGVAVFSRTEPLLIREELPDPAFRGEGRLVHLEYPAFHFLAVYFPNGGEENRRVPYKMAFYDAFLLHVQDLRRTKPLVVCGDFNTAHAEIDLARPKQNENTTGFLPEERAWMDAFTAAGYVDTFRHVHGQVAGAYTWWSYRQGARRTNVGWRIDYFFTSRELLPAIRNAWIEKDVHGSDHCPVGLELEL

📊 Sample Types

Isolate 1.6%
Metagenome 98.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.4%
Kalotermitidae 31.1%
Unclassified 8.9%
Termopsidae 8.9%
Rhinotermitidae 6.7%

🌳 Taxonomy

Archaea 1
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
14 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
15 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
16 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
17 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
18 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2820044805 Unclassified Proteobacteria Th196P4bin15 Isolate Unclassified
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 650716102 Treponema primitia ZAS-2 Isolate Unclassified
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_138697 3300042611 Bacteria 1678
2 Ga0466690_029701 3300042590 Bacteria 8580
3 Ga0466692_172967 3300042591 Bacteria 17796
4 Ga0466691_101246 3300042593 Bacteria 6446
5 Ga0466735_155122 3300042624 Bacteria 2635
6 Ga0466703_397178 3300042636 Bacteria 1625
7 Ga0466704_177901 3300042643 Bacteria 1512
8 Ga0466705_427691 3300042612 Bacteria 5854
9 Ga0466710_188094 3300042613 Bacteria 1265
10 Ga0466712_322017 3300042614 Bacteria 16906
11 Ga0466715_286076 3300042616 Bacteria 13194
12 Ga0466718_121824 3300042617 Bacteria 1661
13 Ga0466723_141827 3300042618 Bacteria 6436
14 Ga0466728_254550 3300042620 Bacteria 6144
15 Ga0466729_015332 3300042621 Bacteria 1065
16 Ga0466716_343406 3300042605 Bacteria 6997
17 Ga0466719_248759 3300042606 Bacteria 2029
18 Ga0466719_479516 3300042606 Unclassified 3272
19 Ga0264413_128257 3300024493 Bacteria 4869
20 Ga0466703_090946 3300042636 Bacteria 4285
21 Ga0466704_229062 3300042643 Bacteria 13146
22 Ga0466708_008051 3300042652 Bacteria 1781
23 Ga0466708_370403 3300042652 Bacteria 1137
24 Ga0466712_065710 3300042614 Bacteria 1148
25 Ga0466711_079301 3300042615 Bacteria 9544
26 Ga0466726_102842 3300042619 Bacteria 3922
27 Ga0123353_10491912 3300010167 Bacteria 1791
28 Ga0466701_102004 3300042598 Bacteria 5698
29 Ga0466717_289486 3300042604 Bacteria 1096
30 Ga0466716_098301 3300042605 Bacteria 6381
31 Ga0072941_1262030 3300005201 Bacteria 1045
32 Ga0466691_225642 3300042593 Bacteria 85197
33 Ga0466696_405851 3300042596 Bacteria 28381
34 Ga0466708_293095 3300042652 Bacteria 4156
35 Ga0466727_318695 3300042655 Bacteria 3057
36 Ga0466711_163751 3300042615 Bacteria 5235
37 Ga0466723_073445 3300042618 Bacteria 67522
38 Ga0466726_056722 3300042619 Bacteria 11309
39 Ga0123353_10597147 3300010167 Bacteria 1579
40 Ga0123353_10850100 3300010167 Bacteria 1251
41 Ga0466716_185390 3300042605 Bacteria 27438
42 Ga0466719_051408 3300042606 Bacteria 1261
43 Ga0466719_217662 3300042606 Bacteria 2370
