Protein Family IF06919

Metagenome Isolate
154 Members
43 Samples
151 Scaffolds
298.82 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_266365|Ga0466722_266365_3974_5032
Length
352 aa
Sequence
MRYSCRQDLFNKAALKRTSVRARRAKNCKSLCESNRLLQQALDYSVLPWEEEMKAKRIQGTAVRLTAGDRVFYALLDIFLVLXXXXVAVPMWSTITLSFRSNTFIGSNLEGMFLPPWKWSAAAYRALLGNSGFLNAFFNSLKIFVFGVASALFLTIPLAYVLSVRTLPGRKFLNVFILIPYLFNVGLIPSYLVVNRLGLSNHLAAIFLPAAISTYNCLIMRGFFEGIPDELKESARIDGAPEITVLLRIIIPLSKPIIMTIGLYYGVQFWNDFFHAMLYINNNALQPLPILLRNILMATGMNEFVEVSAFGEAPVQAIKAASVFMAAIPMIIAYPFIQKYFTKGTLLGSVKG

📊 Sample Types

Isolate 1.9%
Metagenome 98.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.9%
Kalotermitidae 31.7%
Rhinotermitidae 9.8%
Unclassified 7.3%
Termopsidae 7.3%

🌳 Taxonomy

Archaea 0
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
17 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
34 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
37 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
38 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_001436 3300042612 Bacteria 17855
2 Ga0466705_086011 3300042612 Bacteria 10166
3 Ga0466733_200220 3300042659 Bacteria 1607
4 Ga0415639_010394 3300038395 Bacteria 11605
5 Ga0466690_214071 3300042590 Bacteria 16418
6 Ga0466692_066278 3300042591 Bacteria 3508
7 Ga0466692_143855 3300042591 Bacteria 4958
8 Ga0466692_158720 3300042591 Bacteria 9049
9 Ga0466696_173354 3300042596 Bacteria 2691
10 JGI24695J34938_10004971 3300002450 Bacteria 8484
11 JGI24702J35022_10032062 3300002462 Bacteria 2814
12 Ga0123354_10130109 3300010882 Bacteria 3185
13 Ga0466707_096252 3300042601 Bacteria 1401
14 Ga0466705_414425 3300042612 Bacteria 11317
15 Ga0466726_388923 3300042619 Bacteria 2247
16 Ga0466728_372826 3300042620 Bacteria 1522
17 Ga0466703_098927 3300042636 Bacteria 24801
18 Ga0466709_302691 3300042648 Bacteria 3114
19 Ga0466705_048665 3300042612 Bacteria 8142
20 Ga0466690_390620 3300042590 Bacteria 26148
21 Ga0466691_198638 3300042593 Bacteria 3076
22 Ga0466696_090401 3300042596 Bacteria 10101
23 Ga0466696_188752 3300042596 Bacteria 12694
24 Ga0466699_413953 3300042597 Bacteria 1027
25 AustNasuHG_c1001273 3300000089 Bacteria 9064
26 Ga0466707_338338 3300042601 Bacteria 1277
27 Ga0466714_146583 3300042603 Bacteria 1648
28 Ga0466719_476167 3300042606 Bacteria 2442
29 Ga0466722_166522 3300042609 Bacteria 7319
30 Ga0466715_460929 3300042616 Bacteria 18133
31 Ga0466715_494209 3300042616 Bacteria 17849
32 Ga0466718_097298 3300042617 Bacteria 24857
33 Ga0466704_263674 3300042643 Bacteria 3889
34 Ga0466704_387584 3300042643 Bacteria 5497
35 Ga0466732_121898 3300042656 Bacteria 6061
36 Ga0466733_111851 3300042659 Bacteria 82439
37 Ga0264413_119780 3300024493 Bacteria 4183
38 Ga0466691_111146 3300042593 Unclassified 9805
39 Ga0466694_160356 3300042594 Bacteria 2514
40 Ga0466694_184274 3300042594 Bacteria 1714
41 Ga0466696_060743 3300042596 Unclassified 2220
42 JGI24698J34947_10012555 3300002449 Bacteria 4642
