Protein Family IF06917
Metagenome
Isolate
226
Members
110
Samples
163
Scaffolds
355.38
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_262071|Ga0466722_262071_17843_19045
- Length
- 400 aa
- Sequence
- MYFVHAYYHCPGVVDAIPAGFVMFEFSCVWLVPIVVTKPAILCYTLAMKMSRKTFGVLSNGKKAHLYVLKAGDITFCLTNLGAAWTSLLVPSKNGRRDDVLLGFSNCDGYLHNGPYLGVTVGRFANRIGGAHFALNGTRYNLDRNDGNNTLHGGFRGFDKQLWKADAYEENEGVFVRFELDSPGGDSGFPGRLKAVVSYGLTRSNEIIASYEASADAPTPVNFTNHAYFNLAGEGRGSILSHEVSLGSSSYVEIDSEYIPTGRLIPVRGTPFDFRTRKPIKQDMRQEFGGSGGPDAPEGYDHCFSIDGDHGKLRPCAEVYEPDSGRTIKVFTTQPGVQFYTGNMLTGIPGKTGSVYSRHTGFCLETGHFPDSPNKSNFPSCIFGPGNDYHEKTVFAFGTE
Sample Types
Isolate
27.9%
Metagenome
72.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
46.7%
Termitidae
15.9%
Kalotermitidae
13.1%
Unclassified
11.2%
Rhinotermitidae
2.8%
Culicidae
2.8%
Termopsidae
2.8%
Blattidae
0.9%
Hodotermitidae
0.9%
Berytidae
0.9%
Passalidae
0.9%
Siricidae
0.9%
Taxonomy
Archaea
0
Bacteria
214
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 8 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 9 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 10 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 11 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 12 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 13 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 14 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 19 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 20 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 21 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 22 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 23 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 24 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 25 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 26 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 27 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 28 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 29 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 30 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 31 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 32 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 33 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 34 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 44 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 45 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 46 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 47 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 48 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 49 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 52 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 57 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 58 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 59 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 60 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 61 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 62 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 63 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 64 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 65 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 66 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 67 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 68 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 69 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 70 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 71 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 72 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 73 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 74 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 75 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 76 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 77 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 