Protein Family IF06917

Metagenome Isolate
226 Members
110 Samples
163 Scaffolds
355.38 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_262071|Ga0466722_262071_17843_19045
Length
400 aa
Sequence
MYFVHAYYHCPGVVDAIPAGFVMFEFSCVWLVPIVVTKPAILCYTLAMKMSRKTFGVLSNGKKAHLYVLKAGDITFCLTNLGAAWTSLLVPSKNGRRDDVLLGFSNCDGYLHNGPYLGVTVGRFANRIGGAHFALNGTRYNLDRNDGNNTLHGGFRGFDKQLWKADAYEENEGVFVRFELDSPGGDSGFPGRLKAVVSYGLTRSNEIIASYEASADAPTPVNFTNHAYFNLAGEGRGSILSHEVSLGSSSYVEIDSEYIPTGRLIPVRGTPFDFRTRKPIKQDMRQEFGGSGGPDAPEGYDHCFSIDGDHGKLRPCAEVYEPDSGRTIKVFTTQPGVQFYTGNMLTGIPGKTGSVYSRHTGFCLETGHFPDSPNKSNFPSCIFGPGNDYHEKTVFAFGTE

πŸ“Š Sample Types

Isolate 27.9%
Metagenome 72.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Coreidae 46.7%
Termitidae 15.9%
Kalotermitidae 13.1%
Unclassified 11.2%
Rhinotermitidae 2.8%
Culicidae 2.8%
Termopsidae 2.8%
Blattidae 0.9%
Hodotermitidae 0.9%
Berytidae 0.9%
Passalidae 0.9%
Siricidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 214
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
8 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
9 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
10 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
11 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
12 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
13 8102102351 Caballeronia sp. INML1 Isolate Coreidae
14 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
19 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
20 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
21 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
22 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
23 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
24 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
25 3006667155 Streptomyces sp. SID9727 Isolate
26 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
27 2862784999 Streptomyces sp. M41 Isolate Unclassified
28 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
29 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
30 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
31 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
32 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
33 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
34 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
38 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
44 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
45 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
46 8102117041 Caballeronia sp. INML3 Isolate Coreidae
47 8102131453 Caballeronia sp. INML5 Isolate Coreidae
48 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
49 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
50 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
51 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
52 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
53 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
54 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
55 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
56 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
57 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
58 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
59 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
60 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
61 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