43 Ga0466719_173922 3300042606 Bacteria 34358
44 Ga0466720_081487 3300042607 Bacteria 31706
45 Ga0466720_096828 3300042607 Bacteria 3236
46 Ga0466711_032414 3300042615 Bacteria 20943
47 Ga0466723_166945 3300042618 Unclassified 1688
48 Ga0466723_187469 3300042618 Bacteria 21499
49 Ga0466726_076331 3300042619 Bacteria 1059
50 Ga0466726_196858 3300042619 Bacteria 2327
51 Ga0466704_304046 3300042643 Unclassified 6533
52 Ga0466708_182406 3300042652 Unclassified 1512
53 Ga0466727_019210 3300042655 Bacteria 1707
54 Ga0466705_126222 3300042612 Bacteria 8501
55 Ga0466705_321928 3300042612 Bacteria 28342
56 Ga0466690_012256 3300042590 Bacteria 3296
57 Ga0466690_110981 3300042590 Unclassified 2928
58 Ga0466692_007906 3300042591 Bacteria 2827
59 Ga0466691_079092 3300042593 Bacteria 17061
60 JGI24702J35022_10002316 3300002462 Bacteria 11661
61 Ga0072941_1059593 3300005201 Bacteria 24866
62 Ga0466719_301447 3300042606 Bacteria 7708
63 Ga0466698_433879 3300042610 Bacteria 1914
64 Ga0466715_016671 3300042616 Bacteria 5817
65 Ga0466715_321233 3300042616 Bacteria 2661
66 Ga0466723_337292 3300042618 Bacteria 4769
67 Ga0466726_287535 3300042619 Bacteria 15444
68 Ga0466735_112823 3300042624 Bacteria 3202
69 Ga0466703_087443 3300042636 Bacteria 4567
70 Ga0466703_097372 3300042636 Bacteria 4108
71 Ga0466704_033321 3300042643 Bacteria 22698
72 Ga0466704_045523 3300042643 Bacteria 14134
73 Ga0466709_216249 3300042648 Bacteria 16336
74 Ga0456237_0006060 3300041968 Bacteria 1904
75 Ga0466692_096783 3300042591 Bacteria 19299
76 Ga0466691_043739 3300042593 Bacteria 24323
77 Ga0466696_164791 3300042596 Bacteria 2286
78 Ga0123356_10055329 3300010049 Bacteria 3696
79 Ga0466701_067360 3300042598 Bacteria 1791
80 Ga0466714_095312 3300042603 Bacteria 1839
81 Ga0466719_336365 3300042606 Bacteria 1758
82 Ga0466720_084737 3300042607 Bacteria 18029
83 Ga0466722_157764 3300042609 Bacteria 7540
84 Ga0466722_182467 3300042609 Bacteria 5498
85 Ga0466718_129500 3300042617 Bacteria 1892
86 Ga0466723_357375 3300042618 Bacteria 6207
87 Ga0466726_097959 3300042619 Bacteria 16779
88 Ga0466728_271121 3300042620 Bacteria 1895
89 Ga0466703_051244 3300042636 Bacteria 11307
90 Ga0466703_305461 3300042636 Bacteria 4555
91 Ga0466704_119498 3300042643 Bacteria 6175
92 Ga0466704_295827 3300042643 Unclassified 5131
93 Ga0466709_018963 3300042648 Bacteria 10441
94 Ga0466708_145218 3300042652 Bacteria 21009
95 Ga0466708_277030 3300042652 Bacteria 5021
96 Ga0466727_204874 3300042655 Bacteria 2210
97 Ga0466705_225787 3300042612 Bacteria 6997
98 Ga0466732_118680 3300042656 Bacteria 9111
99 Ga0466733_210161 3300042659 Bacteria 1705
100 Ga0466691_127732 3300042593 Bacteria 11614
101 Ga0466694_105531 3300042594 Bacteria 1669
102 Ga0466694_244312 3300042594 Bacteria 37974
103 JGI24698J34947_10033245 3300002449 Bacteria 2706
104 JGI24695J34938_10025159 3300002450 Bacteria 2850
105 JGI24695J34938_10036787 3300002450 Bacteria 2229
106 Ga0074263_104761 3300005485 Bacteria 8480