78 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 79 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 80 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 81 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 82 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 83 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 84 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 85 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 86 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 87 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 88 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 89 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 90 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 91 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 92 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 93 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 94 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 95 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 96 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 97 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 98 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 99 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 100 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 101 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 102 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 103 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 104 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 105 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 106 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 107 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 108 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 109 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 110 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_068316 | 3300042593 | Bacteria | 35532 |
| 2 | Ga0466696_444106 | 3300042596 | Bacteria | 10449 |
| 3 | Ga0123353_10102833 | 3300010167 | Bacteria | 4605 |
| 4 | Ga0123353_10255696 | 3300010167 | Unclassified | 2709 |
| 5 | Ga0123353_10260592 | 3300010167 | Bacteria | 2678 |
| 6 | Ga0123353_10344492 | 3300010167 | Bacteria | 2249 |
| 7 | Ga0160471_100980 | 3300012812 | Bacteria | 6329 |
| 8 | Ga0466729_252662 | 3300042621 | Bacteria | 3489 |
| 9 | Ga0466702_037390 | 3300042635 | Bacteria | 11627 |
| 10 | Ga0466709_129829 | 3300042648 | Bacteria | 9338 |
| 11 | Ga0466708_193326 | 3300042652 | Bacteria | 1582 |
| 12 | Ga0466713_033541 | 3300042602 | Bacteria | 2265 |
| 13 | Ga0466719_061898 | 3300042606 | Bacteria | 2425 |
| 14 | Ga0466711_209219 | 3300042615 | Bacteria | 6613 |
| 15 | Ga0466715_218489 | 3300042616 | Bacteria | 2432 |
| 16 | Ga0466718_037736 | 3300042617 | Bacteria | 2080 |
| 17 | Ga0466723_199267 | 3300042618 | Bacteria | 3135 |
| 18 | Ga0466723_322739 | 3300042618 | Bacteria | 3633 |
| 19 | Ga0466728_112387 | 3300042620 | Bacteria | 9197 |
| 20 | Ga0466732_224177 | 3300042656 | Bacteria | 2156 |
| 21 | Ga0160435_1001560 | 3300012857 | Unclassified | 5774 |
| 22 | Ga0264413_117078 | 3300024493 | Bacteria | 4176 |
| 23 | Ga0466696_302250 | 3300042596 | Bacteria | 2179 |
| 24 | Ga0123353_10413077 | 3300010167 | Bacteria | 2003 |
| 25 | Ga0123353_10672965 | 3300010167 | Bacteria | 1459 |
| 26 | JGI24695J34938_10008871 | 3300002450 | Bacteria | 5681 |
| 27 | Ga0068305_10508729 | 3300005083 | Bacteria | 6482 |
| 28 | Ga0072940_1095869 | 3300005200 | Bacteria | 10182 |
| 29 | Ga0466703_121691 | 3300042636 | Bacteria | 4585 |
| 30 | Ga0466703_213760 | 3300042636 | Bacteria | 8690 |
| 31 | Ga0466703_306512 | 3300042636 | Bacteria | 50589 |
| 32 | Ga0466704_103406 | 3300042643 | Bacteria | 3120 |
| 33 | Ga0466704_215777 | 3300042643 | Bacteria | 9662 |
| 34 | Ga0466727_157437 | 3300042655 | Bacteria | 2143 |
| 35 | Ga0466715_044539 | 3300042616 | Bacteria | 4328 |
