Protein Family IF06956
Metagenome
Isolate
340
Members
187
Samples
241
Scaffolds
293.02
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_399543|Ga0466698_399543_1257_2318
- Length
- 353 aa
- Sequence
- VKLCITVCKRSAAYGKKQKAAKSRRKNLTALPLKGVGGMFLSQKSTHNISPPTAFIKKIKQNHIRMKGIILAGGSGTRLHPLTLAMSKQLMPIYDKPMIYYPLSVLITAGIREILIISTPQDLPNFEKMLGSGEQIGCSFSYKVQHVPNGLAQAFVLGEEFIGNEKVCLVLGDNIFYGSGFDKSLKSCNNPDGGIVFAYHVNDPERYGVVEFDKDFNALSIEEKPLKPKSHYAVPGLYFYDNSVVEVAKNIQPSARGEYEITDVNKYYLEKNKLKVSILERGTAWLDTGTFKSLIEAAQYVQVIEDRQGKKIGCIEECAYEQGFINAEQLENIATPLLKSGYGKYLMSLIEKD
Sample Types
Isolate
29.1%
Metagenome
70.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Drosophilidae
20.3%
Unclassified
19.2%
Termitidae
16.3%
Kalotermitidae
8.1%
Apidae
7.6%
Formicidae
5.2%
Tenebrionidae
4.1%
Culicidae
3.5%
Armadillidiidae
3.5%
Rhinotermitidae
2.3%
Termopsidae
1.7%
Elmidae
1.7%
Daphniidae
1.2%
Scarabaeidae
1.2%
Passalidae
1.2%
Hodotermitidae
0.6%
Nephropidae
0.6%
Bombycidae
0.6%
Aphididae
0.6%
Hydrophilidae
0.6%
Taxonomy
Archaea
0
Bacteria
325
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 2 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 3 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 4 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 5 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 6 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 7 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 8 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 9 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 12 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 13 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 14 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 15 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 23 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 24 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 25 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 28 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 29 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 34 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 35 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 36 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 37 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 38 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 39 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 40 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 41 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 42 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 43 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 44 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 45 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 46 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 47 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 50 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 51 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 52 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 53 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 54 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 55 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 56 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 57 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 58 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 59 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 60 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 61 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 62 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 67 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 68 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 69 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 70 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 71 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 72 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 73 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 74 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 75 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 76 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 77 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 78 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 79 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 80 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 81 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 82 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 83 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 84 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 85 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 86 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 87 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 88 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 89 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 90 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 91 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 92 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 93 | 2820403592 | Unclassified Firmicutes Lab288P4bin93 | Isolate | Unclassified |
| 94 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 95 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 96 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 97 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 98 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 99 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 100 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 101 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 102 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 103 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 104 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 105 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 106 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 107 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 108 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 109 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 110 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 111 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 112 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 113 | 2585427698 | Occidentia massiliensis OS118 | Isolate | Unclassified |