107 Ga0466707_109718 3300042601 Bacteria 3954
108 Ga0466722_051815 3300042609 Bacteria 15391
109 Ga0466722_266365 3300042609 Bacteria 11236
110 Ga0466711_126039 3300042615 Bacteria 5250
111 Ga0466718_054451 3300042617 Bacteria 4511
112 Ga0466718_123395 3300042617 Bacteria 3431
113 Ga0466723_174306 3300042618 Bacteria 10443
114 Ga0466728_034310 3300042620 Bacteria 10596
115 Ga0466728_418472 3300042620 Bacteria 9456
116 Ga0466735_012469 3300042624 Bacteria 1706
117 Ga0264413_129109 3300024493 Bacteria 4224
118 Ga0466690_040836 3300042590 Bacteria 3620
119 Ga0466690_073261 3300042590 Bacteria 5050
120 Ga0466690_148172 3300042590 Bacteria 1098
121 Ga0466696_007503 3300042596 Bacteria 10728
122 Ga0466696_224532 3300042596 Bacteria 9727
123 Ga0466696_307974 3300042596 Bacteria 34055
124 JGI24698J34947_10113674 3300002449 Bacteria 1189
125 Ga0123356_10021945 3300010049 Bacteria 6029
126 Ga0466707_344548 3300042601 Bacteria 1430
127 Ga0466722_175899 3300042609 Bacteria 3869
128 Ga0466722_197142 3300042609 Bacteria 8548
129 Ga0466715_238123 3300042616 Bacteria 9038
130 Ga0466723_168978 3300042618 Bacteria 11427
131 Ga0466723_285704 3300042618 Bacteria 3365
132 Ga0466726_137503 3300042619 Bacteria 1228
133 Ga0466728_244014 3300042620 Bacteria 12713
134 Ga0466729_025386 3300042621 Bacteria 1599
135 Ga0466704_479716 3300042643 Bacteria 8080
136 Ga0466727_014358 3300042655 Bacteria 1430
137 Ga0466733_208167 3300042659 Bacteria 31218
138 Ga0466696_043605 3300042596 Unclassified 2761
139 JGI24695J34938_10055692 3300002450 Unclassified 1708
140 Ga0123357_10042466 3300009784 Bacteria 6183
141 Ga0466722_208570 3300042609 Bacteria 1924
142 Ga0466698_176786 3300042610 Bacteria 1778
143 Ga0466705_508012 3300042612 Bacteria 3347
144 Ga0466718_147171 3300042617 Bacteria 1771
145 Ga0466723_293823 3300042618 Bacteria 10602
146 Ga0466728_254581 3300042620 Unclassified 2394
147 Ga0466735_036027 3300042624 Bacteria 2247
148 Ga0466704_021379 3300042643 Bacteria 2605
149 Ga0466704_279924 3300042643 Bacteria 14891
150 Ga0466709_178541 3300042648 Bacteria 10415
151 Ga0466727_217448 3300042655 Bacteria 4917

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042607 Ga0466720_081487 Ga0466720_081487_11876_12769 282
2 3300042617 Ga0466718_147171 Ga0466718_147171_161_1063 285
3 3300005485 Ga0074263_104761 Ga0074263_1047615 287
4 3300042612 Ga0466705_086011 Ga0466705_086011_4353_5255 287
5 3300042615 Ga0466711_032414 Ga0466711_032414_3451_4350 287
6 3300042618 Ga0466723_174306 Ga0466723_174306_891_1793 287
7 3300042643 Ga0466704_033321 Ga0466704_033321_5417_6319 287
8 3300042652 Ga0466708_182406 Ga0466708_182406_416_1321 287
9 3300002449 JGI24698J34947_10113674 JGI24698J34947_101136741 288
10 3300042618 Ga0466723_168978 Ga0466723_168978_4730_5620 288
11 3300042620 Ga0466728_372826 Ga0466728_372826_303_1205 288
12 3300042620 Ga0466728_418472 Ga0466728_418472_3951_4853 289
13 3300042624 Ga0466735_012469 Ga0466735_012469_447_1346 289