| 36 | Ga0466723_210331 | 3300042618 | Bacteria | 2274 |
| 37 | Ga0466690_107729 | 3300042590 | Bacteria | 2272 |
| 38 | Ga0466694_027531 | 3300042594 | Bacteria | 10377 |
| 39 | Ga0466694_231615 | 3300042594 | Bacteria | 4550 |
| 40 | AustNasuHG_c1005755 | 3300000089 | Bacteria | 4427 |
| 41 | JGI24698J34947_10054940 | 3300002449 | Bacteria | 1986 |
| 42 | Ga0466704_049599 | 3300042643 | Bacteria | 4185 |
| 43 | Ga0466727_069119 | 3300042655 | Bacteria | 1246 |
| 44 | Ga0466716_521334 | 3300042605 | Bacteria | 2429 |
| 45 | Ga0466719_205004 | 3300042606 | Bacteria | 3859 |
| 46 | Ga0466715_080521 | 3300042616 | Bacteria | 10514 |
| 47 | Ga0466723_335847 | 3300042618 | Bacteria | 9423 |
| 48 | Ga0466726_072030 | 3300042619 | Bacteria | 4146 |
| 49 | Ga0466726_073988 | 3300042619 | Bacteria | 4692 |
| 50 | Ga0466728_126343 | 3300042620 | Bacteria | 2430 |
| 51 | Ga0466705_011662 | 3300042612 | Bacteria | 15068 |
| 52 | Ga0466705_050037 | 3300042612 | Bacteria | 2588 |
| 53 | Ga0466732_015511 | 3300042656 | Bacteria | 1763 |
| 54 | Ga0264413_108507 | 3300024493 | Bacteria | 3004 |
| 55 | Ga0466690_087858 | 3300042590 | Bacteria | 2082 |
| 56 | Ga0466690_194875 | 3300042590 | Unclassified | 1650 |
| 57 | Ga0466690_265407 | 3300042590 | Bacteria | 9289 |
| 58 | Ga0466692_001354 | 3300042591 | Bacteria | 5615 |
| 59 | Ga0466694_010477 | 3300042594 | Bacteria | 16833 |
| 60 | Ga0466696_219154 | 3300042596 | Bacteria | 9627 |
| 61 | Ga0466699_015014 | 3300042597 | Bacteria | 13008 |
| 62 | Ga0466699_307388 | 3300042597 | Unclassified | 1986 |
| 63 | IMNBL1DRAFT_c0000780 | 3300000062 | Bacteria | 25177 |
| 64 | Ga0466735_155443 | 3300042624 | Bacteria | 30203 |
| 65 | Ga0466704_156833 | 3300042643 | Bacteria | 2306 |
| 66 | Ga0466704_156946 | 3300042643 | Bacteria | 3001 |
| 67 | Ga0466708_398056 | 3300042652 | Bacteria | 5362 |
| 68 | Ga0466727_286870 | 3300042655 | Bacteria | 16301 |
| 69 | Ga0466700_305544 | 3300042600 | Bacteria | 2626 |
| 70 | Ga0466707_093490 | 3300042601 | Bacteria | 1841 |
| 71 | Ga0466713_144772 | 3300042602 | Bacteria | 8175 |
| 72 | Ga0466716_041329 | 3300042605 | Bacteria | 2983 |
| 73 | Ga0466719_284138 | 3300042606 | Bacteria | 5227 |
| 74 | Ga0466719_510865 | 3300042606 | Bacteria | 6725 |
| 75 | Ga0466720_183960 | 3300042607 | Unclassified | 3719 |
| 76 | Ga0466722_104141 | 3300042609 | Bacteria | 3809 |
| 77 | Ga0466722_181203 | 3300042609 | Bacteria | 46889 |
| 78 | Ga0466715_104280 | 3300042616 | Bacteria | 1364 |
| 79 | Ga0466726_042769 | 3300042619 | Bacteria | 28047 |
| 80 | Ga0466726_274917 | 3300042619 | Bacteria | 1962 |
| 81 | Ga0466696_174752 | 3300042596 | Bacteria | 4303 |
| 82 | Ga0466699_120667 | 3300042597 | Bacteria | 6315 |
| 83 | Ga0466699_223788 | 3300042597 | Bacteria | 7509 |
| 84 | Ga0466699_308453 | 3300042597 | Bacteria | 2440 |
| 85 | Ga0123353_10032421 | 3300010167 | Unclassified | 8113 |
| 86 | Ga0123353_10354927 | 3300010167 | Bacteria | 2207 |
| 87 | Ga0466703_113252 | 3300042636 | Bacteria | 2099 |
| 88 | Ga0466704_078922 | 3300042643 | Bacteria | 6742 |
| 89 | Ga0466708_339785 | 3300042652 | Bacteria | 6606 |
| 90 | Ga0466727_225117 | 3300042655 | Bacteria | 5196 |
| 91 | Ga0466727_253139 | 3300042655 | Bacteria | 9060 |
| 92 | Ga0466706_183331 | 3300042599 | Bacteria | 69025 |
| 93 | Ga0466720_043182 | 3300042607 | Bacteria | 19980 |
| 94 | Ga0466720_043691 | 3300042607 | Bacteria | 5164 |
| 95 | Ga0466720_157834 | 3300042607 | Unclassified | 2238 |
| 96 | Ga0466711_255630 | 3300042615 | Bacteria | 7937 |
| 97 | Ga0466723_035242 | 3300042618 | Bacteria | 2545 |
| 98 | Ga0466732_080089 | 3300042656 | Bacteria | 10952 |
| 99 | Ga0415639_013342 | 3300038395 | Bacteria | 3844 |
| 100 | Ga0466692_143613 | 3300042591 | Bacteria | 3655 |
| 101 | Ga0466693_340263 | 3300042592 | Bacteria | 1495 |
| 102 | Ga0466694_364923 | 3300042594 | Bacteria | 4530 |