62 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
63 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
64 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
65 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
66 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
67 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
68 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
69 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
70 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
71 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
72 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
73 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
74 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
75 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
76 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
77 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
78 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
79 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
80 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
81 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
82 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
83 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
84 8069748016 Caballeronia sp. LP003 Isolate Coreidae
85 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
86 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
87 8102109360 Caballeronia sp. INML2 Isolate Coreidae
88 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
89 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
90 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
91 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
92 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
93 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
94 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
95 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
96 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
97 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
98 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
99 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
100 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
101 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
102 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
103 8102124461 Caballeronia sp. INML3B Isolate Coreidae
104 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
105 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
106 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
107 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
108 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
109 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
110 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466691_068316 3300042593 Bacteria 35532
2 Ga0466696_444106 3300042596 Bacteria 10449
3 Ga0123353_10102833 3300010167 Bacteria 4605
4 Ga0123353_10255696 3300010167 Unclassified 2709
5 Ga0123353_10260592 3300010167 Bacteria 2678
6 Ga0123353_10344492 3300010167 Bacteria 2249
7 Ga0160471_100980 3300012812 Bacteria 6329
8 Ga0466729_252662 3300042621 Bacteria 3489
9 Ga0466702_037390 3300042635 Bacteria 11627
10 Ga0466709_129829 3300042648 Bacteria 9338
11 Ga0466708_193326 3300042652 Bacteria 1582
12 Ga0466713_033541 3300042602 Bacteria 2265
13 Ga0466719_061898 3300042606 Bacteria 2425
14 Ga0466711_209219 3300042615 Bacteria 6613
