Protein Family IF06957

Metagenome Isolate
189 Members
56 Samples
182 Scaffolds
270.6 Avg Length

🧬 Representative Sequence

ID
3300042610|Ga0466698_399737|Ga0466698_399737_233_1123
Length
296 aa
Sequence
LELPAAWKNVFHPENNMGDVQKTNPLSLIVMYAIVILFTLLAVYPIFWLIIQSFKTTQDYMLNSKLAFPVRWFFRNYPISWRTGRFSMLILNSIFYTSVTVVSIIILSFMAGFAFAKLPSKLTPILHGSFIIGILLTLQSILVPLFLMINATGLYNTRLGVLIPYIGIGLPFGIYLSTEYIKGIPDSVIESARIDGAKYLRIFRSIIMPIASPVAVTVAILSITGTWNEFMLINILVSKNELKSLPVGINMFSGALASDFGKQFAALVIGMTPMIIFYLIFRKRITEGVSAGAVKG

📊 Sample Types

Isolate 3.7%
Metagenome 96.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.3%
Kalotermitidae 26.4%
Unclassified 15.1%
Rhinotermitidae 7.5%
Termopsidae 3.8%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 173
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
12 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
17 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
18 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
19 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
26 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
36 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
37 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
38 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 650716102 Treponema primitia ZAS-2 Isolate Unclassified
43 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
44 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
45 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
46 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
47 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
48 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
49 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
50 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
51 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
52 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
53 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
54 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
55 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
56 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_100669 3300024493 Bacteria 11782
2 Ga0264413_103860 3300024493 Bacteria 1728
3 Ga0456237_0004735 3300041968 Bacteria 2179
4 Ga0466694_171604 3300042594 Bacteria 2147
5 Ga0466695_009302 3300042595 Bacteria 3067
6 Ga0466699_084347 3300042597 Bacteria 4286
7 AustNasuHG_c1022283 3300000089 Bacteria 2037
8 Ga0072940_1013272 3300005200 Bacteria 4799
9 Ga0072940_1048695 3300005200 Bacteria 4774
10 Ga0072941_1079045 3300005201 Bacteria 4894
11 Ga0074263_100055 3300005485 Bacteria 4319
12 Ga0466718_050603 3300042617 Bacteria 8779
13 Ga0466718_087308 3300042617 Bacteria 2122
14 Ga0466726_416440 3300042619 Bacteria 3379
15 Ga0466719_057956 3300042606 Bacteria 5521
16 Ga0466720_134722 3300042607 Unclassified 2349
17 Ga0466722_049172 3300042609 Bacteria 5084
18 Ga0264413_109002 3300024493 Bacteria 2681
19 Ga0466690_082299 3300042590 Bacteria 4325
20 Ga0466692_126050 3300042591 Bacteria 5112
21 Ga0466696_099173 3300042596 Bacteria 2471
22 Ga0466699_110972 3300042597 Bacteria 2115
23 JGI24698J34947_10004930 3300002449 Bacteria 7314
24 Ga0074263_117579 3300005485 Bacteria 3473