| 114 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 115 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 116 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 117 | 2843073756 | Oecophyllibacter saccharovorans Jb2 | Isolate | Formicidae |
| 118 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 119 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 120 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 121 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 122 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 123 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 124 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 125 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 126 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 127 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 128 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 129 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 130 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 131 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 132 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 133 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 134 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 135 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 136 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 137 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 138 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 139 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 140 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 141 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 142 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 143 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 144 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 145 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 146 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 147 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 148 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 149 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 150 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 151 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 152 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 153 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 154 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 155 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 156 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 157 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 158 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 159 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 160 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 161 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 162 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 163 | 2820070515 | Unclassified Proteobacteria Nt197P3bin137 | Isolate | Unclassified |
| 164 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 165 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 166 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 167 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 168 | 2837008993 | Oecophyllibacter saccharovorans Ta1 | Isolate | Formicidae |
| 169 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 170 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 171 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 172 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 173 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 174 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 175 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 176 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 177 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 178 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 179 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 180 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 181 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 182 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 183 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 184 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 185 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 186 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 187 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_060312 | 3300042611 | Unclassified | 2105 |
| 2 | Ga0466705_152589 | 3300042612 | Bacteria | 5341 |
| 3 | Ga0562375_0062 | 3300056856 | Bacteria | 424406 |
| 4 | Ga0466729_309503 | 3300042621 | Bacteria | 12683 |
| 5 | Ga0466703_300979 | 3300042636 | Bacteria | 3341 |
| 6 | Ga0466709_335259 | 3300042648 | Bacteria | 23807 |
| 7 | Ga0466724_25707 | 3300042649 | Bacteria | 20045 |
| 8 | Ga0466712_132327 | 3300042614 | Bacteria | 3621 |
| 9 | Ga0466715_391574 | 3300042616 | Bacteria | 47321 |
| 10 | Ga0466728_004312 | 3300042620 | Bacteria | 17173 |
| 11 | Ga0466693_226589 | 3300042592 | Bacteria | 1625 |
| 12 | Ga0466691_120902 | 3300042593 | Bacteria | 35416 |
| 13 | Ga0123355_10037712 | 3300009826 | Bacteria | 7859 |
| 14 | Ga0123356_10844527 | 3300010049 | Bacteria | 1087 |
| 15 | Ga0123353_10326615 | 3300010167 | Unclassified | 2325 |
| 16 | Ga0123353_10395990 | 3300010167 | Bacteria | 2058 |
| 17 | Ga0160465_100031 | 3300012803 | Bacteria | 200207 |
| 18 | Ga0160464_100287 | 3300012805 | Bacteria | 44496 |
| 19 | Ga0466701_090323 | 3300042598 | Bacteria | 3745 |
| 20 | Ga0466707_024038 | 3300042601 | Bacteria | 50351 |
| 21 | Ga0466714_045948 | 3300042603 | Bacteria | 10759 |
| 22 | Ga0466722_041659 | 3300042609 | Bacteria | 4383 |
| 23 | Ga0072941_1073964 | 3300005201 | Bacteria | 5302 |
| 24 | Ga0072941_1073965 | 3300005201 | Unclassified | 1328 |