15 Ga0466715_218489 3300042616 Bacteria 2432
16 Ga0466718_037736 3300042617 Bacteria 2080
17 Ga0466723_199267 3300042618 Bacteria 3135
18 Ga0466723_322739 3300042618 Bacteria 3633
19 Ga0466728_112387 3300042620 Bacteria 9197
20 Ga0466732_224177 3300042656 Bacteria 2156
21 Ga0160435_1001560 3300012857 Unclassified 5774
22 Ga0264413_117078 3300024493 Bacteria 4176
23 Ga0466696_302250 3300042596 Bacteria 2179
24 Ga0123353_10413077 3300010167 Bacteria 2003
25 Ga0123353_10672965 3300010167 Bacteria 1459
26 JGI24695J34938_10008871 3300002450 Bacteria 5681
27 Ga0068305_10508729 3300005083 Bacteria 6482
28 Ga0072940_1095869 3300005200 Bacteria 10182
29 Ga0466703_121691 3300042636 Bacteria 4585
30 Ga0466703_213760 3300042636 Bacteria 8690
31 Ga0466703_306512 3300042636 Bacteria 50589
32 Ga0466704_103406 3300042643 Bacteria 3120
33 Ga0466704_215777 3300042643 Bacteria 9662
34 Ga0466727_157437 3300042655 Bacteria 2143
35 Ga0466715_044539 3300042616 Bacteria 4328
36 Ga0466723_210331 3300042618 Bacteria 2274
37 Ga0466690_107729 3300042590 Bacteria 2272
38 Ga0466694_027531 3300042594 Bacteria 10377
39 Ga0466694_231615 3300042594 Bacteria 4550
40 AustNasuHG_c1005755 3300000089 Bacteria 4427
41 JGI24698J34947_10054940 3300002449 Bacteria 1986
42 Ga0466704_049599 3300042643 Bacteria 4185
43 Ga0466727_069119 3300042655 Bacteria 1246
44 Ga0466716_521334 3300042605 Bacteria 2429
45 Ga0466719_205004 3300042606 Bacteria 3859
46 Ga0466715_080521 3300042616 Bacteria 10514
47 Ga0466723_335847 3300042618 Bacteria 9423
48 Ga0466726_072030 3300042619 Bacteria 4146
49 Ga0466726_073988 3300042619 Bacteria 4692
50 Ga0466728_126343 3300042620 Bacteria 2430
51 Ga0466705_011662 3300042612 Bacteria 15068
52 Ga0466705_050037 3300042612 Bacteria 2588
53 Ga0466732_015511 3300042656 Bacteria 1763
54 Ga0264413_108507 3300024493 Bacteria 3004
55 Ga0466690_087858 3300042590 Bacteria 2082
56 Ga0466690_194875 3300042590 Unclassified 1650
57 Ga0466690_265407 3300042590 Bacteria 9289
58 Ga0466692_001354 3300042591 Bacteria 5615
59 Ga0466694_010477 3300042594 Bacteria 16833
60 Ga0466696_219154 3300042596 Bacteria 9627
61 Ga0466699_015014 3300042597 Bacteria 13008
62 Ga0466699_307388 3300042597 Unclassified 1986
63 IMNBL1DRAFT_c0000780 3300000062 Bacteria 25177
64 Ga0466735_155443 3300042624 Bacteria 30203
65 Ga0466704_156833 3300042643 Bacteria 2306
66 Ga0466704_156946 3300042643 Bacteria 3001
67 Ga0466708_398056 3300042652 Bacteria 5362
68 Ga0466727_286870 3300042655 Bacteria 16301
69 Ga0466700_305544 3300042600 Bacteria 2626
70 Ga0466707_093490 3300042601 Bacteria 1841
71 Ga0466713_144772 3300042602 Bacteria 8175
72 Ga0466716_041329 3300042605 Bacteria 2983
73 Ga0466719_284138 3300042606 Bacteria 5227
74 Ga0466719_510865 3300042606 Bacteria 6725
75 Ga0466720_183960 3300042607 Unclassified 3719
76 Ga0466722_104141 3300042609 Bacteria 3809
77 Ga0466722_181203 3300042609 Bacteria 46889
78 Ga0466715_104280 3300042616 Bacteria 1364
79 Ga0466726_042769 3300042619 Bacteria 28047
80 Ga0466726_274917 3300042619 Bacteria 1962
81 Ga0466696_174752 3300042596 Bacteria 4303
82 Ga0466699_120667 3300042597 Bacteria 6315
83 Ga0466699_223788 3300042597 Bacteria 7509
84 Ga0466699_308453 3300042597 Bacteria 2440
85 Ga0123353_10032421 3300010167 Unclassified 8113
86 Ga0123353_10354927 3300010167 Bacteria 2207
87 Ga0466703_113252 3300042636 Bacteria 2099
88 Ga0466704_078922 3300042643 Bacteria 6742