25 Ga0123357_10096099 3300009784 Bacteria 3838
26 Ga0466712_038130 3300042614 Bacteria 20446
27 Ga0466712_287775 3300042614 Unclassified 2124
28 Ga0466711_168556 3300042615 Bacteria 55422
29 Ga0466718_063445 3300042617 Bacteria 5746
30 Ga0466718_161422 3300042617 Bacteria 1489
31 Ga0466718_168645 3300042617 Unclassified 2932
32 Ga0466723_136078 3300042618 Unclassified 3483
33 Ga0466726_158587 3300042619 Bacteria 1283
34 Ga0466729_081703 3300042621 Bacteria 4095
35 Ga0466707_100992 3300042601 Bacteria 1119
36 Ga0466722_031182 3300042609 Bacteria 24727
37 Ga0466722_076388 3300042609 Bacteria 12202
38 Ga0466698_359291 3300042610 Bacteria 2415
39 Ga0466698_399737 3300042610 Bacteria 1202
40 Ga0466703_103808 3300042636 Bacteria 65741
41 Ga0466703_127939 3300042636 Bacteria 32645
42 Ga0466704_491957 3300042643 Unclassified 16412
43 Ga0466727_006127 3300042655 Unclassified 1483
44 Ga0466705_258627 3300042612 Bacteria 11727
45 Ga0466732_297193 3300042656 Bacteria 1498
46 Ga0466692_132530 3300042591 Bacteria 37722
47 Ga0466694_204632 3300042594 Bacteria 1136
48 Ga0466699_032243 3300042597 Bacteria 1531
49 AustNasuHG_c1014616 3300000089 Bacteria 2663
50 FAAS_10001194 3300001880 Bacteria 1316
51 JGI24695J34938_10002921 3300002450 Bacteria 12393
52 JGI24695J34938_10034526 3300002450 Bacteria 2320
53 JGI24702J35022_10003924 3300002462 Bacteria 8934
54 Ga0466711_153381 3300042615 Bacteria 4299
55 Ga0466715_233938 3300042616 Bacteria 9949
56 Ga0466718_116625 3300042617 Bacteria 1304
57 Ga0466726_252469 3300042619 Bacteria 3451
58 Ga0466726_375182 3300042619 Bacteria 15101
59 Ga0466728_115492 3300042620 Bacteria 18751
60 Ga0466717_124266 3300042604 Bacteria 1431
61 Ga0466720_066785 3300042607 Bacteria 1630
62 Ga0466703_135579 3300042636 Bacteria 3347
63 Ga0466727_235174 3300042655 Bacteria 3608
64 Ga0466705_186256 3300042612 Bacteria 7882
65 Ga0466705_287101 3300042612 Bacteria 1981
66 Ga0466732_116533 3300042656 Bacteria 17693
67 Ga0466732_180358 3300042656 Bacteria 8804
68 Ga0264413_101312 3300024493 Unclassified 1803
69 Ga0264413_103379 3300024493 Bacteria 13508
70 Ga0466692_068135 3300042591 Bacteria 6741
71 Ga0466692_119438 3300042591 Bacteria 8628
72 Ga0466694_056937 3300042594 Bacteria 11086
73 Ga0466694_068198 3300042594 Bacteria 4530
74 Ga0466694_094882 3300042594 Bacteria 23179
75 Ga0466694_129519 3300042594 Bacteria 58319
76 Ga0466696_329665 3300042596 Bacteria 5604
77 Ga0466699_053666 3300042597 Bacteria 30730
78 Ga0123355_10301200 3300009826 Bacteria 2185
79 Ga0123353_10267239 3300010167 Bacteria 2638
80 Ga0123354_10159503 3300010882 Bacteria 2686
81 Ga0466718_054887 3300042617 Bacteria 4312
82 Ga0466718_086776 3300042617 Bacteria 73105
83 Ga0466716_338181 3300042605 Unclassified 3006
84 Ga0466720_026033 3300042607 Bacteria 10333
85 Ga0466720_066832 3300042607 Bacteria 7301
86 Ga0466720_177676 3300042607 Bacteria 91443
87 Ga0466729_205711 3300042621 Bacteria 1777
88 Ga0466731_317119 3300042622 Bacteria 2529
89 Ga0466704_055479 3300042643 Bacteria 4734
90 Ga0466704_255539 3300042643 Unclassified 5126
91 Ga0466727_141018 3300042655 Unclassified 4296
92 Ga0466733_149869 3300042659 Bacteria 8387
93 Ga0264413_101054 3300024493 Bacteria 8808