| 25 | Ga0104045_1001726 | 3300007085 | Bacteria | 8597 |
| 26 | Ga0102740_1000227 | 3300007140 | Bacteria | 16248 |
| 27 | Ga0104048_1022222 | 3300007143 | Bacteria | 6227 |
| 28 | Ga0466724_60511 | 3300042649 | Bacteria | 10953 |
| 29 | Ga0466708_405482 | 3300042652 | Bacteria | 19950 |
| 30 | Ga0466725_093969 | 3300042654 | Bacteria | 5160 |
| 31 | Ga0466711_074367 | 3300042615 | Bacteria | 8581 |
| 32 | Ga0466711_078849 | 3300042615 | Bacteria | 2516 |
| 33 | Ga0466728_173110 | 3300042620 | Bacteria | 17804 |
| 34 | Ga0160443_100011 | 3300012848 | Bacteria | 464596 |
| 35 | Ga0415639_006384 | 3300038395 | Bacteria | 18820 |
| 36 | Ga0466657_153013 | 3300042582 | Bacteria | 3508 |
| 37 | Ga0466657_334239 | 3300042582 | Bacteria | 17784 |
| 38 | Ga0466691_023594 | 3300042593 | Bacteria | 16897 |
| 39 | Ga0466695_290486 | 3300042595 | Bacteria | 5398 |
| 40 | Ga0466696_220668 | 3300042596 | Bacteria | 2273 |
| 41 | Ga0466696_423762 | 3300042596 | Bacteria | 3410 |
| 42 | Ga0123355_10075178 | 3300009826 | Bacteria | 5408 |
| 43 | Ga0123356_10196594 | 3300010049 | Bacteria | 2053 |
| 44 | Ga0123353_10012850 | 3300010167 | Bacteria | 11942 |
| 45 | Ga0123353_10251508 | 3300010167 | Bacteria | 2736 |
| 46 | Ga0466701_093289 | 3300042598 | Bacteria | 14763 |
| 47 | Ga0466701_094256 | 3300042598 | Bacteria | 22262 |
| 48 | Ga0466719_206380 | 3300042606 | Bacteria | 8205 |
| 49 | Ga0466719_222514 | 3300042606 | Bacteria | 5950 |
| 50 | Ga0466698_399543 | 3300042610 | Bacteria | 3080 |
| 51 | JGI24702J35022_10004158 | 3300002462 | Bacteria | 8651 |
| 52 | JGI24702J35022_10155450 | 3300002462 | Bacteria | 1285 |
| 53 | JGI24699J35502_11114944 | 3300002509 | Bacteria | 2888 |
| 54 | Ga0104041_1033984 | 3300007106 | Bacteria | 1779 |
| 55 | Ga0104050_1000740 | 3300007153 | Bacteria | 2241 |
| 56 | Ga0466697_088123 | 3300042611 | Bacteria | 1609 |
| 57 | Ga0466733_016064 | 3300042659 | Bacteria | 46942 |
| 58 | Ga0562378_0404 | 3300056814 | Bacteria | 79095 |
| 59 | Ga0562376_0088 | 3300056857 | Bacteria | 219719 |
| 60 | Ga0466704_266426 | 3300042643 | Bacteria | 2950 |
| 61 | Ga0466704_346807 | 3300042643 | Bacteria | 27552 |
| 62 | Ga0466704_492270 | 3300042643 | Bacteria | 1200 |
| 63 | Ga0466708_232353 | 3300042652 | Bacteria | 129711 |
| 64 | Ga0466725_374344 | 3300042654 | Bacteria | 4316 |
| 65 | Ga0466705_419663 | 3300042612 | Bacteria | 6281 |
| 66 | Ga0466723_024162 | 3300042618 | Bacteria | 7461 |
| 67 | Ga0160469_100036 | 3300012824 | Bacteria | 248494 |
| 68 | Ga0415639_015931 | 3300038395 | Bacteria | 9123 |
| 69 | Ga0415639_049181 | 3300038395 | Bacteria | 5560 |
| 70 | Ga0415639_094985 | 3300038395 | Bacteria | 4383 |
| 71 | Ga0466690_305366 | 3300042590 | Unclassified | 5683 |
| 72 | Ga0466699_081258 | 3300042597 | Bacteria | 1255 |
| 73 | Ga0466699_232179 | 3300042597 | Bacteria | 1219 |
| 74 | Ga0123355_10005368 | 3300009826 | Bacteria | 18735 |
| 75 | Ga0123355_10174663 | 3300009826 | Bacteria | 3202 |
| 76 | Ga0123356_10766919 | 3300010049 | Bacteria | 1135 |
| 77 | Ga0123353_10170275 | 3300010167 | Unclassified | 3458 |
| 78 | Ga0160464_101887 | 3300012805 | Bacteria | 5176 |
| 79 | Ga0160466_100054 | 3300012809 | Bacteria | 144581 |
| 80 | Ga0466706_189380 | 3300042599 | Bacteria | 24268 |
| 81 | Ga0466707_202048 | 3300042601 | Bacteria | 26018 |
| 82 | Ga0466713_071199 | 3300042602 | Bacteria | 4589 |
| 83 | JGI24699J35502_11115835 | 3300002509 | Bacteria | 2937 |
| 84 | Ga0104045_1015158 | 3300007085 | Bacteria | 3294 |
| 85 | Ga0562376_6206 | 3300056857 | Bacteria | 5767 |
| 86 | Ga0562374_2764 | 3300057007 | Bacteria | 13625 |
| 87 | Ga0466703_182892 | 3300042636 | Bacteria | 1370 |
| 88 | Ga0466703_240657 | 3300042636 | Bacteria | 13597 |
| 89 | Ga0466708_347609 | 3300042652 | Bacteria | 10952 |
| 90 | Ga0466725_056913 | 3300042654 | Bacteria | 5186 |
| 91 | Ga0466725_254332 | 3300042654 | Bacteria | 4173 |
| 92 | Ga0466723_231316 | 3300042618 | Bacteria | 7676 |
| 93 | Ga0466728_063589 | 3300042620 | Bacteria | 21271 |
| 94 | Ga0466728_109614 | 3300042620 | Bacteria | 32052 |
| 95 | Ga0160432_100009 | 3300012818 | Bacteria | 463846 |
| 96 | Ga0160469_101281 | 3300012824 | Bacteria | 7117 |
| 97 | Ga0160472_100076 | 3300012839 | Bacteria | 162972 |
| 98 | Ga0160472_100974 | 3300012839 | Bacteria | 10567 |
| 99 | Ga0160433_107358 | 3300012846 | Bacteria | 1519 |
| 100 | Ga0466657_166006 | 3300042582 | Bacteria | 6832 |
| 101 | Ga0466692_167406 | 3300042591 | Bacteria | 107532 |
| 102 | Ga0466693_161806 | 3300042592 | Bacteria | 1893 |
| 103 | Ga0123355_10000217 | 3300009826 | Bacteria | 72204 |
| 104 | Ga0123355_10065640 | 3300009826 | Bacteria | 5845 |
| 105 | Ga0123355_10340757 | 3300009826 | Bacteria | 1997 |
| 106 | Ga0123356_10004330 | 3300010049 | Bacteria | 14682 |
| 107 | Ga0123353_10358707 | 3300010167 | Bacteria | 2192 |
| 108 | Ga0466713_135381 | 3300042602 | Bacteria | 4850 |
| 109 | Ga0466716_274094 | 3300042605 | Bacteria | 1240 |
| 110 | Ga0466719_189490 | 3300042606 | Bacteria | 8945 |
| 111 | Ga0466719_533548 | 3300042606 | Bacteria | 2963 |
| 112 | 2227129977 | 2225789004 | Bacteria | 1665 |
| 113 | JGI24705J35276_12228837 | 3300002504 | Bacteria | 3270 |
| 114 | JGI24705J35276_12237236 | 3300002504 | Bacteria | 10300 |
| 115 | JGI24699J35502_11111392 | 3300002509 | Bacteria | 2716 |
| 116 | JGI24699J35502_11134164 | 3300002509 | Bacteria | 41878 |
| 117 | Ga0466733_199813 | 3300042659 | Bacteria | 1418 |
| 118 | Ga0562377_0028 | 3300056842 | Bacteria | 766538 |
| 119 | Ga0466704_033779 | 3300042643 | Bacteria | 2763 |
| 120 | Ga0466704_376448 | 3300042643 | Bacteria | 1831 |
| 121 | Ga0466708_192526 | 3300042652 | Bacteria | 6623 |
| 122 | Ga0466725_248619 | 3300042654 | Bacteria | 1861 |
| 123 | Ga0466727_330942 | 3300042655 | Bacteria | 38760 |
| 124 | Ga0466710_046168 | 3300042613 | Bacteria | 4059 |
| 125 | Ga0466710_173881 | 3300042613 | Bacteria | 1122 |
| 126 | Ga0466711_063189 | 3300042615 | Bacteria | 6481 |
| 127 | Ga0466711_092810 | 3300042615 | Bacteria | 12566 |