| 103 | Ga0123353_10003322 | 3300010167 | Bacteria | 20296 |
| 104 | Ga0072941_1021522 | 3300005201 | Bacteria | 13567 |
| 105 | Ga0466703_071566 | 3300042636 | Bacteria | 3022 |
| 106 | Ga0466703_136395 | 3300042636 | Bacteria | 2305 |
| 107 | Ga0466704_142002 | 3300042643 | Bacteria | 3189 |
| 108 | Ga0466727_033542 | 3300042655 | Bacteria | 1590 |
| 109 | Ga0466719_223946 | 3300042606 | Bacteria | 5422 |
| 110 | Ga0466720_001706 | 3300042607 | Unclassified | 5615 |
| 111 | Ga0466720_050711 | 3300042607 | Bacteria | 42730 |
| 112 | Ga0466722_016024 | 3300042609 | Bacteria | 6843 |
| 113 | Ga0466705_025816 | 3300042612 | Bacteria | 1873 |
| 114 | Ga0466705_345057 | 3300042612 | Unclassified | 3329 |
| 115 | Ga0466732_069461 | 3300042656 | Bacteria | 1180 |
| 116 | Ga0466732_137446 | 3300042656 | Unclassified | 1302 |
| 117 | Ga0466732_411412 | 3300042656 | Bacteria | 4336 |
| 118 | Ga0160447_100066 | 3300012849 | Unclassified | 97109 |
| 119 | Ga0466692_168180 | 3300042591 | Bacteria | 13839 |
| 120 | Ga0466691_036636 | 3300042593 | Bacteria | 4073 |
| 121 | Ga0466691_126427 | 3300042593 | Bacteria | 3568 |
| 122 | Ga0466696_062480 | 3300042596 | Bacteria | 2472 |
| 123 | Ga0466696_419727 | 3300042596 | Bacteria | 8488 |
| 124 | Ga0466699_248577 | 3300042597 | Bacteria | 1660 |
| 125 | Ga0123353_10061115 | 3300010167 | Bacteria | 6042 |
| 126 | Ga0123353_10452287 | 3300010167 | Bacteria | 1890 |
| 127 | Ga0123353_10669899 | 3300010167 | Bacteria | 1464 |
| 128 | AustNasuHG_c1011627 | 3300000089 | Bacteria | 3048 |
| 129 | JGI24695J34938_10026593 | 3300002450 | Bacteria | 2748 |
| 130 | JGI24702J35022_10010145 | 3300002462 | Bacteria | 5275 |
| 131 | Ga0466709_349319 | 3300042648 | Bacteria | 1400 |
| 132 | Ga0466720_062054 | 3300042607 | Bacteria | 2175 |
| 133 | Ga0466720_084636 | 3300042607 | Bacteria | 5100 |
| 134 | Ga0466720_115684 | 3300042607 | Bacteria | 2119 |
| 135 | Ga0466722_262071 | 3300042609 | Bacteria | 23442 |
| 136 | Ga0466718_156416 | 3300042617 | Bacteria | 8512 |
| 137 | Ga0466723_135412 | 3300042618 | Bacteria | 4023 |
| 138 | Ga0466723_265366 | 3300042618 | Bacteria | 1683 |
| 139 | Ga0466723_291981 | 3300042618 | Bacteria | 4621 |
| 140 | Ga0466705_242662 | 3300042612 | Bacteria | 3920 |
| 141 | Ga0264413_114595 | 3300024493 | Bacteria | 7509 |
| 142 | Ga0466690_098241 | 3300042590 | Bacteria | 1788 |
| 143 | Ga0466690_271589 | 3300042590 | Bacteria | 3038 |
| 144 | Ga0466695_197689 | 3300042595 | Bacteria | 7117 |
| 145 | Ga0123353_10057737 | 3300010167 | Bacteria | 6217 |
| 146 | Ga0123353_10588365 | 3300010167 | Bacteria | 1594 |
| 147 | JGI24702J35022_10025894 | 3300002462 | Bacteria | 3163 |
| 148 | Ga0072941_1071690 | 3300005201 | Bacteria | 2751 |
| 149 | Ga0466729_296835 | 3300042621 | Bacteria | 1298 |
| 150 | Ga0466704_427505 | 3300042643 | Unclassified | 2888 |
| 151 | Ga0466709_235300 | 3300042648 | Bacteria | 3694 |
| 152 | Ga0466708_057592 | 3300042652 | Bacteria | 5062 |
| 153 | Ga0466708_210566 | 3300042652 | Bacteria | 12593 |
| 154 | Ga0466727_062817 | 3300042655 | Bacteria | 1634 |
| 155 | Ga0466719_024195 | 3300042606 | Bacteria | 4717 |
| 156 | Ga0466722_005288 | 3300042609 | Bacteria | 5572 |
| 157 | Ga0466722_024179 | 3300042609 | Bacteria | 3770 |
| 158 | Ga0466722_160382 | 3300042609 | Bacteria | 30194 |
| 159 | Ga0466722_228758 | 3300042609 | Bacteria | 3388 |
| 160 | Ga0466712_121768 | 3300042614 | Bacteria | 1998 |
| 161 | Ga0466711_121145 | 3300042615 | Bacteria | 20134 |
| 162 | Ga0466715_032258 | 3300042616 | Bacteria | 5631 |
| 163 | Ga0466726_123882 | 3300042619 | Bacteria | 8125 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_10102833 | Ga0123353_101028331 | 299 |
| 2 | 3300042607 | Ga0466720_157834 | Ga0466720_157834_1303_2226 | 307 |
| 3 | iso_pr_bacteria | 2515154106 | 2515603126 | 323 |
| 4 | iso_pr_bacteria | 2862784999 | 2862785524 | 324 |
