Protein Family IF06945

Metagenome Isolate
138 Members
52 Samples
127 Scaffolds
312.49 Avg Length

🧬 Representative Sequence

ID
3300042610|Ga0466698_245888|Ga0466698_245888_1005_2138
Length
377 aa
Sequence
MPYQQQNNSYHRESKVTRHVTLINYKKSVELSYAYKEKTMQIPEPAKTPAFYFVGVTTGQSSIMKVFPKWAEILGLQADIRGIDLPLHAPPDDYRKAAQFMKDDGLSLGGLVTTHKLDMYKACRDIFDYIDPFGEKLEEVSCLSKKDGQFRAHAKDPITSGLALEAFVPVNYWKEKGGEVLLLGAGGSSLAMSLYFAQEKHSGNMPKRITIANRSEPRLVSAKEALQGLNGQIEFRFVHSPTPKDNDRLIAELPPYSLIVNATGLGKDAPGSPATDSVSFPRDSLVWEINYRGDLLFMRQAQAQQREKNLHVEDGWMYFIHGWTEVIAEVFHIDIDSKVLEKLSAIAQANRRRRIMTGNIEWVSGTAEDFDLLTGLS

📊 Sample Types

Isolate 8.0%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.5%
Kalotermitidae 26.9%
Unclassified 25.0%
Rhinotermitidae 5.8%
Termopsidae 3.8%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
15 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
22 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
23 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
28 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
31 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
36 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
40 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
43 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
44 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
47 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
48 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
50 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
51 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
52 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_156486 3300042615 Bacteria 1469
2 Ga0466692_046639 3300042591 Bacteria 23631
3 Ga0466691_023496 3300042593 Bacteria 5650
4 Ga0466713_066031 3300042602 Bacteria 72966
5 Ga0466717_141080 3300042604 Bacteria 1851
6 Ga0466720_117372 3300042607 Bacteria 29633
7 Ga0466729_228951 3300042621 Bacteria 8066
8 Ga0466709_284196 3300042648 Bacteria 18825
9 Ga0466727_069357 3300042655 Bacteria 5370
10 JGI24698J34947_10044077 3300002449 Bacteria 2285
11 Ga0466705_287142 3300042612 Bacteria 1790
12 Ga0466705_311400 3300042612 Bacteria 2108
13 Ga0466711_284728 3300042615 Bacteria 4554
14 Ga0466723_015663 3300042618 Bacteria 58778
15 Ga0466726_031506 3300042619 Bacteria 7209
16 Ga0415639_163770 3300038395 Bacteria 3216
17 Ga0466696_020290 3300042596 Bacteria 17438
18 Ga0123355_10023791 3300009826 Bacteria 9840
19 Ga0123355_10353025 3300009826 Bacteria 1946
20 Ga0123353_10138693 3300010167 Bacteria 3898
21 Ga0466707_124629 3300042601 Unclassified 1511
22 Ga0466722_207655 3300042609 Bacteria 8578
23 Ga0466698_138998 3300042610 Bacteria 1707
24 Ga0466704_160392 3300042643 Bacteria 3008
25 Ga0466708_436511 3300042652 Bacteria 1840
26 JGI24699J35502_11113011 3300002509 Bacteria 2788
27 Ga0466705_070665 3300042612 Bacteria 7282
28 Ga0466705_082747 3300042612 Bacteria 9066
29 Ga0466705_243783 3300042612 Bacteria 3148
30 Ga0466711_064090 3300042615 Bacteria 1148
31 Ga0466711_304771 3300042615 Bacteria 4133
32 Ga0466723_268749 3300042618 Unclassified 3393
33 Ga0466692_014024 3300042591 Bacteria 3076
34 Ga0466693_202582 3300042592 Bacteria 1057
35 Ga0466691_177490 3300042593 Bacteria 7343