94 Ga0466694_123668 3300042594 Bacteria 5234
95 Ga0466696_116969 3300042596 Bacteria 15796
96 Ga0466696_138975 3300042596 Bacteria 11995
97 Ga0466696_320714 3300042596 Bacteria 5700
98 Ga0466699_007467 3300042597 Bacteria 1680
99 JGI24698J34947_10001108 3300002449 Bacteria 13893
100 JGI24698J34947_10113697 3300002449 Bacteria 1189
101 Ga0072940_1012970 3300005200 Bacteria 4554
102 Ga0072941_1011361 3300005201 Unclassified 12960
103 Ga0123355_10377151 3300009826 Bacteria 1852
104 Ga0466705_430412 3300042612 Bacteria 8024
105 Ga0466711_193435 3300042615 Bacteria 6203
106 Ga0466718_051125 3300042617 Bacteria 2584
107 Ga0466718_169367 3300042617 Bacteria 3306
108 Ga0466726_345518 3300042619 Bacteria 5130
109 Ga0466706_160403 3300042599 Bacteria 2741
110 Ga0466707_299843 3300042601 Bacteria 2821
111 Ga0466722_016217 3300042609 Bacteria 6001
112 Ga0466722_168172 3300042609 Bacteria 11643
113 Ga0466704_477217 3300042643 Unclassified 3107
114 Ga0466708_278449 3300042652 Bacteria 1659
115 Ga0466727_051430 3300042655 Bacteria 4955
116 Ga0466705_124471 3300042612 Bacteria 5503
117 Ga0466705_365475 3300042612 Unclassified 4239
118 Ga0466732_339398 3300042656 Bacteria 6768
119 Ga0264413_111445 3300024493 Bacteria 14584
120 Ga0466690_317756 3300042590 Bacteria 2185
121 Ga0466692_140083 3300042591 Bacteria 1405
122 Ga0466692_191616 3300042591 Bacteria 5418
123 Ga0466691_144782 3300042593 Bacteria 35149
124 Ga0466694_026216 3300042594 Bacteria 44731
125 Ga0466694_112784 3300042594 Bacteria 5965
126 AustNasuHG_c1016683 3300000089 Bacteria 2451
127 JGI24695J34938_10015390 3300002450 Bacteria 3926
128 JGI24695J34938_10043288 3300002450 Bacteria 2010
129 JGI24702J35022_10022212 3300002462 Bacteria 3437
130 Ga0072940_1029704 3300005200 Bacteria 3870
131 Ga0072941_1002224 3300005201 Bacteria 13116
132 Ga0072941_1020810 3300005201 Bacteria 8497
133 Ga0466723_316341 3300042618 Bacteria 37580
134 Ga0466726_030432 3300042619 Bacteria 24294
135 Ga0466726_492116 3300042619 Bacteria 1222
136 Ga0466728_337747 3300042620 Bacteria 3381
137 Ga0466720_115810 3300042607 Bacteria 4956
138 Ga0466720_123370 3300042607 Unclassified 1873
139 Ga0466722_081140 3300042609 Bacteria 1937
140 Ga0466722_160996 3300042609 Bacteria 18974
141 Ga0466698_073174 3300042610 Bacteria 1082
142 Ga0466698_405094 3300042610 Bacteria 1013
143 Ga0466729_310769 3300042621 Bacteria 1383
144 Ga0466704_222278 3300042643 Bacteria 19727
145 Ga0466708_027263 3300042652 Bacteria 15744
146 Ga0466708_079819 3300042652 Bacteria 8102
147 Ga0466694_229662 3300042594 Bacteria 2102
148 Ga0466699_257370 3300042597 Bacteria 15379
149 Ga0466699_423054 3300042597 Bacteria 1385
150 AustNasuHG_c1019031 3300000089 Bacteria 2259
151 JGI24698J34947_10079713 3300002449 Bacteria 1541
152 JGI24699J35502_11119610 3300002509 Bacteria 3183
153 Ga0072941_1023219 3300005201 Bacteria 4863
154 Ga0466711_100751 3300042615 Bacteria 5891
155 Ga0466715_178499 3300042616 Bacteria 3756
156 Ga0466718_060989 3300042617 Unclassified 3908
157 Ga0466726_166302 3300042619 Bacteria 4735
158 Ga0466706_195116 3300042599 Bacteria 1215
159 Ga0466720_200781 3300042607 Bacteria 10651
160 Ga0466698_168009 3300042610 Bacteria 41165