| 5 | 3300010167 | Ga0123353_10260592 | Ga0123353_102605922 | 325 |
| 6 | iso_pr_bacteria | 3006667155 | 3006668169 | 330 |
| 7 | 3300042596 | Ga0466696_174752 | Ga0466696_174752_1808_2854 | 331 |
| 8 | 3300005200 | Ga0072940_1095869 | Ga0072940_10958699 | 332 |
| 9 | 3300042656 | Ga0466732_137446 | Ga0466732_137446_182_1207 | 332 |
| 10 | iso_pr_bacteria | 2515154104 | 2515584791 | 332 |
| 11 | 3300010167 | Ga0123353_10061115 | Ga0123353_100611155 | 333 |
| 12 | 3300042596 | Ga0466696_419727 | Ga0466696_419727_5220_6278 | 333 |
| 13 | 3300042597 | Ga0466699_307388 | Ga0466699_307388_951_1958 | 335 |
| 14 | 3300042597 | Ga0466699_308453 | Ga0466699_308453_951_1958 | 335 |
| 15 | 3300042597 | Ga0466699_120667 | Ga0466699_120667_3898_4908 | 336 |
| 16 | 3300042599 | Ga0466706_183331 | Ga0466706_183331_6050_7081 | 336 |
| 17 | 3300042652 | Ga0466708_193326 | Ga0466708_193326_273_1283 | 336 |
| 18 | 3300010167 | Ga0123353_10672965 | Ga0123353_106729651 | 337 |
| 19 | 3300024493 | Ga0264413_117078 | Ga0264413_1170785 | 337 |
| 20 | 3300042597 | Ga0466699_223788 | Ga0466699_223788_1294_2307 | 337 |
| 21 | iso_pr_bacteria | 2781125631 | 2781268715 | 337 |
| 22 | 3300042616 | Ga0466715_104280 | Ga0466715_104280_21_1040 | 339 |
| 23 | iso_pr_bacteria | 2523533511 | 2523589696 | 340 |
| 24 | iso_pr_bacteria | 2820460928 | 2820462051 | 340 |
| 25 | 3300010167 | Ga0123353_10255696 | Ga0123353_102556962 | 341 |
| 26 | 3300042656 | Ga0466732_015511 | Ga0466732_015511_135_1160 | 341 |
| 27 | iso_pr_bacteria | 2910949487 | 2910951798 | 341 |
| 28 | iso_pr_bacteria | 8023747282 | 8023749007 | 341 |
| 29 | iso_pr_bacteria | 8025735396 | 8025739752 | 341 |
| 30 | iso_pr_bacteria | 8069770227 | 8069771952 | 341 |
| 31 | iso_pr_bacteria | 8102169119 | 8102173475 | 341 |
| 32 | 3300010167 | Ga0123353_10032421 | Ga0123353_100324214 | 342 |
| 33 | 3300010167 | Ga0123353_10344492 | Ga0123353_103444921 | 342 |
| 34 | 3300042590 | Ga0466690_194875 | Ga0466690_194875_495_1577 | 343 |
| 35 | 3300042618 | Ga0466723_265366 | Ga0466723_265366_326_1357 | 343 |
| 36 | 3300042619 | Ga0466726_042769 | Ga0466726_042769_24026_25057 | 343 |
| 37 | 3300042619 | Ga0466726_072030 | Ga0466726_072030_1717_2748 | 343 |
| 38 | 3300042619 | Ga0466726_123882 | Ga0466726_123882_3059_4090 | 343 |
| 39 | 3300042624 | Ga0466735_155443 | Ga0466735_155443_28989_30020 | 343 |
| 40 | 3300042655 | Ga0466727_062817 | Ga0466727_062817_78_1109 | 343 |
| 41 | 3300042602 | Ga0466713_033541 | Ga0466713_033541_1204_2238 | 344 |
| 42 | 3300042616 | Ga0466715_218489 | Ga0466715_218489_1109_2143 | 344 |
| 43 | 3300005083 | Ga0068305_10508729 | Ga0068305_105087294 | 345 |
| 44 | 3300010167 | Ga0123353_10354927 | Ga0123353_103549273 | 345 |
| 45 | 3300010167 | Ga0123353_10413077 | Ga0123353_104130772 | 345 |
| 46 | 3300038395 | Ga0415639_013342 | Ga0415639_013342_1639_2676 | 345 |
| 47 | 3300042594 | Ga0466694_010477 | Ga0466694_010477_5845_6882 | 345 |
| 48 | 3300042594 | Ga0466694_364923 | Ga0466694_364923_3190_4227 | 345 |
| 49 | 3300042595 | Ga0466695_197689 | Ga0466695_197689_4404_5441 | 345 |
| 50 | 3300042620 | Ga0466728_112387 | Ga0466728_112387_258_1295 | 345 |
| 51 | 3300042648 | Ga0466709_349319 | Ga0466709_349319_63_1100 | 345 |
| 52 | 3300042655 | Ga0466727_069119 | Ga0466727_069119_67_1104 | 345 |
| 53 | 3300000062 | IMNBL1DRAFT_c0000780 | IMNBL1DRAFT_000078024 | 346 |
| 54 | 3300010167 | Ga0123353_10057737 | Ga0123353_100577376 | 346 |
| 55 | 3300042590 | Ga0466690_107729 | Ga0466690_107729_107_1147 | 346 |
| 56 | 3300042616 | Ga0466715_044539 | Ga0466715_044539_2644_3684 | 346 |
| 57 | 3300042636 | Ga0466703_213760 | Ga0466703_213760_7471_8511 | 346 |
| 58 | 3300042643 | Ga0466704_078922 | Ga0466704_078922_636_1676 | 346 |
| 59 | 3300042652 | Ga0466708_057592 | Ga0466708_057592_2365_3405 | 346 |
| 60 | 3300002462 | JGI24702J35022_10010145 | JGI24702J35022_100101452 | 347 |