36 Ga0466696_130912 3300042596 Bacteria 3785
37 Ga0123357_10102169 3300009784 Bacteria 3692
38 Ga0123355_10162742 3300009826 Bacteria 3357
39 Ga0123356_10063725 3300010049 Bacteria 3445
40 Ga0466716_060236 3300042605 Bacteria 3922
41 Ga0466716_121255 3300042605 Unclassified 1756
42 Ga0466704_011869 3300042643 Bacteria 7490
43 Ga0466727_256159 3300042655 Bacteria 1193
44 Ga0466712_131579 3300042614 Bacteria 27791
45 Ga0466712_133266 3300042614 Bacteria 38197
46 Ga0466711_274098 3300042615 Bacteria 26177
47 Ga0466723_161634 3300042618 Bacteria 7090
48 Ga0466723_183835 3300042618 Bacteria 1275
49 Ga0466692_123356 3300042591 Bacteria 1092
50 Ga0123357_10024492 3300009784 Unclassified 8126
51 Ga0123357_10171815 3300009784 Bacteria 2561
52 Ga0123357_10329401 3300009784 Bacteria 1495
53 Ga0123356_10082512 3300010049 Bacteria 3043
54 Ga0123353_10133326 3300010167 Bacteria 3985
55 Ga0466716_171734 3300042605 Bacteria 1698
56 Ga0466719_441935 3300042606 Bacteria 11138
57 Ga0466698_245888 3300042610 Unclassified 2247
58 Ga0466703_243022 3300042636 Bacteria 15617
59 Ga0466703_299542 3300042636 Bacteria 22133
60 Ga0466709_018916 3300042648 Bacteria 6081
61 Ga0466725_261980 3300042654 Unclassified 9636
62 JGI24695J34938_10000040 3300002450 Bacteria 97045
63 Ga0466711_205529 3300042615 Bacteria 7137
64 Ga0466691_048165 3300042593 Bacteria 15053
65 Ga0466691_137442 3300042593 Bacteria 18156
66 Ga0466696_294185 3300042596 Bacteria 1178
67 Ga0466696_348667 3300042596 Bacteria 1371
68 Ga0123355_10002234 3300009826 Bacteria 27344
69 Ga0123355_10002319 3300009826 Bacteria 26885
70 Ga0123354_10150574 3300010882 Bacteria 2821
71 Ga0123354_10344883 3300010882 Bacteria 1337
72 Ga0466713_030402 3300042602 Bacteria 14822
73 Ga0466716_490848 3300042605 Bacteria 3806
74 Ga0466719_005015 3300042606 Unclassified 4434
75 Ga0466722_039124 3300042609 Bacteria 4035
76 Ga0466704_063745 3300042643 Bacteria 39367
77 Ga0466704_209227 3300042643 Bacteria 22130
78 JGI24698J34947_10000007 3300002449 Bacteria 54610
79 JGI24695J34938_10003528 3300002450 Bacteria 10845
80 Ga0466718_122724 3300042617 Bacteria 29201
81 Ga0466726_093682 3300042619 Bacteria 1348
82 Ga0466728_445722 3300042620 Bacteria 5382
83 Ga0466699_072488 3300042597 Bacteria 13556
84 Ga0123355_10003626 3300009826 Bacteria 22238
85 Ga0123355_10004233 3300009826 Bacteria 20847
86 Ga0466714_031392 3300042603 Bacteria 2585
87 Ga0466716_211680 3300042605 Bacteria 1043
88 Ga0466722_029222 3300042609 Bacteria 3633
89 Ga0466698_033571 3300042610 Bacteria 3002
90 Ga0466698_335901 3300042610 Bacteria 3820
91 Ga0466703_024190 3300042636 Bacteria 22279
92 Ga0466703_274955 3300042636 Bacteria 2849
93 Ga0466704_297275 3300042643 Bacteria 20574
94 Ga0466727_047615 3300042655 Bacteria 11731
95 Ga0466727_283003 3300042655 Bacteria 2411
96 JGI24695J34938_10019789 3300002450 Bacteria 3325
97 Ga0466705_231821 3300042612 Bacteria 3969
98 Ga0466723_127145 3300042618 Bacteria 6078
99 Ga0466726_345393 3300042619 Bacteria 1736
100 Ga0466691_026214 3300042593 Bacteria 4802
101 Ga0466691_175486 3300042593 Bacteria 12157
102 Ga0466699_231906 3300042597 Bacteria 29115
103 Ga0466707_371544 3300042601 Bacteria 11694