161 Ga0466703_046388 3300042636 Bacteria 22730
162 Ga0466703_422496 3300042636 Bacteria 1451
163 Ga0466709_127137 3300042648 Bacteria 4654
164 Ga0466708_104918 3300042652 Bacteria 2222
165 Ga0466732_206149 3300042656 Bacteria 1592
166 Ga0466733_131762 3300042659 Bacteria 13323
167 Ga0466694_169470 3300042594 Bacteria 10079
168 Ga0466699_142247 3300042597 Bacteria 1628
169 JGI24702J35022_10024968 3300002462 Bacteria 3227
170 JGI24697J35500_11160685 3300002507 Unclassified 1400
171 Ga0072940_1235995 3300005200 Bacteria 5744
172 Ga0123353_10139590 3300010167 Bacteria 3883
173 Ga0466705_507463 3300042612 Bacteria 1614
174 Ga0466712_157243 3300042614 Bacteria 2042
175 Ga0466715_524769 3300042616 Bacteria 17670
176 Ga0466718_121786 3300042617 Bacteria 1811
177 Ga0466726_243121 3300042619 Bacteria 2175
178 Ga0466728_307899 3300042620 Bacteria 8199
179 Ga0466707_095176 3300042601 Bacteria 6288
180 Ga0466714_040238 3300042603 Bacteria 13182
181 Ga0466704_357625 3300042643 Bacteria 5482
182 Ga0466709_055220 3300042648 Bacteria 12997

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000089 AustNasuHG_c1016683 AustNasuHG_10166833 239
2 3300042591 Ga0466692_140083 Ga0466692_140083_69_869 245
3 3300042597 Ga0466699_053666 Ga0466699_053666_23901_24695 245
4 3300042607 Ga0466720_026033 Ga0466720_026033_2736_3578 245
5 3300009784 Ga0123357_10096099 Ga0123357_100960993 247
6 3300009826 Ga0123355_10377151 Ga0123355_103771512 247
7 3300042652 Ga0466708_079819 Ga0466708_079819_2816_3655 247
8 3300042617 Ga0466718_060989 Ga0466718_060989_1021_1806 248
9 3300005201 Ga0072941_1079045 Ga0072941_10790453 251
10 3300042607 Ga0466720_134722 Ga0466720_134722_405_1244 251
11 3300042609 Ga0466722_016217 Ga0466722_016217_2649_3491 251
12 3300024493 Ga0264413_100669 Ga0264413_1006693 252
13 3300024493 Ga0264413_103379 Ga0264413_1033794 253
14 3300024493 Ga0264413_109002 Ga0264413_1090023 253
15 3300042594 Ga0466694_056937 Ga0466694_056937_6506_7306 253
16 3300042607 Ga0466720_177676 Ga0466720_177676_17978_18778 253
17 3300042619 Ga0466726_252469 Ga0466726_252469_2496_3335 253
18 3300042620 Ga0466728_307899 Ga0466728_307899_1621_2472 253
19 3300042594 Ga0466694_171604 Ga0466694_171604_491_1291 255
20 3300042636 Ga0466703_127939 Ga0466703_127939_1053_1892 255
21 3300002450 JGI24695J34938_10043288 JGI24695J34938_100432881 256
22 3300042656 Ga0466732_206149 Ga0466732_206149_118_891 257
23 3300002450 JGI24695J34938_10002921 JGI24695J34938_100029214 258
24 3300002450 JGI24695J34938_10034526 JGI24695J34938_100345263 258
25 3300042609 Ga0466722_049172 Ga0466722_049172_1652_2494 258
26 3300042612 Ga0466705_258627 Ga0466705_258627_2594_3436 258
27 3300009826 Ga0123355_10301200 Ga0123355_103012002 259
28 3300042597 Ga0466699_257370 Ga0466699_257370_8879_9688 259
29 3300042619 Ga0466726_416440 Ga0466726_416440_2204_3043 261
30 3300002449 JGI24698J34947_10001108 JGI24698J34947_100011083 262
31 3300041968 Ga0456237_0004735 Ga0456237_0004735_1286_2128 262
32 3300042593 Ga0466691_144782 Ga0466691_144782_29586_30374 262
33 3300042599 Ga0466706_195116 Ga0466706_195116_171_959 262
34 3300042610 Ga0466698_073174 Ga0466698_073174_26_814 262