89 Ga0466708_339785 3300042652 Bacteria 6606
90 Ga0466727_225117 3300042655 Bacteria 5196
91 Ga0466727_253139 3300042655 Bacteria 9060
92 Ga0466706_183331 3300042599 Bacteria 69025
93 Ga0466720_043182 3300042607 Bacteria 19980
94 Ga0466720_043691 3300042607 Bacteria 5164
95 Ga0466720_157834 3300042607 Unclassified 2238
96 Ga0466711_255630 3300042615 Bacteria 7937
97 Ga0466723_035242 3300042618 Bacteria 2545
98 Ga0466732_080089 3300042656 Bacteria 10952
99 Ga0415639_013342 3300038395 Bacteria 3844
100 Ga0466692_143613 3300042591 Bacteria 3655
101 Ga0466693_340263 3300042592 Bacteria 1495
102 Ga0466694_364923 3300042594 Bacteria 4530
103 Ga0123353_10003322 3300010167 Bacteria 20296
104 Ga0072941_1021522 3300005201 Bacteria 13567
105 Ga0466703_071566 3300042636 Bacteria 3022
106 Ga0466703_136395 3300042636 Bacteria 2305
107 Ga0466704_142002 3300042643 Bacteria 3189
108 Ga0466727_033542 3300042655 Bacteria 1590
109 Ga0466719_223946 3300042606 Bacteria 5422
110 Ga0466720_001706 3300042607 Unclassified 5615
111 Ga0466720_050711 3300042607 Bacteria 42730
112 Ga0466722_016024 3300042609 Bacteria 6843
113 Ga0466705_025816 3300042612 Bacteria 1873
114 Ga0466705_345057 3300042612 Unclassified 3329
115 Ga0466732_069461 3300042656 Bacteria 1180
116 Ga0466732_137446 3300042656 Unclassified 1302
117 Ga0466732_411412 3300042656 Bacteria 4336
118 Ga0160447_100066 3300012849 Unclassified 97109
119 Ga0466692_168180 3300042591 Bacteria 13839
120 Ga0466691_036636 3300042593 Bacteria 4073
121 Ga0466691_126427 3300042593 Bacteria 3568
122 Ga0466696_062480 3300042596 Bacteria 2472
123 Ga0466696_419727 3300042596 Bacteria 8488
124 Ga0466699_248577 3300042597 Bacteria 1660
125 Ga0123353_10061115 3300010167 Bacteria 6042
126 Ga0123353_10452287 3300010167 Bacteria 1890
127 Ga0123353_10669899 3300010167 Bacteria 1464
128 AustNasuHG_c1011627 3300000089 Bacteria 3048
129 JGI24695J34938_10026593 3300002450 Bacteria 2748
130 JGI24702J35022_10010145 3300002462 Bacteria 5275
131 Ga0466709_349319 3300042648 Bacteria 1400
132 Ga0466720_062054 3300042607 Bacteria 2175
133 Ga0466720_084636 3300042607 Bacteria 5100
134 Ga0466720_115684 3300042607 Bacteria 2119
135 Ga0466722_262071 3300042609 Bacteria 23442
136 Ga0466718_156416 3300042617 Bacteria 8512
137 Ga0466723_135412 3300042618 Bacteria 4023
138 Ga0466723_265366 3300042618 Bacteria 1683
139 Ga0466723_291981 3300042618 Bacteria 4621
140 Ga0466705_242662 3300042612 Bacteria 3920
141 Ga0264413_114595 3300024493 Bacteria 7509
142 Ga0466690_098241 3300042590 Bacteria 1788
143 Ga0466690_271589 3300042590 Bacteria 3038
144 Ga0466695_197689 3300042595 Bacteria 7117
145 Ga0123353_10057737 3300010167 Bacteria 6217
146 Ga0123353_10588365 3300010167 Bacteria 1594
147 JGI24702J35022_10025894 3300002462 Bacteria 3163
148 Ga0072941_1071690 3300005201 Bacteria 2751
149 Ga0466729_296835 3300042621 Bacteria 1298
150 Ga0466704_427505 3300042643 Unclassified 2888
151 Ga0466709_235300 3300042648 Bacteria 3694
152 Ga0466708_057592 3300042652 Bacteria 5062
153 Ga0466708_210566 3300042652 Bacteria 12593
154 Ga0466727_062817 3300042655 Bacteria 1634
155 Ga0466719_024195 3300042606 Bacteria 4717
156 Ga0466722_005288 3300042609 Bacteria 5572
157 Ga0466722_024179 3300042609 Bacteria 3770
158 Ga0466722_160382 3300042609 Bacteria 30194
159 Ga0466722_228758 3300042609 Bacteria 3388
160 Ga0466712_121768 3300042614 Bacteria 1998
161 Ga0466711_121145 3300042615 Bacteria 20134