44 Ga0466719_254288 3300042606 Bacteria 2985
45 Ga0466719_331741 3300042606 Bacteria 24471
46 JGI24698J34947_10007827 3300002449 Bacteria 5869
47 JGI24698J34947_10100083 3300002449 Bacteria 1306
48 Ga0466705_062368 3300042612 Bacteria 6844
49 Ga0466691_033243 3300042593 Bacteria 1282
50 Ga0466735_163932 3300042624 Bacteria 1706
51 Ga0466704_258296 3300042643 Bacteria 7907
52 Ga0466709_144763 3300042648 Bacteria 1986
53 Ga0466725_394106 3300042654 Bacteria 1874
54 Ga0466712_159988 3300042614 Bacteria 1025
55 Ga0466715_288828 3300042616 Bacteria 18849
56 Ga0466723_175652 3300042618 Bacteria 41824
57 Ga0123357_10467995 3300009784 Bacteria 1077
58 Ga0123356_11186300 3300010049 Bacteria 930
59 Ga0466713_106285 3300042602 Bacteria 2427
60 Ga0466716_296428 3300042605 Bacteria 2302
61 Ga0466698_178188 3300042610 Bacteria 2709
62 Ga0466705_226612 3300042612 Bacteria 1979
63 Ga0466657_010771 3300042582 Bacteria 1277
64 Ga0466690_137081 3300042590 Bacteria 37774
65 Ga0466729_207463 3300042621 Bacteria 64397
66 Ga0466735_073363 3300042624 Bacteria 3333
67 Ga0466704_037586 3300042643 Unclassified 1403
68 Ga0466704_408972 3300042643 Bacteria 12038
69 Ga0466704_469559 3300042643 Bacteria 5902
70 Ga0466718_117643 3300042617 Bacteria 10012
71 Ga0466723_217381 3300042618 Unclassified 5794
72 Ga0466726_116200 3300042619 Unclassified 3631
73 Ga0123356_10260532 3300010049 Bacteria 1817
74 Ga0123353_10330883 3300010167 Unclassified 2306
75 Ga0123354_10035153 3300010882 Bacteria 7826
76 Ga0466707_373814 3300042601 Bacteria 5293
77 Ga0466716_268443 3300042605 Bacteria 106882
78 Ga0466719_150329 3300042606 Bacteria 9424
79 Ga0466719_203444 3300042606 Bacteria 5533
80 Ga0466722_161423 3300042609 Bacteria 3096
81 JGI24698J34947_10056056 3300002449 Bacteria 1961
82 JGI24702J35022_10008767 3300002462 Bacteria 5710
83 JGI24705J35276_12194183 3300002504 Bacteria 1508
84 Ga0466729_318336 3300042621 Unclassified 2968
85 Ga0466735_173989 3300042624 Bacteria 4078
86 Ga0466704_145291 3300042643 Bacteria 11527
87 Ga0466709_338581 3300042648 Bacteria 14434
88 Ga0466715_386787 3300042616 Bacteria 2005
89 Ga0466715_425219 3300042616 Bacteria 5108
90 Ga0466726_128370 3300042619 Unclassified 5330
91 Ga0466729_170719 3300042621 Bacteria 1006
92 Ga0123353_10942033 3300010167 Bacteria 1169
93 Ga0466717_088881 3300042604 Bacteria 1380
94 Ga0466719_097142 3300042606 Bacteria 22858
95 Ga0466719_266835 3300042606 Archaea 3011
96 Ga0466722_198809 3300042609 Bacteria 5197
97 Ga0466698_449876 3300042610 Bacteria 2346
98 Ga0466695_213576 3300042595 Bacteria 4622
99 Ga0466696_389282 3300042596 Bacteria 5980
100 Ga0466729_232740 3300042621 Bacteria 1154
101 Ga0466703_119095 3300042636 Bacteria 16693
102 Ga0466709_166132 3300042648 Bacteria 5359
103 Ga0466712_277646 3300042614 Bacteria 1888
104 Ga0466715_114308 3300042616 Bacteria 5948
105 Ga0466700_181380 3300042600 Bacteria 1501