| 128 | Ga0466728_459199 | 3300042620 | Bacteria | 2254 |
| 129 | Ga0160459_100041 | 3300012831 | Bacteria | 228416 |
| 130 | Ga0160459_108380 | 3300012831 | Bacteria | 1275 |
| 131 | Ga0160445_100119 | 3300012847 | Bacteria | 69517 |
| 132 | Ga0160435_1000010 | 3300012857 | Unclassified | 242467 |
| 133 | Ga0466693_371376 | 3300042592 | Bacteria | 1792 |
| 134 | Ga0123353_10270274 | 3300010167 | Bacteria | 2620 |
| 135 | Ga0123354_10329969 | 3300010882 | Bacteria | 1393 |
| 136 | Ga0160464_103098 | 3300012805 | Bacteria | 2558 |
| 137 | Ga0466706_066919 | 3300042599 | Bacteria | 95360 |
| 138 | Ga0466706_217442 | 3300042599 | Bacteria | 2199 |
| 139 | Ga0466707_099604 | 3300042601 | Bacteria | 1264 |
| 140 | Ga0466713_106795 | 3300042602 | Bacteria | 3214 |
| 141 | Ga0466717_229928 | 3300042604 | Bacteria | 8932 |
| 142 | Ga0466716_460492 | 3300042605 | Bacteria | 7196 |
| 143 | IMNBL1DRAFT_c0033607 | 3300000062 | Bacteria | 1834 |
| 144 | Ga0104045_1075696 | 3300007085 | Bacteria | 1856 |
| 145 | Ga0466705_245302 | 3300042612 | Bacteria | 1314 |
| 146 | Ga0466733_049047 | 3300042659 | Bacteria | 7269 |
| 147 | Ga0466733_200059 | 3300042659 | Bacteria | 44789 |
| 148 | Ga0466735_012986 | 3300042624 | Bacteria | 1099 |
| 149 | Ga0466730_068440 | 3300042625 | Bacteria | 2012 |
| 150 | Ga0466730_077225 | 3300042625 | Bacteria | 2498 |
| 151 | Ga0466703_276069 | 3300042636 | Bacteria | 15268 |
| 152 | Ga0466704_354424 | 3300042643 | Bacteria | 4341 |
| 153 | Ga0466704_509831 | 3300042643 | Bacteria | 133092 |
| 154 | Ga0466725_010440 | 3300042654 | Bacteria | 37328 |
| 155 | Ga0466705_430557 | 3300042612 | Bacteria | 1723 |
| 156 | Ga0466710_387775 | 3300042613 | Bacteria | 3094 |
| 157 | Ga0466710_453627 | 3300042613 | Bacteria | 2974 |
| 158 | Ga0466715_341207 | 3300042616 | Bacteria | 52992 |
| 159 | Ga0466726_425263 | 3300042619 | Bacteria | 15829 |
| 160 | Ga0466729_141203 | 3300042621 | Bacteria | 8339 |
| 161 | Ga0160468_100045 | 3300012819 | Bacteria | 189187 |
| 162 | Ga0160441_100003 | 3300012825 | Bacteria | 759726 |
| 163 | Ga0160433_100755 | 3300012846 | Bacteria | 11925 |
| 164 | Ga0160457_1002911 | 3300012858 | Bacteria | 3254 |
| 165 | Ga0415639_098792 | 3300038395 | Bacteria | 4453 |
| 166 | Ga0466690_106956 | 3300042590 | Bacteria | 4034 |
| 167 | Ga0466694_164891 | 3300042594 | Bacteria | 1950 |
| 168 | Ga0466701_009184 | 3300042598 | Bacteria | 202780 |
| 169 | Ga0123356_10000006 | 3300010049 | Bacteria | 247371 |
| 170 | Ga0123353_10072694 | 3300010167 | Bacteria | 5527 |
| 171 | Ga0466707_141179 | 3300042601 | Bacteria | 16846 |
| 172 | Ga0466713_094667 | 3300042602 | Bacteria | 11339 |
| 173 | Ga0466717_182726 | 3300042604 | Bacteria | 6971 |
| 174 | Ga0466719_468580 | 3300042606 | Bacteria | 19949 |
| 175 | Ga0466722_197953 | 3300042609 | Bacteria | 5108 |
| 176 | 2227222466 | 2225789004 | Bacteria | 7475 |
| 177 | Ga0072940_1077742 | 3300005200 | Bacteria | 2994 |
| 178 | Ga0102734_1001717 | 3300007129 | Bacteria | 5366 |
| 179 | Ga0102738_1000957 | 3300007141 | Unclassified | 4564 |
| 180 | Ga0104019_1001347 | 3300007150 | Unclassified | 8267 |
| 181 | Ga0103267_1000220 | 3300007190 | Bacteria | 22231 |
| 182 | Ga0466705_006383 | 3300042612 | Bacteria | 4335 |
| 183 | Ga0466705_307402 | 3300042612 | Bacteria | 6768 |
| 184 | Ga0530661_041152 | 3300056564 | Unclassified | 1343 |
| 185 | Ga0466724_02664 | 3300042649 | Bacteria | 2182 |
| 186 | Ga0466710_321955 | 3300042613 | Bacteria | 1861 |
| 187 | Ga0466711_313429 | 3300042615 | Bacteria | 90458 |
| 188 | Ga0160460_100300 | 3300012845 | Bacteria | 36880 |
| 189 | Ga0466691_042413 | 3300042593 | Bacteria | 1704 |
| 190 | Ga0123355_10000161 | 3300009826 | Bacteria | 81946 |
| 191 | Ga0123355_10014151 | 3300009826 | Bacteria | 12455 |
| 192 | Ga0123355_10183777 | 3300009826 | Bacteria | 3097 |
| 193 | Ga0123355_10201080 | 3300009826 | Bacteria | 2910 |
| 194 | Ga0123356_10920773 | 3300010049 | Unclassified | 1045 |
| 195 | Ga0123353_10016787 | 3300010167 | Bacteria | 10720 |
| 196 | Ga0123354_10036531 | 3300010882 | Bacteria | 7663 |
| 197 | Ga0466701_078804 | 3300042598 | Bacteria | 7509 |
| 198 | Ga0466707_205685 | 3300042601 | Bacteria | 17644 |
| 199 | Ga0466714_015872 | 3300042603 | Bacteria | 1707 |
| 200 | Ga0466719_390306 | 3300042606 | Bacteria | 2095 |
| 201 | Ga0104048_1004612 | 3300007143 | Bacteria | 5613 |
| 202 | Ga0466733_061622 | 3300042659 | Bacteria | 45413 |
| 203 | Ga0562377_0127 | 3300056842 | Bacteria | 227622 |
| 204 | Ga0562375_0015 | 3300056856 | Bacteria | 1028412 |
| 205 | Ga0466735_138612 | 3300042624 | Unclassified | 1081 |
| 206 | Ga0466730_103184 | 3300042625 | Bacteria | 430539 |
| 207 | Ga0466715_146797 | 3300042616 | Bacteria | 104288 |
| 208 | Ga0466715_177003 | 3300042616 | Bacteria | 1298 |
| 209 | Ga0466715_430592 | 3300042616 | Bacteria | 2691 |
| 210 | Ga0466728_090083 | 3300042620 | Bacteria | 5372 |
| 211 | Ga0160469_103556 | 3300012824 | Bacteria | 2102 |
| 212 | Ga0160458_100059 | 3300012832 | Bacteria | 140854 |
| 213 | Ga0160452_102984 | 3300012834 | Bacteria | 3207 |
| 214 | Ga0160434_100026 | 3300012850 | Unclassified | 152152 |
| 215 | Ga0415639_093688 | 3300038395 | Bacteria | 2038 |
| 216 | Ga0466694_297265 | 3300042594 | Bacteria | 9095 |
| 217 | Ga0123357_10212387 | 3300009784 | Bacteria | 2170 |
| 218 | Ga0123355_10323203 | 3300009826 | Bacteria | 2076 |
| 219 | Ga0123356_10696471 | 3300010049 | Bacteria | 1185 |
| 220 | Ga0123354_10010543 | 3300010882 | Bacteria | 14248 |
| 221 | Ga0466701_079539 | 3300042598 | Bacteria | 22402 |
| 222 | Ga0466701_090230 | 3300042598 | Unclassified | 2084 |
| 223 | Ga0466706_030177 | 3300042599 | Bacteria | 2865 |
| 224 | Ga0466706_165313 | 3300042599 | Bacteria | 60368 |
| 225 | Ga0466700_108665 | 3300042600 | Bacteria | 3352 |
| 226 | Ga0466700_196335 | 3300042600 | Bacteria | 2654 |
| 227 | Ga0466700_301649 | 3300042600 | Unclassified | 1698 |
| 228 | Ga0466713_075001 | 3300042602 | Bacteria | 6358 |
| 229 | Ga0466717_275020 | 3300042604 | Bacteria | 3875 |