| 61 | 3300042590 | Ga0466690_265407 | Ga0466690_265407_5373_6416 | 347 |
| 62 | 3300042596 | Ga0466696_444106 | Ga0466696_444106_1525_2568 | 347 |
| 63 | 3300042607 | Ga0466720_001706 | Ga0466720_001706_19_1062 | 347 |
| 64 | 3300042607 | Ga0466720_043691 | Ga0466720_043691_4103_5146 | 347 |
| 65 | 3300042607 | Ga0466720_062054 | Ga0466720_062054_100_1143 | 347 |
| 66 | 3300042607 | Ga0466720_115684 | Ga0466720_115684_256_1299 | 347 |
| 67 | 3300042607 | Ga0466720_183960 | Ga0466720_183960_1063_2106 | 347 |
| 68 | 3300042617 | Ga0466718_037736 | Ga0466718_037736_223_1266 | 347 |
| 69 | 3300042621 | Ga0466729_296835 | Ga0466729_296835_65_1108 | 347 |
| 70 | 3300042655 | Ga0466727_286870 | Ga0466727_286870_13344_14387 | 347 |
| 71 | 3300042656 | Ga0466732_069461 | Ga0466732_069461_116_1159 | 347 |
| 72 | 3300042656 | Ga0466732_224177 | Ga0466732_224177_769_1812 | 347 |
| 73 | 3300042656 | Ga0466732_411412 | Ga0466732_411412_3171_4214 | 347 |
| 74 | 3300000089 | AustNasuHG_c1005755 | AustNasuHG_10057555 | 348 |
| 75 | 3300002462 | JGI24702J35022_10025894 | JGI24702J35022_100258943 | 348 |
| 76 | 3300005201 | Ga0072941_1021522 | Ga0072941_10215226 | 348 |
| 77 | 3300024493 | Ga0264413_114595 | Ga0264413_1145956 | 348 |
| 78 | 3300042590 | Ga0466690_087858 | Ga0466690_087858_99_1145 | 348 |
| 79 | 3300042590 | Ga0466690_098241 | Ga0466690_098241_133_1179 | 348 |
| 80 | 3300042593 | Ga0466691_036636 | Ga0466691_036636_2756_3802 | 348 |
| 81 | 3300042593 | Ga0466691_068316 | Ga0466691_068316_2245_3291 | 348 |
| 82 | 3300042596 | Ga0466696_062480 | Ga0466696_062480_781_1827 | 348 |
| 83 | 3300042596 | Ga0466696_219154 | Ga0466696_219154_6591_7637 | 348 |
| 84 | 3300042596 | Ga0466696_302250 | Ga0466696_302250_977_2023 | 348 |
| 85 | 3300042601 | Ga0466707_093490 | Ga0466707_093490_89_1135 | 348 |
| 86 | 3300042605 | Ga0466716_041329 | Ga0466716_041329_907_1953 | 348 |
| 87 | 3300042606 | Ga0466719_024195 | Ga0466719_024195_2102_3148 | 348 |
| 88 | 3300042606 | Ga0466719_205004 | Ga0466719_205004_1719_2765 | 348 |
| 89 | 3300042606 | Ga0466719_223946 | Ga0466719_223946_2268_3314 | 348 |
| 90 | 3300042612 | Ga0466705_025816 | Ga0466705_025816_26_1072 | 348 |
| 91 | 3300042612 | Ga0466705_050037 | Ga0466705_050037_559_1605 | 348 |
| 92 | 3300042612 | Ga0466705_242662 | Ga0466705_242662_1392_2438 | 348 |
| 93 | 3300042612 | Ga0466705_345057 | Ga0466705_345057_535_1581 | 348 |
| 94 | 3300042615 | Ga0466711_255630 | Ga0466711_255630_575_1621 | 348 |
| 95 | 3300042616 | Ga0466715_032258 | Ga0466715_032258_268_1314 | 348 |
| 96 | 3300042618 | Ga0466723_035242 | Ga0466723_035242_1342_2388 | 348 |
| 97 | 3300042618 | Ga0466723_135412 | Ga0466723_135412_2871_3917 | 348 |
| 98 | 3300042618 | Ga0466723_199267 | Ga0466723_199267_406_1452 | 348 |
| 99 | 3300042618 | Ga0466723_210331 | Ga0466723_210331_660_1706 | 348 |
| 100 | 3300042618 | Ga0466723_291981 | Ga0466723_291981_1098_2144 | 348 |
| 101 | 3300042618 | Ga0466723_322739 | Ga0466723_322739_793_1839 | 348 |
| 102 | 3300042618 | Ga0466723_335847 | Ga0466723_335847_7706_8752 | 348 |
| 103 | 3300042619 | Ga0466726_274917 | Ga0466726_274917_135_1181 | 348 |
| 104 | 3300042636 | Ga0466703_071566 | Ga0466703_071566_1417_2463 | 348 |
| 105 | 3300042636 | Ga0466703_113252 | Ga0466703_113252_796_1842 | 348 |
| 106 | 3300042636 | Ga0466703_121691 | Ga0466703_121691_1691_2737 | 348 |
| 107 | 3300042636 | Ga0466703_136395 | Ga0466703_136395_858_1904 | 348 |
| 108 | 3300042636 | Ga0466703_306512 | Ga0466703_306512_43420_44466 | 348 |
| 109 | 3300042643 | Ga0466704_142002 | Ga0466704_142002_221_1267 | 348 |
| 110 | 3300042643 | Ga0466704_156833 | Ga0466704_156833_890_1936 | 348 |
| 111 | 3300042643 | Ga0466704_215777 | Ga0466704_215777_50_1096 | 348 |
| 112 | 3300042648 | Ga0466709_129829 | Ga0466709_129829_5560_6606 | 348 |
| 113 | 3300042648 | Ga0466709_235300 | Ga0466709_235300_147_1193 | 348 |