35 3300042612 Ga0466705_287101 Ga0466705_287101_1042_1830 262
36 3300042612 Ga0466705_365475 Ga0466705_365475_3091_3879 262
37 3300042612 Ga0466705_430412 Ga0466705_430412_663_1451 262
38 3300042615 Ga0466711_193435 Ga0466711_193435_1776_2564 262
39 3300042616 Ga0466715_233938 Ga0466715_233938_4517_5305 262
40 3300042643 Ga0466704_055479 Ga0466704_055479_20_808 262
41 3300042643 Ga0466704_255539 Ga0466704_255539_1423_2211 262
42 3300042643 Ga0466704_491957 Ga0466704_491957_6958_7746 262
43 3300042648 Ga0466709_055220 Ga0466709_055220_8120_8908 262
44 3300042655 Ga0466727_006127 Ga0466727_006127_41_829 262
45 3300042601 Ga0466707_100992 Ga0466707_100992_19_810 263
46 3300005201 Ga0072941_1011361 Ga0072941_10113615 264
47 3300042594 Ga0466694_129519 Ga0466694_129519_50949_51791 264
48 3300042597 Ga0466699_084347 Ga0466699_084347_2598_3449 264
49 3300042609 Ga0466722_081140 Ga0466722_081140_840_1634 264
50 3300042643 Ga0466704_222278 Ga0466704_222278_17878_18720 264
51 3300005485 Ga0074263_100055 Ga0074263_1000552 265
52 3300042636 Ga0466703_103808 Ga0466703_103808_22309_23151 265
53 3300000089 AustNasuHG_c1019031 AustNasuHG_10190312 266
54 3300005200 Ga0072940_1013272 Ga0072940_10132724 266
55 3300005201 Ga0072941_1002224 Ga0072941_10022245 266
56 3300024493 Ga0264413_111445 Ga0264413_1114453 266
57 3300042594 Ga0466694_094882 Ga0466694_094882_15502_16302 266
58 3300042594 Ga0466694_169470 Ga0466694_169470_6727_7527 266
59 3300042594 Ga0466694_204632 Ga0466694_204632_196_996 266
60 3300042596 Ga0466696_329665 Ga0466696_329665_270_1112 266
61 3300042597 Ga0466699_142247 Ga0466699_142247_170_970 266
62 3300042610 Ga0466698_359291 Ga0466698_359291_1418_2260 266
63 3300042614 Ga0466712_287775 Ga0466712_287775_390_1232 266
64 3300042615 Ga0466711_168556 Ga0466711_168556_36141_36983 266
65 3300042616 Ga0466715_178499 Ga0466715_178499_1524_2324 266
66 3300042643 Ga0466704_477217 Ga0466704_477217_338_1138 266
67 3300042652 Ga0466708_104918 Ga0466708_104918_112_912 266
68 3300042655 Ga0466727_141018 Ga0466727_141018_452_1291 266
69 3300042656 Ga0466732_116533 Ga0466732_116533_153_953 266
70 3300042656 Ga0466732_297193 Ga0466732_297193_139_939 266
71 3300002462 JGI24702J35022_10003924 JGI24702J35022_100039243 267
72 3300002507 JGI24697J35500_11160685 JGI24697J35500_111606852 267
73 3300042607 Ga0466720_123370 Ga0466720_123370_838_1680 267
74 3300042610 Ga0466698_405094 Ga0466698_405094_116_958 267
75 3300042617 Ga0466718_063445 Ga0466718_063445_4560_5402 267
76 3300042619 Ga0466726_243121 Ga0466726_243121_1028_1867 267
77 3300042636 Ga0466703_135579 Ga0466703_135579_122_958 267
78 3300002462 JGI24702J35022_10022212 JGI24702J35022_100222123 268
79 3300024493 Ga0264413_101054 Ga0264413_1010545 268
80 3300042591 Ga0466692_126050 Ga0466692_126050_2848_3687 268
81 3300042594 Ga0466694_068198 Ga0466694_068198_3323_4165 268
82 3300042597 Ga0466699_423054 Ga0466699_423054_348_1226 268
83 3300042656 Ga0466732_180358 Ga0466732_180358_4108_4950 268
84 3300042594 Ga0466694_026216 Ga0466694_026216_21839_22681 269
85 3300042597 Ga0466699_007467 Ga0466699_007467_756_1607 269
86 3300042607 Ga0466720_115810 Ga0466720_115810_1163_2005 269