162 Ga0466715_032258 3300042616 Bacteria 5631
163 Ga0466726_123882 3300042619 Bacteria 8125

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10102833 Ga0123353_101028331 299
2 3300042607 Ga0466720_157834 Ga0466720_157834_1303_2226 307
3 iso_pr_bacteria 2515154106 2515603126 323
4 iso_pr_bacteria 2862784999 2862785524 324
5 3300010167 Ga0123353_10260592 Ga0123353_102605922 325
6 iso_pr_bacteria 3006667155 3006668169 330
7 3300042596 Ga0466696_174752 Ga0466696_174752_1808_2854 331
8 3300005200 Ga0072940_1095869 Ga0072940_10958699 332
9 3300042656 Ga0466732_137446 Ga0466732_137446_182_1207 332
10 iso_pr_bacteria 2515154104 2515584791 332
11 3300010167 Ga0123353_10061115 Ga0123353_100611155 333
12 3300042596 Ga0466696_419727 Ga0466696_419727_5220_6278 333
13 3300042597 Ga0466699_307388 Ga0466699_307388_951_1958 335
14 3300042597 Ga0466699_308453 Ga0466699_308453_951_1958 335
15 3300042597 Ga0466699_120667 Ga0466699_120667_3898_4908 336
16 3300042599 Ga0466706_183331 Ga0466706_183331_6050_7081 336
17 3300042652 Ga0466708_193326 Ga0466708_193326_273_1283 336
18 3300010167 Ga0123353_10672965 Ga0123353_106729651 337
19 3300024493 Ga0264413_117078 Ga0264413_1170785 337
20 3300042597 Ga0466699_223788 Ga0466699_223788_1294_2307 337
21 iso_pr_bacteria 2781125631 2781268715 337
22 3300042616 Ga0466715_104280 Ga0466715_104280_21_1040 339
23 iso_pr_bacteria 2523533511 2523589696 340
24 iso_pr_bacteria 2820460928 2820462051 340
25 3300010167 Ga0123353_10255696 Ga0123353_102556962 341
26 3300042656 Ga0466732_015511 Ga0466732_015511_135_1160 341
27 iso_pr_bacteria 2910949487 2910951798 341
28 iso_pr_bacteria 8023747282 8023749007 341
29 iso_pr_bacteria 8025735396 8025739752 341
30 iso_pr_bacteria 8069770227 8069771952 341
31 iso_pr_bacteria 8102169119 8102173475 341
32 3300010167 Ga0123353_10032421 Ga0123353_100324214 342
33 3300010167 Ga0123353_10344492 Ga0123353_103444921 342
34 3300042590 Ga0466690_194875 Ga0466690_194875_495_1577 343
35 3300042618 Ga0466723_265366 Ga0466723_265366_326_1357 343
36 3300042619 Ga0466726_042769 Ga0466726_042769_24026_25057 343
37 3300042619 Ga0466726_072030 Ga0466726_072030_1717_2748 343
38 3300042619 Ga0466726_123882 Ga0466726_123882_3059_4090 343
39 3300042624 Ga0466735_155443 Ga0466735_155443_28989_30020 343
40 3300042655 Ga0466727_062817 Ga0466727_062817_78_1109 343
41 3300042602 Ga0466713_033541 Ga0466713_033541_1204_2238 344
42 3300042616 Ga0466715_218489 Ga0466715_218489_1109_2143 344
43 3300005083 Ga0068305_10508729 Ga0068305_105087294 345
44 3300010167 Ga0123353_10354927 Ga0123353_103549273 345
45 3300010167 Ga0123353_10413077 Ga0123353_104130772 345
46 3300038395 Ga0415639_013342 Ga0415639_013342_1639_2676 345
47 3300042594 Ga0466694_010477 Ga0466694_010477_5845_6882 345
48 3300042594 Ga0466694_364923 Ga0466694_364923_3190_4227 345
49 3300042595 Ga0466695_197689 Ga0466695_197689_4404_5441 345
50 3300042620 Ga0466728_112387 Ga0466728_112387_258_1295 345
51 3300042648 Ga0466709_349319 Ga0466709_349319_63_1100 345
52 3300042655 Ga0466727_069119 Ga0466727_069119_67_1104 345
53 3300000062 IMNBL1DRAFT_c0000780 IMNBL1DRAFT_000078024 346
54 3300010167 Ga0123353_10057737 Ga0123353_100577376 346
55 3300042590 Ga0466690_107729 Ga0466690_107729_107_1147 346
56 3300042616 Ga0466715_044539 Ga0466715_044539_2644_3684 346
57 3300042636 Ga0466703_213760 Ga0466703_213760_7471_8511 346
58 3300042643 Ga0466704_078922 Ga0466704_078922_636_1676 346