| 114 | 3300042652 | Ga0466708_339785 | Ga0466708_339785_617_1663 | 348 |
| 115 | 3300042652 | Ga0466708_398056 | Ga0466708_398056_3797_4843 | 348 |
| 116 | 3300042655 | Ga0466727_033542 | Ga0466727_033542_371_1417 | 348 |
| 117 | 3300042655 | Ga0466727_157437 | Ga0466727_157437_782_1828 | 348 |
| 118 | 3300042655 | Ga0466727_225117 | Ga0466727_225117_3991_5037 | 348 |
| 119 | 3300042655 | Ga0466727_253139 | Ga0466727_253139_1852_2898 | 348 |
| 120 | 3300042600 | Ga0466700_305544 | Ga0466700_305544_974_2023 | 349 |
| 121 | 3300042609 | Ga0466722_160382 | Ga0466722_160382_26151_27200 | 349 |
| 122 | 3300042606 | Ga0466719_284138 | Ga0466719_284138_2532_3587 | 351 |
| 123 | 3300042606 | Ga0466719_510865 | Ga0466719_510865_4025_5080 | 351 |
| 124 | 3300042614 | Ga0466712_121768 | Ga0466712_121768_724_1779 | 351 |
| 125 | 3300042643 | Ga0466704_427505 | Ga0466704_427505_653_1708 | 351 |
| 126 | 3300002450 | JGI24695J34938_10008871 | JGI24695J34938_100088715 | 352 |
| 127 | 3300005201 | Ga0072941_1071690 | Ga0072941_10716903 | 352 |
| 128 | 3300010167 | Ga0123353_10588365 | Ga0123353_105883651 | 352 |
| 129 | 3300042591 | Ga0466692_001354 | Ga0466692_001354_879_1937 | 352 |
| 130 | 3300042591 | Ga0466692_143613 | Ga0466692_143613_1190_2248 | 352 |
| 131 | 3300042593 | Ga0466691_126427 | Ga0466691_126427_1214_2272 | 352 |
| 132 | 3300042597 | Ga0466699_015014 | Ga0466699_015014_1249_2307 | 352 |
| 133 | 3300042609 | Ga0466722_005288 | Ga0466722_005288_696_1754 | 352 |
| 134 | 3300042609 | Ga0466722_104141 | Ga0466722_104141_2670_3728 | 352 |
| 135 | 3300042609 | Ga0466722_228758 | Ga0466722_228758_848_1906 | 352 |
| 136 | 3300042615 | Ga0466711_121145 | Ga0466711_121145_17560_18618 | 352 |
| 137 | 3300024493 | Ga0264413_108507 | Ga0264413_1085072 | 353 |
| 138 | 3300042597 | Ga0466699_248577 | Ga0466699_248577_167_1228 | 353 |
| 139 | 3300042607 | Ga0466720_043182 | Ga0466720_043182_14668_15729 | 353 |
| 140 | 3300042607 | Ga0466720_050711 | Ga0466720_050711_585_1646 | 353 |
| 141 | 3300042609 | Ga0466722_016024 | Ga0466722_016024_5581_6660 | 353 |
| 142 | 3300042609 | Ga0466722_024179 | Ga0466722_024179_189_1250 | 353 |
| 143 | 3300042609 | Ga0466722_181203 | Ga0466722_181203_2070_3131 | 353 |
| 144 | 3300042620 | Ga0466728_126343 | Ga0466728_126343_1330_2391 | 353 |
| 145 | 3300042652 | Ga0466708_210566 | Ga0466708_210566_9076_10137 | 353 |
| 146 | 3300042656 | Ga0466732_080089 | Ga0466732_080089_9045_10106 | 353 |
| 147 | iso_pr_bacteria | 2781125640 | 2781287016 | 353 |
| 148 | iso_pr_bacteria | 2781125682 | 2781409007 | 353 |
| 149 | 3300000089 | AustNasuHG_c1011627 | AustNasuHG_10116272 | 354 |
| 150 | 3300002450 | JGI24695J34938_10026593 | JGI24695J34938_100265931 | 354 |
| 151 | 3300042612 | Ga0466705_011662 | Ga0466705_011662_11121_12185 | 354 |
| 152 | 3300042615 | Ga0466711_209219 | Ga0466711_209219_4969_6033 | 354 |
| 153 | 3300042643 | Ga0466704_156946 | Ga0466704_156946_1525_2589 | 354 |
| 154 | 3300002449 | JGI24698J34947_10054940 | JGI24698J34947_100549402 | 355 |
| 155 | 3300010167 | Ga0123353_10452287 | Ga0123353_104522872 | 355 |
| 156 | 3300010167 | Ga0123353_10669899 | Ga0123353_106698992 | 355 |
| 157 | 3300042602 | Ga0466713_144772 | Ga0466713_144772_5310_6377 | 355 |
| 158 | 3300042635 | Ga0466702_037390 | Ga0466702_037390_3483_4550 | 355 |
| 159 | iso_pr_bacteria | 2820857933 | 2820858538 | 356 |
| 160 | 3300010167 | Ga0123353_10003322 | Ga0123353_100033226 | 357 |
| 161 | 3300042605 | Ga0466716_521334 | Ga0466716_521334_945_2018 | 357 |
| 162 | 3300042617 | Ga0466718_156416 | Ga0466718_156416_4473_5549 | 358 |
| 163 | 3300042619 | Ga0466726_073988 | Ga0466726_073988_614_1690 | 358 |
| 164 | 3300042621 | Ga0466729_252662 | Ga0466729_252662_2081_3157 | 358 |
| 165 | 3300042607 | Ga0466720_084636 | Ga0466720_084636_2218_3297 | 359 |
| 166 | iso_pr_bacteria | 2781125693 | 2781433369 | 359 |