14 3300010049 Ga0123356_10021945 Ga0123356_100219453 290
15 3300042616 Ga0466715_016671 Ga0466715_016671_34_948 290
16 3300042593 Ga0466691_111146 Ga0466691_111146_4593_5495 292
17 3300042616 Ga0466715_494209 Ga0466715_494209_7515_8417 292
18 3300042619 Ga0466726_076331 Ga0466726_076331_167_1045 292
19 3300042619 Ga0466726_388923 Ga0466726_388923_1298_2197 292
20 3300042648 Ga0466709_216249 Ga0466709_216249_10809_11723 292
21 3300024493 Ga0264413_129109 Ga0264413_1291092 293
22 3300042598 Ga0466701_067360 Ga0466701_067360_223_1125 293
23 3300042601 Ga0466707_096252 Ga0466707_096252_478_1386 293
24 3300042616 Ga0466715_238123 Ga0466715_238123_3959_4864 293
25 3300042593 Ga0466691_079092 Ga0466691_079092_6294_7196 294
26 3300042607 Ga0466720_084737 Ga0466720_084737_11179_12078 294
27 3300042612 Ga0466705_225787 Ga0466705_225787_2119_3021 294
28 3300042618 Ga0466723_166945 Ga0466723_166945_367_1272 294
29 3300042618 Ga0466723_293823 Ga0466723_293823_6697_7599 294
30 3300042620 Ga0466728_034310 Ga0466728_034310_5760_6662 294
31 3300042643 Ga0466704_045523 Ga0466704_045523_9457_10359 294
32 3300042648 Ga0466709_018963 Ga0466709_018963_4540_5439 294
33 3300042648 Ga0466709_178541 Ga0466709_178541_3933_4838 294
34 3300042648 Ga0466709_302691 Ga0466709_302691_1905_2807 294
35 3300042652 Ga0466708_277030 Ga0466708_277030_587_1489 294
36 3300042655 Ga0466727_014358 Ga0466727_014358_91_993 294
37 3300042606 Ga0466719_476167 Ga0466719_476167_118_1032 295
38 3300042619 Ga0466726_097959 Ga0466726_097959_2342_3229 295
39 3300042616 Ga0466715_460929 Ga0466715_460929_11668_12558 296
40 3300042617 Ga0466718_097298 Ga0466718_097298_6985_7875 296
41 3300042620 Ga0466728_254581 Ga0466728_254581_1146_2051 296
42 3300042594 Ga0466694_244312 Ga0466694_244312_11136_12029 297
43 3300002449 JGI24698J34947_10012555 JGI24698J34947_100125553 298
44 3300038395 Ga0415639_010394 Ga0415639_010394_566_1462 298
45 3300042591 Ga0466692_096783 Ga0466692_096783_16725_17621 298
46 3300042596 Ga0466696_060743 Ga0466696_060743_814_1710 298
47 3300042621 Ga0466729_025386 Ga0466729_025386_615_1511 298
48 3300042624 Ga0466735_036027 Ga0466735_036027_713_1609 298
49 3300042636 Ga0466703_087443 Ga0466703_087443_733_1629 298
50 3300000089 AustNasuHG_c1001273 AustNasuHG_10012735 299
51 3300005201 Ga0072941_1059593 Ga0072941_10595933 299
52 3300042590 Ga0466690_040836 Ga0466690_040836_729_1628 299
53 3300042590 Ga0466690_073261 Ga0466690_073261_1087_1986 299
54 3300042594 Ga0466694_184274 Ga0466694_184274_396_1295 299
55 3300042596 Ga0466696_090401 Ga0466696_090401_6701_7600 299
56 3300042596 Ga0466696_188752 Ga0466696_188752_6116_7015 299
57 3300042601 Ga0466707_109718 Ga0466707_109718_853_1752 299
58 3300042601 Ga0466707_344548 Ga0466707_344548_359_1258 299
59 3300042603 Ga0466714_095312 Ga0466714_095312_521_1420 299
60 3300042603 Ga0466714_146583 Ga0466714_146583_348_1247 299
61 3300042606 Ga0466719_301447 Ga0466719_301447_2957_3877 299