104 Ga0466719_017114 3300042606 Bacteria 8024
105 Ga0466703_046543 3300042636 Bacteria 3580
106 Ga0466704_181791 3300042643 Bacteria 10950
107 Ga0466708_165474 3300042652 Bacteria 34114
108 Ga0466708_341343 3300042652 Bacteria 32119
109 Ga0466708_446124 3300042652 Bacteria 2428
110 JGI24703J35330_11743455 3300002501 Bacteria 3910
111 Ga0466705_193049 3300042612 Bacteria 40502
112 Ga0466732_000909 3300042656 Bacteria 4192
113 Ga0466715_428846 3300042616 Bacteria 3754
114 Ga0466718_153859 3300042617 Bacteria 1509
115 Ga0466723_245079 3300042618 Bacteria 2326
116 Ga0466690_424112 3300042590 Bacteria 2925
117 Ga0466692_119330 3300042591 Bacteria 10335
118 Ga0123356_10072182 3300010049 Bacteria 3242
119 Ga0123356_10693923 3300010049 Unclassified 1187
120 Ga0123356_10791988 3300010049 Bacteria 1119
121 Ga0123353_10356198 3300010167 Bacteria 2202
122 Ga0466719_144230 3300042606 Bacteria 30295
123 Ga0466703_025455 3300042636 Bacteria 6125
124 Ga0466704_226266 3300042643 Bacteria 6083
125 Ga0466704_529865 3300042643 Bacteria 1299
126 Ga0466727_182103 3300042655 Unclassified 7025
127 Ga0466727_334802 3300042655 Unclassified 10764

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_141080 Ga0466717_141080_57_953 298
2 3300042593 Ga0466691_177490 Ga0466691_177490_262_1197 305
3 3300042618 Ga0466723_245079 Ga0466723_245079_1303_2238 305
4 3300042648 Ga0466709_284196 Ga0466709_284196_3063_3998 305
5 3300042652 Ga0466708_165474 Ga0466708_165474_18884_19819 305
6 3300042612 Ga0466705_231821 Ga0466705_231821_293_1213 306
7 3300042655 Ga0466727_182103 Ga0466727_182103_3934_4854 306
8 3300042607 Ga0466720_117372 Ga0466720_117372_4852_5778 308
9 3300042618 Ga0466723_127145 Ga0466723_127145_862_1806 308
10 iso_pr_bacteria 2781125681 2781406651 308
11 iso_pr_bacteria 2820666966 2820667456 308
12 3300002450 JGI24695J34938_10000040 JGI24695J34938_1000004027 309
13 3300002450 JGI24695J34938_10003528 JGI24695J34938_100035289 309
14 3300009826 Ga0123355_10023791 Ga0123355_100237918 309
15 3300009826 Ga0123355_10353025 Ga0123355_103530252 309
16 3300010049 Ga0123356_10082512 Ga0123356_100825122 309
17 3300042591 Ga0466692_014024 Ga0466692_014024_1881_2810 309
18 3300042591 Ga0466692_046639 Ga0466692_046639_20752_21681 309
19 3300042591 Ga0466692_119330 Ga0466692_119330_1989_2918 309
20 3300042591 Ga0466692_123356 Ga0466692_123356_22_951 309
21 3300042606 Ga0466719_441935 Ga0466719_441935_1266_2195 309
22 3300042612 Ga0466705_193049 Ga0466705_193049_16621_17550 309
23 3300042614 Ga0466712_131579 Ga0466712_131579_7383_8312 309
24 3300042614 Ga0466712_133266 Ga0466712_133266_19219_20148 309
25 3300042619 Ga0466726_031506 Ga0466726_031506_4534_5463 309
26 3300042636 Ga0466703_274955 Ga0466703_274955_469_1398 309
27 3300042636 Ga0466703_299542 Ga0466703_299542_5588_6517 309
28 3300042643 Ga0466704_226266 Ga0466704_226266_4331_5260 309
29 3300042652 Ga0466708_446124 Ga0466708_446124_596_1525 309
30 3300042655 Ga0466727_069357 Ga0466727_069357_4177_5106 309
31 3300042655 Ga0466727_283003 Ga0466727_283003_112_1041 309
32 3300042655 Ga0466727_334802 Ga0466727_334802_172_1101 309
33 iso_pr_bacteria 2820533259 2820534368 309
34 iso_pr_bacteria 2820702360 2820702846 309