| 167 | 3300042590 | Ga0466690_271589 | Ga0466690_271589_1153_2235 | 360 |
| 168 | 3300042592 | Ga0466693_340263 | Ga0466693_340263_125_1207 | 360 |
| 169 | 3300042594 | Ga0466694_027531 | Ga0466694_027531_5395_6477 | 360 |
| 170 | 3300042606 | Ga0466719_061898 | Ga0466719_061898_739_1821 | 360 |
| 171 | 3300042643 | Ga0466704_103406 | Ga0466704_103406_297_1379 | 360 |
| 172 | 3300042616 | Ga0466715_080521 | Ga0466715_080521_7051_8136 | 361 |
| 173 | 3300042594 | Ga0466694_231615 | Ga0466694_231615_229_1317 | 362 |
| 174 | iso_pr_bacteria | 8078130113 | 8078135478 | 365 |
| 175 | 3300042591 | Ga0466692_168180 | Ga0466692_168180_5365_6501 | 378 |
| 176 | iso_pr_bacteria | 8023752828 | 8023757027 | 380 |
| 177 | iso_pr_bacteria | 8024014383 | 8024018933 | 380 |
| 178 | iso_pr_bacteria | 8024044713 | 8024050169 | 380 |
| 179 | iso_pr_bacteria | 8025666332 | 8025669295 | 380 |
| 180 | iso_pr_bacteria | 8069775773 | 8069779972 | 380 |
| 181 | iso_pr_bacteria | 8102020860 | 8102025178 | 380 |
| 182 | iso_pr_bacteria | 8102054868 | 8102058950 | 380 |
| 183 | iso_pr_bacteria | 8102081745 | 8102085879 | 380 |
| 184 | iso_pr_bacteria | 8102246966 | 8102249929 | 380 |
| 185 | 3300042643 | Ga0466704_049599 | Ga0466704_049599_2317_3465 | 382 |
| 186 | iso_pr_bacteria | 8025708040 | 8025712873 | 383 |
| 187 | iso_pr_bacteria | 8102014801 | 8102020337 | 383 |
| 188 | iso_pr_bacteria | 8102094248 | 8102098885 | 383 |
| 189 | iso_pr_bacteria | 8102193924 | 8102198755 | 383 |
| 190 | 3300012857 | Ga0160435_1001560 | Ga0160435_10015604 | 384 |
| 191 | iso_pr_bacteria | 8024037630 | 8024042647 | 384 |
| 192 | iso_pr_bacteria | 8025716094 | 8025720136 | 384 |
| 193 | iso_pr_bacteria | 8025740903 | 8025745250 | 384 |
| 194 | iso_pr_bacteria | 8069748016 | 8069754845 | 384 |
| 195 | iso_pr_bacteria | 8069763219 | 8069767566 | 384 |
| 196 | iso_pr_bacteria | 8101951471 | 8101955867 | 384 |
| 197 | iso_pr_bacteria | 8101960468 | 8101964821 | 384 |
| 198 | iso_pr_bacteria | 8101967387 | 8101971735 | 384 |
| 199 | iso_pr_bacteria | 8101974301 | 8101978666 | 384 |
| 200 | iso_pr_bacteria | 8101981714 | 8101985928 | 384 |
| 201 | iso_pr_bacteria | 8101988189 | 8101992389 | 384 |
| 202 | iso_pr_bacteria | 8101994502 | 8101998846 | 384 |
| 203 | iso_pr_bacteria | 8102001125 | 8102005466 | 384 |
| 204 | iso_pr_bacteria | 8102007614 | 8102011952 | 384 |
| 205 | iso_pr_bacteria | 8102026984 | 8102031341 | 384 |
| 206 | iso_pr_bacteria | 8102033761 | 8102039343 | 384 |
| 207 | iso_pr_bacteria | 8102047609 | 8102052012 | 384 |
| 208 | iso_pr_bacteria | 8102067727 | 8102072037 | 384 |
| 209 | iso_pr_bacteria | 8102102351 | 8102107179 | 384 |
| 210 | iso_pr_bacteria | 8102109360 | 8102113714 | 384 |
| 211 | iso_pr_bacteria | 8102117041 | 8102121599 | 384 |
| 212 | iso_pr_bacteria | 8102124461 | 8102129238 | 384 |
| 213 | iso_pr_bacteria | 8102131453 | 8102133841 | 384 |
| 214 | iso_pr_bacteria | 8102186987 | 8102191027 | 384 |
| 215 | iso_pr_bacteria | 8102264549 | 8102269706 | 384 |
| 216 | iso_pr_bacteria | 8102271933 | 8102277097 | 384 |
| 217 | iso_pr_bacteria | 8102279326 | 8102284590 | 384 |
| 218 | iso_pr_bacteria | 8102286609 | 8102291975 | 384 |
| 219 | iso_pr_bacteria | 8102312426 | 8102316681 | 384 |
| 220 | 3300012812 | Ga0160471_100980 | Ga0160471_1009807 | 385 |
| 221 | 3300012849 | Ga0160447_100066 | Ga0160447_10006671 | 385 |
| 222 | iso_pr_bacteria | 8025723035 | 8025726981 | 386 |
| 223 | iso_pr_bacteria | 8102181083 | 8102185029 | 386 |
| 224 | iso_pr_bacteria | 8024025509 | 8024030543 | 392 |
| 225 | 3300042609 | Ga0466722_262071 | Ga0466722_262071_17843_19045 | 400 |
| 226 | iso_pr_bacteria | 8102138357 | 8102142830 | 400 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01263 | Aldose_epim | Aldose 1-epimerase | 66 | 395 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.93 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.