106 Ga0466717_182282 3300042604 Unclassified 1402
107 Ga0123357_10001974 3300009784 Bacteria 22438
108 Ga0466694_363184 3300042594 Bacteria 5532
109 Ga0466735_136968 3300042624 Bacteria 1167
110 Ga0466703_296491 3300042636 Unclassified 1231
111 Ga0466704_376558 3300042643 Unclassified 71218
112 Ga0466708_106623 3300042652 Bacteria 34173
113 Ga0466711_513350 3300042615 Bacteria 9422
114 Ga0466723_326724 3300042618 Bacteria 5284
115 Ga0466726_409579 3300042619 Bacteria 3330
116 Ga0466728_231062 3300042620 Bacteria 10677
117 Ga0466729_134072 3300042621 Bacteria 2999
118 Ga0123357_10247435 3300009784 Bacteria 1916
119 Ga0123353_10135563 3300010167 Bacteria 3948
120 Ga0466707_116763 3300042601 Bacteria 3118
121 Ga0466698_247589 3300042610 Bacteria 1299
122 Ga0068302_10019483 3300005071 Bacteria 5707
123 Ga0072940_1275570 3300005200 Bacteria 1155

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_137081 Ga0466690_137081_956_1591 211
2 3300042596 Ga0466696_405851 Ga0466696_405851_2589_3224 211
3 3300042643 Ga0466704_177901 Ga0466704_177901_479_1114 211
4 3300042643 Ga0466704_376558 Ga0466704_376558_1063_1698 211
5 3300042621 Ga0466729_015332 Ga0466729_015332_45_740 231
6 3300042652 Ga0466708_370403 Ga0466708_370403_10_723 237
7 3300042648 Ga0466709_166132 Ga0466709_166132_587_1306 239
8 3300042619 Ga0466726_102842 Ga0466726_102842_68_841 242
9 3300042643 Ga0466704_037586 Ga0466704_037586_174_911 245
10 3300005201 Ga0072941_1262030 Ga0072941_12620301 248
11 3300042605 Ga0466716_098301 Ga0466716_098301_3479_4231 250
12 3300042619 Ga0466726_116200 Ga0466726_116200_436_1191 251
13 3300042619 Ga0466726_128370 Ga0466726_128370_1962_2717 251
14 3300005071 Ga0068302_10019483 Ga0068302_100194831 252
15 3300042598 Ga0466701_102004 Ga0466701_102004_652_1413 253
16 3300042601 Ga0466707_116763 Ga0466707_116763_1410_2171 253
17 3300042604 Ga0466717_182282 Ga0466717_182282_597_1358 253
18 3300042617 Ga0466718_117643 Ga0466718_117643_8789_9550 253
19 iso_pr_bacteria 2820044805 2820045515 253
20 3300009784 Ga0123357_10001974 Ga0123357_1000197419 254
21 3300009784 Ga0123357_10467995 Ga0123357_104679951 254
22 3300010049 Ga0123356_10260532 Ga0123356_102605323 254
23 3300010167 Ga0123353_10135563 Ga0123353_101355632 254
24 3300010167 Ga0123353_10330883 Ga0123353_103308834 254
25 3300010167 Ga0123353_10491912 Ga0123353_104919121 254
26 3300042596 Ga0466696_389282 Ga0466696_389282_2521_3285 254
27 3300042606 Ga0466719_150329 Ga0466719_150329_5268_6032 254
28 3300042614 Ga0466712_065710 Ga0466712_065710_246_1010 254
29 3300042636 Ga0466703_397178 Ga0466703_397178_682_1446 254
30 3300042643 Ga0466704_469559 Ga0466704_469559_2201_2965 254
31 3300010167 Ga0123353_10597147 Ga0123353_105971472 255
32 3300042593 Ga0466691_033243 Ga0466691_033243_332_1099 255
33 3300042612 Ga0466705_226612 Ga0466705_226612_607_1374 255
34 3300042624 Ga0466735_155122 Ga0466735_155122_713_1480 255