35 3300002449 JGI24698J34947_10000007 JGI24698J34947_1000000717 310
36 3300002449 JGI24698J34947_10044077 JGI24698J34947_100440772 310
37 3300009826 Ga0123355_10003626 Ga0123355_100036264 310
38 3300010167 Ga0123353_10133326 Ga0123353_101333262 310
39 3300010167 Ga0123353_10138693 Ga0123353_101386933 310
40 3300010167 Ga0123353_10356198 Ga0123353_103561982 310
41 3300042593 Ga0466691_137442 Ga0466691_137442_15640_16572 310
42 3300042605 Ga0466716_060236 Ga0466716_060236_1848_2780 310
43 3300042605 Ga0466716_121255 Ga0466716_121255_744_1676 310
44 3300042606 Ga0466719_005015 Ga0466719_005015_2045_2977 310
45 3300042610 Ga0466698_138998 Ga0466698_138998_694_1626 310
46 3300042610 Ga0466698_335901 Ga0466698_335901_1105_2037 310
47 3300042612 Ga0466705_243783 Ga0466705_243783_2094_3026 310
48 3300042615 Ga0466711_205529 Ga0466711_205529_3381_4313 310
49 3300042636 Ga0466703_025455 Ga0466703_025455_4615_5547 310
50 3300042643 Ga0466704_063745 Ga0466704_063745_11855_12787 310
51 3300042643 Ga0466704_160392 Ga0466704_160392_24_956 310
52 3300042643 Ga0466704_529865 Ga0466704_529865_242_1174 310
53 iso_pr_bacteria 2781125686 2781419451 310
54 3300002509 JGI24699J35502_11113011 JGI24699J35502_111130112 311
55 3300009784 Ga0123357_10171815 Ga0123357_101718154 311
56 3300010882 Ga0123354_10150574 Ga0123354_101505742 311
57 3300010882 Ga0123354_10344883 Ga0123354_103448831 311
58 3300042593 Ga0466691_026214 Ga0466691_026214_492_1427 311
59 3300042593 Ga0466691_048165 Ga0466691_048165_5677_6612 311
60 3300042596 Ga0466696_020290 Ga0466696_020290_10976_11911 311
61 3300042596 Ga0466696_294185 Ga0466696_294185_59_994 311
62 3300042596 Ga0466696_348667 Ga0466696_348667_20_955 311
63 3300042601 Ga0466707_124629 Ga0466707_124629_171_1106 311
64 3300042601 Ga0466707_371544 Ga0466707_371544_2979_3914 311
65 3300042602 Ga0466713_066031 Ga0466713_066031_19573_20508 311
66 3300042605 Ga0466716_211680 Ga0466716_211680_57_992 311
67 3300042609 Ga0466722_029222 Ga0466722_029222_1683_2618 311
68 3300042609 Ga0466722_039124 Ga0466722_039124_477_1412 311
69 3300042609 Ga0466722_207655 Ga0466722_207655_1624_2559 311
70 3300042612 Ga0466705_311400 Ga0466705_311400_357_1292 311
71 3300042615 Ga0466711_064090 Ga0466711_064090_140_1075 311
72 3300042615 Ga0466711_156486 Ga0466711_156486_370_1305 311
73 3300042615 Ga0466711_274098 Ga0466711_274098_8883_9818 311
74 3300042615 Ga0466711_284728 Ga0466711_284728_2205_3140 311
75 3300042615 Ga0466711_304771 Ga0466711_304771_1314_2249 311
76 3300042616 Ga0466715_428846 Ga0466715_428846_584_1519 311
77 3300042617 Ga0466718_122724 Ga0466718_122724_2324_3259 311
78 3300042617 Ga0466718_153859 Ga0466718_153859_253_1188 311
79 3300042619 Ga0466726_093682 Ga0466726_093682_102_1037 311
80 3300042619 Ga0466726_345393 Ga0466726_345393_571_1506 311
81 3300042636 Ga0466703_046543 Ga0466703_046543_2364_3299 311
82 3300042643 Ga0466704_181791 Ga0466704_181791_5429_6364 311
83 3300042648 Ga0466709_018916 Ga0466709_018916_1901_2836 311
84 3300042652 Ga0466708_436511 Ga0466708_436511_598_1533 311
85 iso_pr_bacteria 2820535361 2820537227 311
86 3300009826 Ga0123355_10002234 Ga0123355_1000223410 312