62 3300042606 Ga0466719_336365 Ga0466719_336365_257_1156 299
63 3300042612 Ga0466705_048665 Ga0466705_048665_4711_5610 299
64 3300042616 Ga0466715_321233 Ga0466715_321233_415_1314 299
65 3300042618 Ga0466723_357375 Ga0466723_357375_1968_2867 299
66 3300042619 Ga0466726_137503 Ga0466726_137503_95_994 299
67 3300042619 Ga0466726_196858 Ga0466726_196858_785_1684 299
68 3300042624 Ga0466735_112823 Ga0466735_112823_1470_2369 299
69 3300042636 Ga0466703_305461 Ga0466703_305461_282_1181 299
70 3300042643 Ga0466704_479716 Ga0466704_479716_2591_3490 299
71 3300042659 Ga0466733_111851 Ga0466733_111851_46520_47419 299
72 3300042659 Ga0466733_200220 Ga0466733_200220_394_1293 299
73 3300042659 Ga0466733_208167 Ga0466733_208167_18833_19732 299
74 3300042659 Ga0466733_210161 Ga0466733_210161_644_1543 299
75 iso_pr_bacteria 2781125662 2781336124 299
76 3300041968 Ga0456237_0006060 Ga0456237_0006060_959_1861 300
77 3300042590 Ga0466690_390620 Ga0466690_390620_7248_8150 300
78 3300042591 Ga0466692_066278 Ga0466692_066278_2186_3088 300
79 3300042591 Ga0466692_143855 Ga0466692_143855_903_1805 300
80 3300042591 Ga0466692_158720 Ga0466692_158720_7767_8669 300
81 3300042594 Ga0466694_160356 Ga0466694_160356_1175_2077 300
82 3300042596 Ga0466696_173354 Ga0466696_173354_561_1463 300
83 3300042596 Ga0466696_224532 Ga0466696_224532_4649_5551 300
84 3300042597 Ga0466699_413953 Ga0466699_413953_82_984 300
85 3300042609 Ga0466722_051815 Ga0466722_051815_12490_13392 300
86 3300042609 Ga0466722_157764 Ga0466722_157764_1919_2821 300
87 3300042609 Ga0466722_175899 Ga0466722_175899_2818_3720 300
88 3300042609 Ga0466722_182467 Ga0466722_182467_1142_2044 300
89 3300042610 Ga0466698_176786 Ga0466698_176786_330_1232 300
90 3300042610 Ga0466698_433879 Ga0466698_433879_599_1501 300
91 3300042612 Ga0466705_126222 Ga0466705_126222_7006_7908 300
92 3300042615 Ga0466711_126039 Ga0466711_126039_1704_2606 300
93 3300042617 Ga0466718_054451 Ga0466718_054451_35_937 300
94 3300042617 Ga0466718_123395 Ga0466718_123395_1624_2526 300
95 3300042617 Ga0466718_129500 Ga0466718_129500_246_1148 300
96 3300042618 Ga0466723_187469 Ga0466723_187469_13362_14264 300
97 3300042618 Ga0466723_337292 Ga0466723_337292_2697_3599 300
98 3300042619 Ga0466726_287535 Ga0466726_287535_3220_4122 300
99 3300042636 Ga0466703_098927 Ga0466703_098927_10488_11390 300
100 3300042643 Ga0466704_279924 Ga0466704_279924_9459_10361 300
101 3300042652 Ga0466708_145218 Ga0466708_145218_11678_12580 300
102 3300042655 Ga0466727_019210 Ga0466727_019210_132_1034 300
103 3300042655 Ga0466727_217448 Ga0466727_217448_3640_4542 300
104 3300042656 Ga0466732_121898 Ga0466732_121898_3353_4255 300
105 iso_pr_bacteria 2781125687 2781419835 300
106 3300002449 JGI24698J34947_10033245 JGI24698J34947_100332452 301
107 3300002450 JGI24695J34938_10004971 JGI24695J34938_100049712 301
108 3300002450 JGI24695J34938_10025159 JGI24695J34938_100251593 301
109 3300002450 JGI24695J34938_10036787 JGI24695J34938_100367872 301