35 3300042606 Ga0466719_248759 Ga0466719_248759_36_806 256
36 3300042618 Ga0466723_141827 Ga0466723_141827_742_1512 256
37 3300042618 Ga0466723_217381 Ga0466723_217381_4543_5313 256
38 3300024493 Ga0264413_128257 Ga0264413_1282573 257
39 3300042582 Ga0466657_010771 Ga0466657_010771_95_868 257
40 3300042594 Ga0466694_363184 Ga0466694_363184_1982_2755 257
41 3300042606 Ga0466719_254288 Ga0466719_254288_1450_2223 257
42 3300042609 Ga0466722_161423 Ga0466722_161423_1002_1775 257
43 3300042610 Ga0466698_178188 Ga0466698_178188_1831_2604 257
44 3300042610 Ga0466698_247589 Ga0466698_247589_18_791 257
45 3300042611 Ga0466697_138697 Ga0466697_138697_856_1629 257
46 3300042613 Ga0466710_188094 Ga0466710_188094_288_1061 257
47 3300042616 Ga0466715_386787 Ga0466715_386787_1212_1985 257
48 3300042621 Ga0466729_318336 Ga0466729_318336_1885_2658 257
49 3300002462 JGI24702J35022_10008767 JGI24702J35022_100087675 258
50 3300002504 JGI24705J35276_12194183 JGI24705J35276_121941831 258
51 3300005200 Ga0072940_1275570 Ga0072940_12755701 258
52 3300010167 Ga0123353_10850100 Ga0123353_108501002 258
53 3300042593 Ga0466691_225642 Ga0466691_225642_83719_84495 258
54 3300042605 Ga0466716_185390 Ga0466716_185390_12529_13305 258
55 3300042605 Ga0466716_268443 Ga0466716_268443_103701_104477 258
56 3300042605 Ga0466716_343406 Ga0466716_343406_5278_6054 258
57 3300042606 Ga0466719_051408 Ga0466719_051408_34_810 258
58 3300042606 Ga0466719_203444 Ga0466719_203444_1923_2699 258
59 3300042615 Ga0466711_079301 Ga0466711_079301_7731_8507 258
60 3300042616 Ga0466715_286076 Ga0466715_286076_3123_3899 258
61 3300042618 Ga0466723_073445 Ga0466723_073445_561_1337 258
62 3300042618 Ga0466723_326724 Ga0466723_326724_1689_2465 258
63 3300042624 Ga0466735_163932 Ga0466735_163932_166_942 258
64 3300042636 Ga0466703_090946 Ga0466703_090946_3405_4181 258
65 3300042652 Ga0466708_008051 Ga0466708_008051_761_1537 258
66 3300042652 Ga0466708_106623 Ga0466708_106623_29432_30208 258
67 3300010049 Ga0123356_11186300 Ga0123356_111863001 259
68 3300042595 Ga0466695_213576 Ga0466695_213576_3460_4239 259
69 3300042601 Ga0466707_373814 Ga0466707_373814_3113_3892 259
70 3300042604 Ga0466717_088881 Ga0466717_088881_195_974 259
71 3300042606 Ga0466719_217662 Ga0466719_217662_57_836 259
72 3300042606 Ga0466719_266835 Ga0466719_266835_748_1527 259
73 3300042612 Ga0466705_427691 Ga0466705_427691_140_919 259
74 3300042616 Ga0466715_114308 Ga0466715_114308_3095_3874 259
75 3300042620 Ga0466728_231062 Ga0466728_231062_4527_5306 259
76 3300042621 Ga0466729_207463 Ga0466729_207463_52432_53211 259
77 3300042624 Ga0466735_136968 Ga0466735_136968_221_1000 259
78 3300042636 Ga0466703_119095 Ga0466703_119095_1186_1965 259
79 3300042636 Ga0466703_296491 Ga0466703_296491_332_1111 259
80 3300042643 Ga0466704_145291 Ga0466704_145291_2761_3540 259
81 3300042643 Ga0466704_258296 Ga0466704_258296_543_1322 259