59 3300042652 Ga0466708_057592 Ga0466708_057592_2365_3405 346
60 3300002462 JGI24702J35022_10010145 JGI24702J35022_100101452 347
61 3300042590 Ga0466690_265407 Ga0466690_265407_5373_6416 347
62 3300042596 Ga0466696_444106 Ga0466696_444106_1525_2568 347
63 3300042607 Ga0466720_001706 Ga0466720_001706_19_1062 347
64 3300042607 Ga0466720_043691 Ga0466720_043691_4103_5146 347
65 3300042607 Ga0466720_062054 Ga0466720_062054_100_1143 347
66 3300042607 Ga0466720_115684 Ga0466720_115684_256_1299 347
67 3300042607 Ga0466720_183960 Ga0466720_183960_1063_2106 347
68 3300042617 Ga0466718_037736 Ga0466718_037736_223_1266 347
69 3300042621 Ga0466729_296835 Ga0466729_296835_65_1108 347
70 3300042655 Ga0466727_286870 Ga0466727_286870_13344_14387 347
71 3300042656 Ga0466732_069461 Ga0466732_069461_116_1159 347
72 3300042656 Ga0466732_224177 Ga0466732_224177_769_1812 347
73 3300042656 Ga0466732_411412 Ga0466732_411412_3171_4214 347
74 3300000089 AustNasuHG_c1005755 AustNasuHG_10057555 348
75 3300002462 JGI24702J35022_10025894 JGI24702J35022_100258943 348
76 3300005201 Ga0072941_1021522 Ga0072941_10215226 348
77 3300024493 Ga0264413_114595 Ga0264413_1145956 348
78 3300042590 Ga0466690_087858 Ga0466690_087858_99_1145 348
79 3300042590 Ga0466690_098241 Ga0466690_098241_133_1179 348
80 3300042593 Ga0466691_036636 Ga0466691_036636_2756_3802 348
81 3300042593 Ga0466691_068316 Ga0466691_068316_2245_3291 348
82 3300042596 Ga0466696_062480 Ga0466696_062480_781_1827 348
83 3300042596 Ga0466696_219154 Ga0466696_219154_6591_7637 348
84 3300042596 Ga0466696_302250 Ga0466696_302250_977_2023 348
85 3300042601 Ga0466707_093490 Ga0466707_093490_89_1135 348
86 3300042605 Ga0466716_041329 Ga0466716_041329_907_1953 348
87 3300042606 Ga0466719_024195 Ga0466719_024195_2102_3148 348
88 3300042606 Ga0466719_205004 Ga0466719_205004_1719_2765 348
89 3300042606 Ga0466719_223946 Ga0466719_223946_2268_3314 348
90 3300042612 Ga0466705_025816 Ga0466705_025816_26_1072 348
91 3300042612 Ga0466705_050037 Ga0466705_050037_559_1605 348
92 3300042612 Ga0466705_242662 Ga0466705_242662_1392_2438 348
93 3300042612 Ga0466705_345057 Ga0466705_345057_535_1581 348
94 3300042615 Ga0466711_255630 Ga0466711_255630_575_1621 348
95 3300042616 Ga0466715_032258 Ga0466715_032258_268_1314 348
96 3300042618 Ga0466723_035242 Ga0466723_035242_1342_2388 348
97 3300042618 Ga0466723_135412 Ga0466723_135412_2871_3917 348
98 3300042618 Ga0466723_199267 Ga0466723_199267_406_1452 348
99 3300042618 Ga0466723_210331 Ga0466723_210331_660_1706 348
100 3300042618 Ga0466723_291981 Ga0466723_291981_1098_2144 348
101 3300042618 Ga0466723_322739 Ga0466723_322739_793_1839 348
102 3300042618 Ga0466723_335847 Ga0466723_335847_7706_8752 348
103 3300042619 Ga0466726_274917 Ga0466726_274917_135_1181 348
104 3300042636 Ga0466703_071566 Ga0466703_071566_1417_2463 348
105 3300042636 Ga0466703_113252 Ga0466703_113252_796_1842 348
106 3300042636 Ga0466703_121691 Ga0466703_121691_1691_2737 348
107 3300042636 Ga0466703_136395 Ga0466703_136395_858_1904 348
108 3300042636 Ga0466703_306512 Ga0466703_306512_43420_44466 348
109 3300042643 Ga0466704_142002 Ga0466704_142002_221_1267 348
110 3300042643 Ga0466704_156833 Ga0466704_156833_890_1936 348
111 3300042643 Ga0466704_215777 Ga0466704_215777_50_1096 348
112 3300042648 Ga0466709_129829 Ga0466709_129829_5560_6606 348
113 3300042648 Ga0466709_235300 Ga0466709_235300_147_1193 348