110 3300002450 JGI24695J34938_10055692 JGI24695J34938_100556922 301
111 3300002462 JGI24702J35022_10002316 JGI24702J35022_100023167 301
112 3300002462 JGI24702J35022_10032062 JGI24702J35022_100320623 301
113 3300009784 Ga0123357_10042466 Ga0123357_100424663 301
114 3300010049 Ga0123356_10055329 Ga0123356_100553293 301
115 3300024493 Ga0264413_119780 Ga0264413_1197802 301
116 3300042590 Ga0466690_012256 Ga0466690_012256_1873_2778 301
117 3300042594 Ga0466694_105531 Ga0466694_105531_301_1206 301
118 3300042606 Ga0466719_173922 Ga0466719_173922_19058_19963 301
119 3300042609 Ga0466722_166522 Ga0466722_166522_4833_5738 301
120 3300042620 Ga0466728_244014 Ga0466728_244014_4866_5771 301
121 3300042636 Ga0466703_097372 Ga0466703_097372_604_1509 301
122 3300042656 Ga0466732_118680 Ga0466732_118680_6121_7026 301
123 3300042590 Ga0466690_110981 Ga0466690_110981_344_1252 302
124 3300042591 Ga0466692_007906 Ga0466692_007906_497_1405 302
125 3300042593 Ga0466691_127732 Ga0466691_127732_8095_9030 302
126 3300042609 Ga0466722_208570 Ga0466722_208570_401_1309 302
127 3300042643 Ga0466704_263674 Ga0466704_263674_189_1097 302
128 iso_pr_bacteria 2781125687 2781421753 302
129 3300010882 Ga0123354_10130109 Ga0123354_101301093 303
130 3300042590 Ga0466690_148172 Ga0466690_148172_94_1005 303
131 3300042590 Ga0466690_214071 Ga0466690_214071_3677_4588 303
132 3300042593 Ga0466691_043739 Ga0466691_043739_16527_17438 303
133 3300042593 Ga0466691_198638 Ga0466691_198638_811_1722 303
134 3300042596 Ga0466696_164791 Ga0466696_164791_1218_2129 303
135 3300042612 Ga0466705_321928 Ga0466705_321928_12590_13501 303
136 3300042612 Ga0466705_414425 Ga0466705_414425_1432_2343 303
137 3300042612 Ga0466705_508012 Ga0466705_508012_346_1257 303
138 3300042636 Ga0466703_051244 Ga0466703_051244_10309_11220 303
139 3300042643 Ga0466704_021379 Ga0466704_021379_1286_2197 303
140 3300042643 Ga0466704_119498 Ga0466704_119498_2284_3195 303
141 3300042643 Ga0466704_295827 Ga0466704_295827_157_1068 303
142 3300042643 Ga0466704_304046 Ga0466704_304046_5044_5955 303
143 3300042643 Ga0466704_387584 Ga0466704_387584_4448_5359 303
144 3300042655 Ga0466727_204874 Ga0466727_204874_737_1648 303
145 3300042596 Ga0466696_307974 Ga0466696_307974_26328_27242 304
146 3300042609 Ga0466722_197142 Ga0466722_197142_3551_4468 305
147 3300042596 Ga0466696_043605 Ga0466696_043605_1332_2252 306
148 3300042618 Ga0466723_285704 Ga0466723_285704_841_1764 307
149 3300042620 Ga0466728_271121 Ga0466728_271121_431_1354 307
150 3300042596 Ga0466696_007503 Ga0466696_007503_9292_10221 309
151 3300042612 Ga0466705_001436 Ga0466705_001436_1832_2764 310
152 3300042601 Ga0466707_338338 Ga0466707_338338_130_1092 314
153 3300042607 Ga0466720_096828 Ga0466720_096828_666_1631 321
154 3300042609 Ga0466722_266365 Ga0466722_266365_3974_5032 352

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 172 342 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.