| 230 | Ga0466719_128062 | 3300042606 | Bacteria | 4000 |
| 231 | Ga0466721_232643 | 3300042608 | Bacteria | 2266 |
| 232 | Ga0466722_234861 | 3300042609 | Bacteria | 10897 |
| 233 | Ga0466698_328919 | 3300042610 | Bacteria | 1489 |
| 234 | IMNBL1DRAFT_c0000412 | 3300000062 | Bacteria | 36189 |
| 235 | JGI24702J35022_10003610 | 3300002462 | Bacteria | 9314 |
| 236 | JGI24702J35022_10026525 | 3300002462 | Bacteria | 3121 |
| 237 | JGI24705J35276_12227246 | 3300002504 | Unclassified | 2970 |
| 238 | Ga0102737_1001472 | 3300007142 | Bacteria | 6526 |
| 239 | Ga0104050_1006519 | 3300007153 | Bacteria | 9212 |
| 240 | Ga0104050_1202223 | 3300007153 | Bacteria | 1656 |
| 241 | Ga0103268_1000768 | 3300007192 | Bacteria | 9057 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042601 | Ga0466707_099604 | Ga0466707_099604_242_1060 | 272 |
| 2 | 3300042619 | Ga0466726_425263 | Ga0466726_425263_15000_15818 | 272 |
| 3 | 3300042643 | Ga0466704_376448 | Ga0466704_376448_21_839 | 272 |
| 4 | 3300010167 | Ga0123353_10251508 | Ga0123353_102515082 | 273 |
| 5 | 3300042599 | Ga0466706_189380 | Ga0466706_189380_15642_16466 | 274 |
| 6 | 3300010049 | Ga0123356_10000006 | Ga0123356_10000006156 | 276 |
| 7 | 3300009784 | Ga0123357_10212387 | Ga0123357_102123872 | 279 |
| 8 | 3300007085 | Ga0104045_1015158 | Ga0104045_10151585 | 285 |
| 9 | 3300007143 | Ga0104048_1022222 | Ga0104048_10222225 | 285 |
| 10 | 3300007150 | Ga0104019_1001347 | Ga0104019_10013478 | 285 |
| 11 | 3300042590 | Ga0466690_106956 | Ga0466690_106956_1781_2638 | 285 |
| 12 | 3300042593 | Ga0466691_120902 | Ga0466691_120902_26578_27435 | 285 |
| 13 | 3300042596 | Ga0466696_220668 | Ga0466696_220668_134_991 | 285 |
| 14 | 3300042603 | Ga0466714_045948 | Ga0466714_045948_268_1125 | 285 |
| 15 | 3300042615 | Ga0466711_313429 | Ga0466711_313429_5758_6615 | 285 |
| 16 | 3300042624 | Ga0466735_138612 | Ga0466735_138612_79_936 | 285 |
| 17 | 3300042649 | Ga0466724_02664 | Ga0466724_02664_876_1733 | 285 |
| 18 | 3300042649 | Ga0466724_25707 | Ga0466724_25707_7610_8467 | 285 |
| 19 | iso_pr_bacteria | 2904728850 | 2904729226 | 285 |
| 20 | 3300007153 | Ga0104050_1000740 | Ga0104050_10007402 | 286 |
| 21 | 3300007153 | Ga0104050_1202223 | Ga0104050_12022232 | 286 |
| 22 | 3300012818 | Ga0160432_100009 | Ga0160432_100009285 | 286 |
| 23 | 3300012846 | Ga0160433_107358 | Ga0160433_1073582 | 286 |
| 24 | 3300042582 | Ga0466657_153013 | Ga0466657_153013_1034_1894 | 286 |
| 25 | 3300042582 | Ga0466657_166006 | Ga0466657_166006_1660_2520 | 286 |
| 26 | 3300042592 | Ga0466693_371376 | Ga0466693_371376_801_1661 | 286 |
| 27 | 3300042594 | Ga0466694_164891 | Ga0466694_164891_585_1445 | 286 |
| 28 | 3300042594 | Ga0466694_297265 | Ga0466694_297265_2636_3496 | 286 |
| 29 | 3300042598 | Ga0466701_090230 | Ga0466701_090230_1204_2064 | 286 |
| 30 | 3300042600 | Ga0466700_301649 | Ga0466700_301649_491_1351 | 286 |
| 31 | 3300042605 | Ga0466716_274094 | Ga0466716_274094_318_1178 | 286 |
| 32 | 3300042612 | Ga0466705_152589 | Ga0466705_152589_3906_4766 | 286 |
| 33 | 3300042613 | Ga0466710_046168 | Ga0466710_046168_2635_3495 | 286 |
| 34 | 3300042613 | Ga0466710_453627 | Ga0466710_453627_47_907 | 286 |
| 35 | 3300042615 | Ga0466711_063189 | Ga0466711_063189_4611_5471 | 286 |
| 36 | 3300042616 | Ga0466715_177003 | Ga0466715_177003_73_933 | 286 |
| 37 | 3300042649 | Ga0466724_60511 | Ga0466724_60511_475_1335 | 286 |
| 38 | 3300042654 | Ga0466725_374344 | Ga0466725_374344_862_1722 | 286 |
| 39 | 3300056814 | Ga0562378_0404 | Ga0562378_0404_68404_69264 | 286 |
| 40 | iso_pr_bacteria | 2579779088 | 2582239886 | 286 |
| 41 | iso_pr_bacteria | 2820753519 | 2820755062 | 286 |
| 42 | iso_pr_bacteria | 2820755292 | 2820756264 | 286 |
| 43 | iso_pr_bacteria | 2820783511 | 2820784604 | 286 |
| 44 | iso_pr_bacteria | 2820785563 | 2820786126 | 286 |
| 45 | iso_pr_bacteria | 2820788205 | 2820788628 | 286 |
| 46 | iso_pr_bacteria | 2873776654 | 2873778366 | 286 |
| 47 | iso_pr_bacteria | 2896321640 | 2896321722 | 286 |
| 48 | iso_pr_bacteria | 2998907766 | 2998908962 | 286 |
| 49 | iso_pr_bacteria | 8065497608 | 8065501888 | 286 |
| 50 | 3300002462 | JGI24702J35022_10004158 | JGI24702J35022_100041585 | 287 |
| 51 | 3300002462 | JGI24702J35022_10026525 | JGI24702J35022_100265251 | 287 |
| 52 | 3300002462 | JGI24702J35022_10155450 | JGI24702J35022_101554502 | 287 |
| 53 | 3300002504 | JGI24705J35276_12228837 | JGI24705J35276_122288372 | 287 |
| 54 | 3300007085 | Ga0104045_1001726 | Ga0104045_10017262 | 287 |
| 55 | 3300007106 | Ga0104041_1033984 | Ga0104041_10339841 | 287 |
| 56 | 3300007129 | Ga0102734_1001717 | Ga0102734_10017173 | 287 |
| 57 | 3300007143 | Ga0104048_1004612 | Ga0104048_10046122 | 287 |
| 58 | 3300007153 | Ga0104050_1006519 | Ga0104050_10065192 | 287 |
| 59 | 3300009826 | Ga0123355_10000161 | Ga0123355_100001619 | 287 |
| 60 | 3300009826 | Ga0123355_10000217 | Ga0123355_1000021754 | 287 |
| 61 | 3300010049 | Ga0123356_10004330 | Ga0123356_100043301 | 287 |
| 62 | 3300010049 | Ga0123356_10196594 | Ga0123356_101965942 | 287 |
| 63 | 3300010049 | Ga0123356_10766919 | Ga0123356_107669191 | 287 |
| 64 | 3300010049 | Ga0123356_10920773 | Ga0123356_109207732 | 287 |
| 65 | 3300010167 | Ga0123353_10072694 | Ga0123353_100726942 | 287 |
| 66 | 3300010167 | Ga0123353_10326615 | Ga0123353_103266152 | 287 |
| 67 | 3300012803 | Ga0160465_100031 | Ga0160465_1000313 | 287 |
| 68 | 3300012805 | Ga0160464_100287 | Ga0160464_10028729 | 287 |
| 69 | 3300012805 | Ga0160464_101887 | Ga0160464_1018872 | 287 |
| 70 | 3300012809 | Ga0160466_100054 | Ga0160466_10005470 | 287 |
| 71 | 3300012824 | Ga0160469_100036 | Ga0160469_100036225 | 287 |
| 72 | 3300012825 | Ga0160441_100003 | Ga0160441_100003377 | 287 |
| 73 | 3300012834 | Ga0160452_102984 | Ga0160452_1029843 | 287 |
| 74 | 3300012839 | Ga0160472_100076 | Ga0160472_10007629 | 287 |
| 75 | 3300012839 | Ga0160472_100974 | Ga0160472_1009741 | 287 |
| 76 | 3300012850 | Ga0160434_100026 | Ga0160434_100026130 | 287 |
| 77 | 3300012857 | Ga0160435_1000010 | Ga0160435_10000101 | 287 |