87 3300042610 Ga0466698_168009 Ga0466698_168009_19800_20642 269
88 3300042652 Ga0466708_027263 Ga0466708_027263_8647_9489 269
89 3300002450 JGI24695J34938_10015390 JGI24695J34938_100153902 270
90 3300042594 Ga0466694_112784 Ga0466694_112784_1821_2663 270
91 3300042597 Ga0466699_110972 Ga0466699_110972_22_834 270
92 3300042619 Ga0466726_345518 Ga0466726_345518_2892_3734 270
93 3300042620 Ga0466728_115492 Ga0466728_115492_2851_3693 270
94 3300024493 Ga0264413_101312 Ga0264413_1013123 271
95 3300042609 Ga0466722_076388 Ga0466722_076388_2211_3053 271
96 3300042617 Ga0466718_168645 Ga0466718_168645_66_908 271
97 3300042620 Ga0466728_337747 Ga0466728_337747_2224_3066 271
98 3300042621 Ga0466729_310769 Ga0466729_310769_391_1233 271
99 3300042591 Ga0466692_191616 Ga0466692_191616_2526_3368 273
100 3300042607 Ga0466720_066785 Ga0466720_066785_95_937 273
101 3300042618 Ga0466723_316341 Ga0466723_316341_10786_11628 274
102 3300005200 Ga0072940_1029704 Ga0072940_10297044 275
103 3300042617 Ga0466718_050603 Ga0466718_050603_7699_8541 275
104 3300005201 Ga0072941_1023219 Ga0072941_10232193 276
105 3300042603 Ga0466714_040238 Ga0466714_040238_1534_2385 277
106 3300042617 Ga0466718_086776 Ga0466718_086776_69621_70484 277
107 3300042595 Ga0466695_009302 Ga0466695_009302_2120_2977 278
108 3300042590 Ga0466690_082299 Ga0466690_082299_1409_2248 279
109 3300042591 Ga0466692_068135 Ga0466692_068135_1456_2295 279
110 3300042591 Ga0466692_119438 Ga0466692_119438_3532_4371 279
111 3300042596 Ga0466696_320714 Ga0466696_320714_3939_4778 279
112 3300042599 Ga0466706_160403 Ga0466706_160403_1348_2187 279
113 3300042604 Ga0466717_124266 Ga0466717_124266_275_1114 279
114 3300042609 Ga0466722_031182 Ga0466722_031182_17379_18218 279
115 3300042612 Ga0466705_186256 Ga0466705_186256_299_1138 279
116 3300042615 Ga0466711_100751 Ga0466711_100751_3957_4796 279
117 3300042617 Ga0466718_087308 Ga0466718_087308_66_905 279
118 3300042619 Ga0466726_158587 Ga0466726_158587_72_911 279
119 3300042619 Ga0466726_166302 Ga0466726_166302_2736_3575 279
120 3300042619 Ga0466726_492116 Ga0466726_492116_30_869 279
121 3300042622 Ga0466731_317119 Ga0466731_317119_1621_2460 279
122 3300042636 Ga0466703_046388 Ga0466703_046388_9944_10783 279
123 3300042655 Ga0466727_051430 Ga0466727_051430_505_1344 279
124 3300042655 Ga0466727_235174 Ga0466727_235174_1088_1927 279
125 iso_pr_bacteria 650716102 650883102 279
126 3300000089 AustNasuHG_c1022283 AustNasuHG_10222832 280
127 3300005200 Ga0072940_1235995 Ga0072940_12359953 280
128 3300010167 Ga0123353_10267239 Ga0123353_102672393 280
129 3300024493 Ga0264413_103860 Ga0264413_1038602 280
130 3300042590 Ga0466690_317756 Ga0466690_317756_105_947 280
131 3300042591 Ga0466692_132530 Ga0466692_132530_8410_9252 280
132 3300042594 Ga0466694_123668 Ga0466694_123668_1305_2147 280
133 3300042594 Ga0466694_229662 Ga0466694_229662_863_1705 280
134 3300042596 Ga0466696_099173 Ga0466696_099173_614_1456 280
135 3300042596 Ga0466696_116969 Ga0466696_116969_6751_7593 280
136 3300042596 Ga0466696_138975 Ga0466696_138975_2731_3573 280
137 3300042601 Ga0466707_095176 Ga0466707_095176_1468_2310 280
138 3300042601 Ga0466707_299843 Ga0466707_299843_1734_2576 280