82 3300042648 Ga0466709_338581 Ga0466709_338581_5872_6651 259
83 3300042652 Ga0466708_293095 Ga0466708_293095_1249_2028 259
84 3300002449 JGI24698J34947_10007827 JGI24698J34947_100078277 260
85 3300010167 Ga0123353_10942033 Ga0123353_109420332 260
86 3300042590 Ga0466690_029701 Ga0466690_029701_5899_6681 260
87 3300042591 Ga0466692_172967 Ga0466692_172967_12243_13025 260
88 3300042593 Ga0466691_101246 Ga0466691_101246_3286_4068 260
89 3300042606 Ga0466719_479516 Ga0466719_479516_829_1611 260
90 3300042615 Ga0466711_513350 Ga0466711_513350_238_1020 260
91 3300042616 Ga0466715_288828 Ga0466715_288828_7484_8266 260
92 3300042617 Ga0466718_121824 Ga0466718_121824_540_1322 260
93 3300042618 Ga0466723_175652 Ga0466723_175652_21045_21827 260
94 3300042619 Ga0466726_409579 Ga0466726_409579_1893_2675 260
95 3300042621 Ga0466729_134072 Ga0466729_134072_1793_2575 260
96 3300042624 Ga0466735_073363 Ga0466735_073363_2184_2966 260
97 3300042624 Ga0466735_173989 Ga0466735_173989_1320_2102 260
98 iso_pr_bacteria 650716102 650881987 260
99 3300042643 Ga0466704_408972 Ga0466704_408972_9128_9913 261
100 3300042655 Ga0466727_318695 Ga0466727_318695_1881_2666 261
101 3300042621 Ga0466729_232740 Ga0466729_232740_35_823 262
102 3300042643 Ga0466704_229062 Ga0466704_229062_9201_9989 262
103 3300042621 Ga0466729_170719 Ga0466729_170719_120_911 263
104 3300010882 Ga0123354_10035153 Ga0123354_100351538 264
105 3300042604 Ga0466717_289486 Ga0466717_289486_156_950 264
106 3300042614 Ga0466712_159988 Ga0466712_159988_51_845 264
107 3300042614 Ga0466712_322017 Ga0466712_322017_11126_11920 264
108 3300002449 JGI24698J34947_10056056 JGI24698J34947_100560561 265
109 3300042606 Ga0466719_097142 Ga0466719_097142_5442_6239 265
110 3300042620 Ga0466728_254550 Ga0466728_254550_5074_5871 265
111 3300042654 Ga0466725_394106 Ga0466725_394106_725_1522 265
112 3300042609 Ga0466722_198809 Ga0466722_198809_4242_5042 266
113 3300042600 Ga0466700_181380 Ga0466700_181380_228_1031 267
114 3300042605 Ga0466716_296428 Ga0466716_296428_379_1182 267
115 3300042606 Ga0466719_331741 Ga0466719_331741_2830_3636 268
116 3300009784 Ga0123357_10247435 Ga0123357_102474351 271
117 3300042615 Ga0466711_163751 Ga0466711_163751_2642_3460 272
118 3300042619 Ga0466726_056722 Ga0466726_056722_8041_8928 277
119 3300042616 Ga0466715_425219 Ga0466715_425219_2259_3110 283
120 3300042602 Ga0466713_106285 Ga0466713_106285_1171_2028 285
121 3300042614 Ga0466712_277646 Ga0466712_277646_16_876 286
122 3300002449 JGI24698J34947_10100083 JGI24698J34947_101000831 289
123 3300042612 Ga0466705_062368 Ga0466705_062368_444_1319 291
124 3300042610 Ga0466698_449876 Ga0466698_449876_168_1067 299
125 3300042648 Ga0466709_144763 Ga0466709_144763_883_1794 303

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 48 290 0.8

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03372 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.