| 78 | 3300042590 | Ga0466690_305366 | Ga0466690_305366_4794_5657 | 287 |
| 79 | 3300042593 | Ga0466691_023594 | Ga0466691_023594_7874_8737 | 287 |
| 80 | 3300042599 | Ga0466706_165313 | Ga0466706_165313_15354_16217 | 287 |
| 81 | 3300042600 | Ga0466700_196335 | Ga0466700_196335_1187_2050 | 287 |
| 82 | 3300042602 | Ga0466713_071199 | Ga0466713_071199_628_1491 | 287 |
| 83 | 3300042602 | Ga0466713_094667 | Ga0466713_094667_9631_10494 | 287 |
| 84 | 3300042602 | Ga0466713_106795 | Ga0466713_106795_1407_2270 | 287 |
| 85 | 3300042612 | Ga0466705_307402 | Ga0466705_307402_3786_4649 | 287 |
| 86 | 3300042618 | Ga0466723_024162 | Ga0466723_024162_3320_4183 | 287 |
| 87 | 3300042620 | Ga0466728_063589 | Ga0466728_063589_17406_18305 | 287 |
| 88 | 3300042652 | Ga0466708_405482 | Ga0466708_405482_10592_11455 | 287 |
| 89 | iso_pr_bacteria | 2820735654 | 2820736367 | 287 |
| 90 | iso_pr_bacteria | 2838772460 | 2838775544 | 287 |
| 91 | iso_pr_bacteria | 2896321640 | 2896325275 | 287 |
| 92 | iso_pr_bacteria | 2896330536 | 2896333697 | 287 |
| 93 | iso_pr_bacteria | 2898741527 | 2898745142 | 287 |
| 94 | 3300000062 | IMNBL1DRAFT_c0033607 | IMNBL1DRAFT_00336072 | 288 |
| 95 | 3300002462 | JGI24702J35022_10003610 | JGI24702J35022_100036106 | 288 |
| 96 | 3300007085 | Ga0104045_1075696 | Ga0104045_10756962 | 288 |
| 97 | 3300007190 | Ga0103267_1000220 | Ga0103267_10002203 | 288 |
| 98 | 3300007192 | Ga0103268_1000768 | Ga0103268_10007684 | 288 |
| 99 | 3300009826 | Ga0123355_10075178 | Ga0123355_100751784 | 288 |
| 100 | 3300042582 | Ga0466657_334239 | Ga0466657_334239_5633_6499 | 288 |
| 101 | 3300042592 | Ga0466693_161806 | Ga0466693_161806_433_1299 | 288 |
| 102 | 3300042595 | Ga0466695_290486 | Ga0466695_290486_3393_4259 | 288 |
| 103 | 3300042597 | Ga0466699_081258 | Ga0466699_081258_309_1175 | 288 |
| 104 | 3300042597 | Ga0466699_232179 | Ga0466699_232179_145_1011 | 288 |
| 105 | 3300042598 | Ga0466701_009184 | Ga0466701_009184_159288_160154 | 288 |
| 106 | 3300042598 | Ga0466701_090323 | Ga0466701_090323_29_895 | 288 |
| 107 | 3300042602 | Ga0466713_075001 | Ga0466713_075001_158_1024 | 288 |
| 108 | 3300042606 | Ga0466719_390306 | Ga0466719_390306_607_1473 | 288 |
| 109 | 3300042610 | Ga0466698_328919 | Ga0466698_328919_47_913 | 288 |
| 110 | 3300042611 | Ga0466697_060312 | Ga0466697_060312_114_980 | 288 |
| 111 | 3300042612 | Ga0466705_419663 | Ga0466705_419663_2290_3156 | 288 |
| 112 | 3300042613 | Ga0466710_321955 | Ga0466710_321955_38_904 | 288 |
| 113 | 3300042620 | Ga0466728_090083 | Ga0466728_090083_996_1862 | 288 |
| 114 | 3300042620 | Ga0466728_109614 | Ga0466728_109614_390_1256 | 288 |
| 115 | 3300042625 | Ga0466730_103184 | Ga0466730_103184_385337_386203 | 288 |
| 116 | 3300042643 | Ga0466704_346807 | Ga0466704_346807_483_1349 | 288 |
| 117 | 3300042648 | Ga0466709_335259 | Ga0466709_335259_658_1524 | 288 |
| 118 | 3300042659 | Ga0466733_049047 | Ga0466733_049047_3890_4756 | 288 |
| 119 | 3300042659 | Ga0466733_061622 | Ga0466733_061622_38708_39574 | 288 |
| 120 | 3300042659 | Ga0466733_199813 | Ga0466733_199813_494_1360 | 288 |
| 121 | iso_pr_bacteria | 2820746860 | 2820746952 | 288 |
| 122 | iso_pr_bacteria | 2820770630 | 2820771005 | 288 |
| 123 | iso_pr_bacteria | 2998929858 | 2998930462 | 288 |
| 124 | iso_pr_bacteria | 8007220153 | 8007222617 | 288 |
| 125 | 3300002504 | JGI24705J35276_12227246 | JGI24705J35276_122272463 | 289 |
| 126 | 3300009826 | Ga0123355_10323203 | Ga0123355_103232032 | 289 |
| 127 | 3300010049 | Ga0123356_10844527 | Ga0123356_108445271 | 289 |
| 128 | 3300010167 | Ga0123353_10170275 | Ga0123353_101702753 | 289 |
| 129 | 3300010167 | Ga0123353_10395990 | Ga0123353_103959902 | 289 |
| 130 | 3300012832 | Ga0160458_100059 | Ga0160458_10005985 | 289 |
| 131 | 3300042601 | Ga0466707_205685 | Ga0466707_205685_14005_14874 | 289 |
| 132 | 3300042618 | Ga0466723_231316 | Ga0466723_231316_6750_7619 | 289 |
| 133 | 3300042620 | Ga0466728_459199 | Ga0466728_459199_202_1110 | 289 |
| 134 | 3300042625 | Ga0466730_077225 | Ga0466730_077225_259_1128 | 289 |
| 135 | 3300056842 | Ga0562377_0028 | Ga0562377_0028_680626_681495 | 289 |
| 136 | 3300056856 | Ga0562375_0015 | Ga0562375_0015_440989_441858 | 289 |
| 137 | 3300056857 | Ga0562376_0088 | Ga0562376_0088_51256_52125 | 289 |
| 138 | iso_pr_bacteria | 2509276035 | 2509456693 | 289 |
| 139 | iso_pr_bacteria | 2585427698 | 2586252578 | 289 |
| 140 | iso_pr_bacteria | 2597490293 | 2598964207 | 289 |
| 141 | iso_pr_bacteria | 2811995047 | 2812946053 | 289 |
| 142 | iso_pr_bacteria | 2864976888 | 2864980841 | 289 |
| 143 | iso_pr_bacteria | 2957623355 | 2957623988 | 289 |
| 144 | iso_pr_bacteria | 2964739456 | 2964741798 | 289 |
| 145 | iso_pr_bacteria | 2964749277 | 2964750511 | 289 |
| 146 | iso_pr_bacteria | 2964775400 | 2964776553 | 289 |
| 147 | iso_pr_bacteria | 2964778705 | 2964779893 | 289 |
| 148 | iso_pr_bacteria | 2967802344 | 2967804484 | 289 |
| 149 | iso_pr_bacteria | 2967825073 | 2967827017 | 289 |
| 150 | iso_pr_bacteria | 2970199020 | 2970201280 | 289 |
| 151 | iso_pr_bacteria | 2970225615 | 2970226444 | 289 |
| 152 | iso_pr_bacteria | 2970254690 | 2970257812 | 289 |
| 153 | iso_pr_bacteria | 2977592972 | 2977596215 | 289 |
| 154 | iso_pr_bacteria | 2977596371 | 2977598828 | 289 |
| 155 | iso_pr_bacteria | 2977622177 | 2977624211 | 289 |
| 156 | iso_pr_bacteria | 2977628635 | 2977630303 | 289 |
| 157 | iso_pr_bacteria | 2977635137 | 2977635609 | 289 |
| 158 | iso_pr_bacteria | 2977653127 | 2977656477 | 289 |
| 159 | iso_pr_bacteria | 8012939035 | 8012940837 | 289 |
| 160 | 3300002504 | JGI24705J35276_12237236 | JGI24705J35276_122372363 | 290 |
| 161 | 3300002509 | JGI24699J35502_11111392 | JGI24699J35502_111113923 | 290 |
| 162 | 3300002509 | JGI24699J35502_11114944 | JGI24699J35502_111149441 | 290 |
| 163 | 3300002509 | JGI24699J35502_11115835 | JGI24699J35502_111158351 | 290 |
| 164 | 3300002509 | JGI24699J35502_11134164 | JGI24699J35502_1113416431 | 290 |
| 165 | 3300007140 | Ga0102740_1000227 | Ga0102740_100022718 | 290 |