139 3300042605 Ga0466716_338181 Ga0466716_338181_1450_2292 280
140 3300042606 Ga0466719_057956 Ga0466719_057956_4641_5483 280
141 3300042607 Ga0466720_066832 Ga0466720_066832_5133_5975 280
142 3300042607 Ga0466720_200781 Ga0466720_200781_1262_2104 280
143 3300042609 Ga0466722_160996 Ga0466722_160996_13684_14526 280
144 3300042609 Ga0466722_168172 Ga0466722_168172_8021_8863 280
145 3300042612 Ga0466705_124471 Ga0466705_124471_4159_5001 280
146 3300042612 Ga0466705_507463 Ga0466705_507463_524_1366 280
147 3300042614 Ga0466712_038130 Ga0466712_038130_4615_5457 280
148 3300042614 Ga0466712_157243 Ga0466712_157243_626_1468 280
149 3300042615 Ga0466711_153381 Ga0466711_153381_3039_3881 280
150 3300042616 Ga0466715_524769 Ga0466715_524769_14556_15398 280
151 3300042617 Ga0466718_054887 Ga0466718_054887_962_1804 280
152 3300042617 Ga0466718_116625 Ga0466718_116625_304_1146 280
153 3300042617 Ga0466718_121786 Ga0466718_121786_17_859 280
154 3300042617 Ga0466718_161422 Ga0466718_161422_410_1252 280
155 3300042617 Ga0466718_169367 Ga0466718_169367_292_1134 280
156 3300042618 Ga0466723_136078 Ga0466723_136078_253_1095 280
157 3300042619 Ga0466726_030432 Ga0466726_030432_8746_9588 280
158 3300042619 Ga0466726_375182 Ga0466726_375182_2900_3742 280
159 3300042621 Ga0466729_081703 Ga0466729_081703_845_1687 280
160 3300042621 Ga0466729_205711 Ga0466729_205711_154_996 280
161 3300042636 Ga0466703_422496 Ga0466703_422496_154_996 280
162 3300042643 Ga0466704_357625 Ga0466704_357625_1702_2544 280
163 3300042648 Ga0466709_127137 Ga0466709_127137_860_1702 280
164 3300042652 Ga0466708_278449 Ga0466708_278449_122_964 280
165 3300042656 Ga0466732_339398 Ga0466732_339398_1444_2286 280
166 iso_pr_bacteria 2781125634 2781275474 280
167 iso_pr_bacteria 2781125651 2781309621 280
168 iso_pr_bacteria 2781125687 2781422287 280
169 iso_pr_bacteria 2781125689 2781425141 280
170 iso_pr_bacteria 2781125696 2781441714 280
171 iso_pr_bacteria 2781125697 2781443842 280
172 3300000089 AustNasuHG_c1014616 AustNasuHG_10146163 281
173 3300001880 FAAS_10001194 FAAS_100011942 281
174 3300002449 JGI24698J34947_10004930 JGI24698J34947_100049306 281
175 3300002449 JGI24698J34947_10079713 JGI24698J34947_100797132 281
176 3300002449 JGI24698J34947_10113697 JGI24698J34947_101136972 281
177 3300002462 JGI24702J35022_10024968 JGI24702J35022_100249682 281
178 3300002509 JGI24699J35502_11119610 JGI24699J35502_111196102 281
179 3300005200 Ga0072940_1012970 Ga0072940_10129704 281
180 3300005485 Ga0074263_117579 Ga0074263_1175792 281
181 3300010167 Ga0123353_10139590 Ga0123353_101395904 281
182 3300010882 Ga0123354_10159503 Ga0123354_101595032 281
183 3300042617 Ga0466718_051125 Ga0466718_051125_820_1665 281
184 3300005200 Ga0072940_1048695 Ga0072940_10486955 282
185 3300042659 Ga0466733_131762 Ga0466733_131762_4194_5045 283
186 3300042659 Ga0466733_149869 Ga0466733_149869_6425_7276 283
187 3300005201 Ga0072941_1020810 Ga0072941_10208108 284
188 3300042597 Ga0466699_032243 Ga0466699_032243_64_954 286
189 3300042610 Ga0466698_399737 Ga0466698_399737_233_1123 296

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 109 283 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.