87 3300009826 Ga0123355_10004233 Ga0123355_100042338 312
88 3300042596 Ga0466696_130912 Ga0466696_130912_2178_3116 312
89 3300042597 Ga0466699_231906 Ga0466699_231906_8940_9878 312
90 3300042602 Ga0466713_030402 Ga0466713_030402_5012_5950 312
91 3300042603 Ga0466714_031392 Ga0466714_031392_564_1502 312
92 3300042606 Ga0466719_144230 Ga0466719_144230_9987_10925 312
93 3300042610 Ga0466698_033571 Ga0466698_033571_508_1446 312
94 3300042612 Ga0466705_287142 Ga0466705_287142_23_961 312
95 3300042652 Ga0466708_341343 Ga0466708_341343_15656_16594 312
96 3300042654 Ga0466725_261980 Ga0466725_261980_8175_9113 312
97 3300042655 Ga0466727_047615 Ga0466727_047615_644_1582 312
98 3300042655 Ga0466727_256159 Ga0466727_256159_185_1123 312
99 3300042656 Ga0466732_000909 Ga0466732_000909_503_1441 312
100 iso_pr_bacteria 2820265624 2820266392 312
101 iso_pr_bacteria 2820602899 2820603987 312
102 3300002501 JGI24703J35330_11743455 JGI24703J35330_117434553 313
103 3300009826 Ga0123355_10002319 Ga0123355_100023194 313
104 3300009826 Ga0123355_10162742 Ga0123355_101627424 313
105 3300010049 Ga0123356_10063725 Ga0123356_100637252 313
106 3300010049 Ga0123356_10072182 Ga0123356_100721824 313
107 3300010049 Ga0123356_10693923 Ga0123356_106939231 313
108 3300042592 Ga0466693_202582 Ga0466693_202582_16_957 313
109 3300042643 Ga0466704_011869 Ga0466704_011869_4836_5777 313
110 iso_pr_bacteria 2781125632 2781269852 313
111 3300042621 Ga0466729_228951 Ga0466729_228951_3571_4515 314
112 3300042636 Ga0466703_243022 Ga0466703_243022_2452_3396 314
113 3300042643 Ga0466704_297275 Ga0466704_297275_4296_5240 314
114 3300038395 Ga0415639_163770 Ga0415639_163770_1639_2586 315
115 3300042590 Ga0466690_424112 Ga0466690_424112_1870_2817 315
116 3300042606 Ga0466719_017114 Ga0466719_017114_6766_7713 315
117 3300042612 Ga0466705_070665 Ga0466705_070665_4478_5425 315
118 3300042618 Ga0466723_015663 Ga0466723_015663_24910_25857 315
119 3300042636 Ga0466703_024190 Ga0466703_024190_3586_4533 315
120 iso_pr_bacteria 2820332331 2820332803 315
121 3300009784 Ga0123357_10102169 Ga0123357_101021693 316
122 3300042612 Ga0466705_082747 Ga0466705_082747_1131_2081 316
123 3300042620 Ga0466728_445722 Ga0466728_445722_856_1806 316
124 iso_pr_bacteria 2820573558 2820574503 317
125 3300042593 Ga0466691_175486 Ga0466691_175486_9140_10096 318
126 3300042618 Ga0466723_268749 Ga0466723_268749_2294_3250 318
127 3300042597 Ga0466699_072488 Ga0466699_072488_9890_10849 319
128 3300002450 JGI24695J34938_10019789 JGI24695J34938_100197892 320
129 3300042593 Ga0466691_023496 Ga0466691_023496_957_1919 320
130 3300042605 Ga0466716_490848 Ga0466716_490848_1689_2651 320
131 3300042643 Ga0466704_209227 Ga0466704_209227_14596_15558 320
132 3300042618 Ga0466723_183835 Ga0466723_183835_68_1033 321
133 3300010049 Ga0123356_10791988 Ga0123356_107919881 322
134 3300042605 Ga0466716_171734 Ga0466716_171734_521_1492 323
135 3300042618 Ga0466723_161634 Ga0466723_161634_837_1814 325
136 3300009784 Ga0123357_10024492 Ga0123357_100244928 343
137 3300009784 Ga0123357_10329401 Ga0123357_103294012 346
138 3300042610 Ga0466698_245888 Ga0466698_245888_1005_2138 377

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.