| 166 | 3300012819 | Ga0160468_100045 | Ga0160468_10004568 | 290 |
| 167 | 3300038395 | Ga0415639_049181 | Ga0415639_049181_3976_4848 | 290 |
| 168 | 3300038395 | Ga0415639_094985 | Ga0415639_094985_121_993 | 290 |
| 169 | 3300042598 | Ga0466701_093289 | Ga0466701_093289_428_1300 | 290 |
| 170 | 3300042603 | Ga0466714_015872 | Ga0466714_015872_685_1557 | 290 |
| 171 | 3300042606 | Ga0466719_128062 | Ga0466719_128062_139_1011 | 290 |
| 172 | 3300042606 | Ga0466719_189490 | Ga0466719_189490_3390_4262 | 290 |
| 173 | iso_pr_bacteria | 2590828803 | 2592927062 | 290 |
| 174 | iso_pr_bacteria | 2718218155 | 2720327988 | 290 |
| 175 | iso_pr_bacteria | 2816332503 | 2818125882 | 290 |
| 176 | 3300009826 | Ga0123355_10183777 | Ga0123355_101837773 | 291 |
| 177 | 3300012848 | Ga0160443_100011 | Ga0160443_100011332 | 291 |
| 178 | 3300038395 | Ga0415639_006384 | Ga0415639_006384_14601_15476 | 291 |
| 179 | 3300038395 | Ga0415639_015931 | Ga0415639_015931_1875_2750 | 291 |
| 180 | 3300042592 | Ga0466693_226589 | Ga0466693_226589_672_1547 | 291 |
| 181 | 3300042598 | Ga0466701_079539 | Ga0466701_079539_18261_19136 | 291 |
| 182 | 3300042599 | Ga0466706_066919 | Ga0466706_066919_39298_40173 | 291 |
| 183 | 3300042601 | Ga0466707_024038 | Ga0466707_024038_40454_41329 | 291 |
| 184 | 3300042602 | Ga0466713_135381 | Ga0466713_135381_3512_4387 | 291 |
| 185 | 3300042609 | Ga0466722_041659 | Ga0466722_041659_2237_3112 | 291 |
| 186 | 3300042609 | Ga0466722_234861 | Ga0466722_234861_4522_5397 | 291 |
| 187 | 3300042616 | Ga0466715_430592 | Ga0466715_430592_1471_2346 | 291 |
| 188 | 3300042652 | Ga0466708_232353 | Ga0466708_232353_46838_47713 | 291 |
| 189 | 3300042655 | Ga0466727_330942 | Ga0466727_330942_35973_36848 | 291 |
| 190 | iso_pr_bacteria | 2582581321 | 2585353928 | 291 |
| 191 | iso_pr_bacteria | 2711768164 | 2712504604 | 291 |
| 192 | iso_pr_bacteria | 2816332545 | 2818332549 | 291 |
| 193 | iso_pr_bacteria | 2820570671 | 2820571072 | 291 |
| 194 | iso_pr_bacteria | 2833478085 | 2833479702 | 291 |
| 195 | 2225789004 | 2227222466 | 2227655855 | 292 |
| 196 | 3300009826 | Ga0123355_10014151 | Ga0123355_100141519 | 292 |
| 197 | 3300009826 | Ga0123355_10174663 | Ga0123355_101746632 | 292 |
| 198 | 3300009826 | Ga0123355_10340757 | Ga0123355_103407574 | 292 |
| 199 | 3300010049 | Ga0123356_10696471 | Ga0123356_106964712 | 292 |
| 200 | 3300010167 | Ga0123353_10270274 | Ga0123353_102702743 | 292 |
| 201 | 3300010167 | Ga0123353_10358707 | Ga0123353_103587072 | 292 |
| 202 | 3300010882 | Ga0123354_10036531 | Ga0123354_100365314 | 292 |
| 203 | 3300010882 | Ga0123354_10329969 | Ga0123354_103299692 | 292 |
| 204 | 3300042608 | Ga0466721_232643 | Ga0466721_232643_843_1721 | 292 |
| 205 | 3300042613 | Ga0466710_387775 | Ga0466710_387775_1970_2848 | 292 |
| 206 | 3300042643 | Ga0466704_033779 | Ga0466704_033779_449_1327 | 292 |
| 207 | 3300042643 | Ga0466704_509831 | Ga0466704_509831_104595_105473 | 292 |
| 208 | 3300042652 | Ga0466708_192526 | Ga0466708_192526_2877_3755 | 292 |
| 209 | 3300042654 | Ga0466725_056913 | Ga0466725_056913_3348_4226 | 292 |
| 210 | 3300042659 | Ga0466733_016064 | Ga0466733_016064_9566_10444 | 292 |
| 211 | iso_pr_bacteria | 2508501043 | 2508700448 | 292 |
| 212 | 3300009826 | Ga0123355_10037712 | Ga0123355_100377122 | 293 |
| 213 | 3300042596 | Ga0466696_423762 | Ga0466696_423762_701_1582 | 293 |
| 214 | 3300042643 | Ga0466704_492270 | Ga0466704_492270_20_901 | 293 |
| 215 | 3300042654 | Ga0466725_093969 | Ga0466725_093969_1417_2298 | 293 |
| 216 | 3300056842 | Ga0562377_0127 | Ga0562377_0127_101011_101892 | 293 |
| 217 | iso_pr_bacteria | 2820255904 | 2820257139 | 293 |
| 218 | iso_pr_bacteria | 2820403592 | 2820403888 | 293 |
| 219 | 2225789004 | 2227129977 | 2227526589 | 294 |
| 220 | 3300042593 | Ga0466691_042413 | Ga0466691_042413_729_1613 | 294 |
| 221 | 3300042598 | Ga0466701_094256 | Ga0466701_094256_19162_20046 | 294 |
| 222 | 3300042601 | Ga0466707_202048 | Ga0466707_202048_10058_10942 | 294 |
| 223 | 3300042606 | Ga0466719_222514 | Ga0466719_222514_4590_5474 | 294 |
| 224 | 3300042615 | Ga0466711_074367 | Ga0466711_074367_4421_5305 | 294 |
| 225 | 3300042620 | Ga0466728_173110 | Ga0466728_173110_1573_2457 | 294 |
| 226 | 3300042621 | Ga0466729_141203 | Ga0466729_141203_2330_3214 | 294 |
| 227 | 3300042654 | Ga0466725_010440 | Ga0466725_010440_12963_13847 | 294 |
| 228 | iso_pr_bacteria | 2820387566 | 2820388255 | 294 |
| 229 | iso_pr_bacteria | 2864878056 | 2864881734 | 294 |
| 230 | iso_pr_bacteria | 2864886855 | 2864890628 | 294 |
| 231 | iso_pr_bacteria | 8018794549 | 8018795956 | 294 |
| 232 | 3300000062 | IMNBL1DRAFT_c0000412 | IMNBL1DRAFT_000041219 | 295 |
| 233 | 3300007141 | Ga0102738_1000957 | Ga0102738_10009572 | 295 |
| 234 | 3300007142 | Ga0102737_1001472 | Ga0102737_10014727 | 295 |
| 235 | 3300009826 | Ga0123355_10201080 | Ga0123355_102010803 | 295 |
| 236 | 3300012805 | Ga0160464_103098 | Ga0160464_1030983 | 295 |
| 237 | 3300012824 | Ga0160469_101281 | Ga0160469_1012814 | 295 |
| 238 | 3300012858 | Ga0160457_1002911 | Ga0160457_10029113 | 295 |
| 239 | 3300038395 | Ga0415639_093688 | Ga0415639_093688_1092_1979 | 295 |
| 240 | 3300042600 | Ga0466700_108665 | Ga0466700_108665_1379_2266 | 295 |
| 241 | 3300042604 | Ga0466717_275020 | Ga0466717_275020_1533_2420 | 295 |
| 242 | 3300042613 | Ga0466710_173881 | Ga0466710_173881_181_1068 | 295 |
| 243 | 3300042616 | Ga0466715_146797 | Ga0466715_146797_36052_36939 | 295 |
| 244 | 3300042624 | Ga0466735_012986 | Ga0466735_012986_60_947 | 295 |
| 245 | 3300042625 | Ga0466730_068440 | Ga0466730_068440_512_1399 | 295 |
| 246 | 3300042654 | Ga0466725_254332 | Ga0466725_254332_107_994 | 295 |
| 247 | 3300056564 | Ga0530661_041152 | Ga0530661_041152_139_1026 | 295 |
| 248 | 3300056856 | Ga0562375_0062 | Ga0562375_0062_286971_287858 | 295 |
| 249 | iso_pr_bacteria | 2820059968 | 2820061491 | 295 |
| 250 | 3300009826 | Ga0123355_10005368 | Ga0123355_100053689 | 296 |
| 251 | 3300009826 | Ga0123355_10065640 | Ga0123355_100656402 | 296 |
| 252 | 3300010167 | Ga0123353_10012850 | Ga0123353_100128508 | 296 |
| 253 | 3300012831 | Ga0160459_100041 | Ga0160459_100041151 | 296 |
| 254 | 3300012846 | Ga0160433_100755 | Ga0160433_1007554 | 296 |
| 255 | 3300038395 | Ga0415639_098792 | Ga0415639_098792_653_1543 | 296 |
| 256 | 3300042599 | Ga0466706_030177 | Ga0466706_030177_574_1464 | 296 |
| 257 | 3300042599 | Ga0466706_217442 | Ga0466706_217442_744_1634 | 296 |
| 258 | 3300042605 | Ga0466716_460492 | Ga0466716_460492_3501_4391 | 296 |
| 259 | 3300042606 | Ga0466719_533548 | Ga0466719_533548_1369_2259 | 296 |
| 260 | 3300042611 | Ga0466697_088123 | Ga0466697_088123_183_1073 | 296 |
| 261 | 3300042612 | Ga0466705_006383 | Ga0466705_006383_854_1744 | 296 |
| 262 | 3300042612 | Ga0466705_430557 | Ga0466705_430557_457_1347 | 296 |
| 263 | 3300042616 | Ga0466715_391574 | Ga0466715_391574_8816_9706 | 296 |
| 264 | 3300042620 | Ga0466728_004312 | Ga0466728_004312_6641_7531 | 296 |
| 265 | 3300042636 | Ga0466703_276069 | Ga0466703_276069_14106_14996 | 296 |
| 266 | 3300012831 | Ga0160459_108380 | Ga0160459_1083802 | 297 |
| 267 | 3300042606 | Ga0466719_206380 | Ga0466719_206380_5488_6381 | 297 |
| 268 | 3300042621 | Ga0466729_309503 | Ga0466729_309503_1415_2308 | 297 |
| 269 | iso_pr_bacteria | 2513237339 | 2514545478 | 297 |
| 270 | iso_pr_bacteria | 2835008077 | 2835009668 | 297 |
| 271 | iso_pr_bacteria | 2858102877 | 2858104776 | 297 |
| 272 | iso_pr_bacteria | 2858129007 | 2858129518 | 297 |
| 273 | iso_pr_bacteria | 2868677537 | 2868678333 | 297 |
| 274 | iso_pr_bacteria | 8002299145 | 8002301096 | 297 |
| 275 | 3300012845 | Ga0160460_100300 | Ga0160460_10030030 | 298 |
| 276 | 3300042636 | Ga0466703_240657 | Ga0466703_240657_7453_8349 | 298 |
| 277 | 3300042643 | Ga0466704_266426 | Ga0466704_266426_1988_2884 | 298 |
| 278 | 3300012824 | Ga0160469_103556 | Ga0160469_1035562 | 299 |
| 279 | 3300042612 | Ga0466705_245302 | Ga0466705_245302_12_911 | 299 |
| 280 | 3300042615 | Ga0466711_092810 | Ga0466711_092810_2871_3770 | 299 |
| 281 | 3300042654 | Ga0466725_248619 | Ga0466725_248619_388_1287 | 299 |
| 282 | iso_pr_bacteria | 2820072841 | 2820072891 | 299 |
| 283 | iso_pr_bacteria | 8022116796 | 8022121663 | 299 |
| 284 | 3300010167 | Ga0123353_10016787 | Ga0123353_100167875 | 300 |
| 285 | iso_pr_bacteria | 2820070515 | 2820070862 | 300 |
| 286 | 3300042604 | Ga0466717_182726 | Ga0466717_182726_4605_5510 | 301 |
| 287 | 3300010882 | Ga0123354_10010543 | Ga0123354_1001054314 | 302 |
| 288 | 3300012847 | Ga0160445_100119 | Ga0160445_10011924 | 302 |
| 289 | iso_pr_bacteria | 2820047982 | 2820049014 | 302 |
| 290 | iso_pr_bacteria | 2820050117 | 2820052606 | 302 |
| 291 | iso_pr_bacteria | 2841175817 | 2841177774 | 302 |
| 292 | 3300005201 | Ga0072941_1073964 | Ga0072941_10739644 | 303 |
| 293 | 3300005201 | Ga0072941_1073965 | Ga0072941_10739652 | 303 |
| 294 | 3300042604 | Ga0466717_229928 | Ga0466717_229928_4177_5088 | 303 |
| 295 | iso_pr_bacteria | 2617271320 | 2619533766 | 303 |
| 296 | iso_pr_bacteria | 2786546124 | 2786628293 | 303 |
| 297 | iso_pr_bacteria | 2816332478 | 2818029242 | 303 |
| 298 | iso_pr_bacteria | 2834852038 | 2834853442 | 303 |
| 299 | iso_pr_bacteria | 2843864159 | 2843864292 | 303 |
| 300 | iso_pr_bacteria | 2854518031 | 2854520889 | 303 |
| 301 | iso_pr_bacteria | 2854520951 | 2854522958 | 303 |
| 302 | iso_pr_bacteria | 2854536247 | 2854538776 | 303 |
| 303 | iso_pr_bacteria | 2854548700 | 2854551485 | 303 |
| 304 | iso_pr_bacteria | 2858089842 | 2858090427 | 303 |
| 305 | iso_pr_bacteria | 2858110640 | 2858112463 | 303 |
| 306 | iso_pr_bacteria | 2858119979 | 2858121002 | 303 |
| 307 | 3300042609 | Ga0466722_197953 | Ga0466722_197953_284_1198 | 304 |
| 308 | iso_pr_bacteria | 2831736028 | 2831737772 | 304 |
| 309 | iso_pr_bacteria | 2920413932 | 2920415269 | 304 |
| 310 | 3300005200 | Ga0072940_1077742 | Ga0072940_10777424 | 306 |
| 311 | 3300042636 | Ga0466703_182892 | Ga0466703_182892_280_1242 | 307 |
| 312 | iso_pr_bacteria | 2751185679 | 2752856694 | 307 |
| 313 | iso_pr_bacteria | 2791354941 | 2792068017 | 307 |
| 314 | iso_pr_bacteria | 2834143536 | 2834144233 | 307 |
| 315 | iso_pr_bacteria | 2834160066 | 2834160112 | 307 |
| 316 | iso_pr_bacteria | 2834165886 | 2834167138 | 307 |
| 317 | iso_pr_bacteria | 2899194184 | 2899195229 | 307 |
| 318 | iso_pr_bacteria | 2901819457 | 2901819598 | 307 |
| 319 | iso_pr_bacteria | 2920412021 | 2920413215 | 307 |
| 320 | iso_pr_bacteria | 8074809037 | 8074809163 | 307 |
| 321 | iso_pr_bacteria | 8074810961 | 8074811491 | 307 |
| 322 | iso_pr_bacteria | 8074812948 | 8074814631 | 307 |
| 323 | 3300042615 | Ga0466711_078849 | Ga0466711_078849_62_991 | 309 |
| 324 | 3300042636 | Ga0466703_300979 | Ga0466703_300979_769_1698 | 309 |
| 325 | 3300056857 | Ga0562376_6206 | Ga0562376_6206_1341_2300 | 311 |
| 326 | 3300057007 | Ga0562374_2764 | Ga0562374_2764_2192_3151 | 311 |
| 327 | iso_pr_bacteria | 2837008993 | 2837010606 | 312 |
| 328 | iso_pr_bacteria | 2843073756 | 2843074849 | 312 |
| 329 | iso_pr_bacteria | 2987037630 | 2987038442 | 312 |
| 330 | 3300042598 | Ga0466701_078804 | Ga0466701_078804_5699_6640 | 313 |
| 331 | 3300042614 | Ga0466712_132327 | Ga0466712_132327_1951_2892 | 313 |
| 332 | 3300042601 | Ga0466707_141179 | Ga0466707_141179_173_1117 | 314 |
| 333 | 3300042591 | Ga0466692_167406 | Ga0466692_167406_83530_84480 | 316 |
| 334 | 3300042659 | Ga0466733_200059 | Ga0466733_200059_12105_13055 | 316 |
| 335 | 3300042616 | Ga0466715_341207 | Ga0466715_341207_12084_13079 | 331 |
| 336 | iso_pr_bacteria | 2843904799 | 2843906827 | 331 |
| 337 | 3300042643 | Ga0466704_354424 | Ga0466704_354424_959_1957 | 332 |
| 338 | 3300042652 | Ga0466708_347609 | Ga0466708_347609_9478_10476 | 332 |
| 339 | 3300042606 | Ga0466719_468580 | Ga0466719_468580_17188_18207 | 339 |
| 340 | 3300042610 | Ga0466698_399543 | Ga0466698_399543_1257_2318 | 353 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00483 | GO:0009058 | biosynthetic process | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.