114 3300042652 Ga0466708_339785 Ga0466708_339785_617_1663 348
115 3300042652 Ga0466708_398056 Ga0466708_398056_3797_4843 348
116 3300042655 Ga0466727_033542 Ga0466727_033542_371_1417 348
117 3300042655 Ga0466727_157437 Ga0466727_157437_782_1828 348
118 3300042655 Ga0466727_225117 Ga0466727_225117_3991_5037 348
119 3300042655 Ga0466727_253139 Ga0466727_253139_1852_2898 348
120 3300042600 Ga0466700_305544 Ga0466700_305544_974_2023 349
121 3300042609 Ga0466722_160382 Ga0466722_160382_26151_27200 349
122 3300042606 Ga0466719_284138 Ga0466719_284138_2532_3587 351
123 3300042606 Ga0466719_510865 Ga0466719_510865_4025_5080 351
124 3300042614 Ga0466712_121768 Ga0466712_121768_724_1779 351
125 3300042643 Ga0466704_427505 Ga0466704_427505_653_1708 351
126 3300002450 JGI24695J34938_10008871 JGI24695J34938_100088715 352
127 3300005201 Ga0072941_1071690 Ga0072941_10716903 352
128 3300010167 Ga0123353_10588365 Ga0123353_105883651 352
129 3300042591 Ga0466692_001354 Ga0466692_001354_879_1937 352
130 3300042591 Ga0466692_143613 Ga0466692_143613_1190_2248 352
131 3300042593 Ga0466691_126427 Ga0466691_126427_1214_2272 352
132 3300042597 Ga0466699_015014 Ga0466699_015014_1249_2307 352
133 3300042609 Ga0466722_005288 Ga0466722_005288_696_1754 352
134 3300042609 Ga0466722_104141 Ga0466722_104141_2670_3728 352
135 3300042609 Ga0466722_228758 Ga0466722_228758_848_1906 352
136 3300042615 Ga0466711_121145 Ga0466711_121145_17560_18618 352
137 3300024493 Ga0264413_108507 Ga0264413_1085072 353
138 3300042597 Ga0466699_248577 Ga0466699_248577_167_1228 353
139 3300042607 Ga0466720_043182 Ga0466720_043182_14668_15729 353
140 3300042607 Ga0466720_050711 Ga0466720_050711_585_1646 353
141 3300042609 Ga0466722_016024 Ga0466722_016024_5581_6660 353
142 3300042609 Ga0466722_024179 Ga0466722_024179_189_1250 353
143 3300042609 Ga0466722_181203 Ga0466722_181203_2070_3131 353
144 3300042620 Ga0466728_126343 Ga0466728_126343_1330_2391 353
145 3300042652 Ga0466708_210566 Ga0466708_210566_9076_10137 353
146 3300042656 Ga0466732_080089 Ga0466732_080089_9045_10106 353
147 iso_pr_bacteria 2781125640 2781287016 353
148 iso_pr_bacteria 2781125682 2781409007 353
149 3300000089 AustNasuHG_c1011627 AustNasuHG_10116272 354
150 3300002450 JGI24695J34938_10026593 JGI24695J34938_100265931 354
151 3300042612 Ga0466705_011662 Ga0466705_011662_11121_12185 354
152 3300042615 Ga0466711_209219 Ga0466711_209219_4969_6033 354
153 3300042643 Ga0466704_156946 Ga0466704_156946_1525_2589 354
154 3300002449 JGI24698J34947_10054940 JGI24698J34947_100549402 355
155 3300010167 Ga0123353_10452287 Ga0123353_104522872 355
156 3300010167 Ga0123353_10669899 Ga0123353_106698992 355
157 3300042602 Ga0466713_144772 Ga0466713_144772_5310_6377 355
158 3300042635 Ga0466702_037390 Ga0466702_037390_3483_4550 355
159 iso_pr_bacteria 2820857933 2820858538 356
160 3300010167 Ga0123353_10003322 Ga0123353_100033226 357
161 3300042605 Ga0466716_521334 Ga0466716_521334_945_2018 357
162 3300042617 Ga0466718_156416 Ga0466718_156416_4473_5549 358
163 3300042619 Ga0466726_073988 Ga0466726_073988_614_1690 358
164 3300042621 Ga0466729_252662 Ga0466729_252662_2081_3157 358
165 3300042607 Ga0466720_084636 Ga0466720_084636_2218_3297 359
166 iso_pr_bacteria 2781125693 2781433369 359
167 3300042590 Ga0466690_271589 Ga0466690_271589_1153_2235 360
168 3300042592 Ga0466693_340263 Ga0466693_340263_125_1207 360
169 3300042594 Ga0466694_027531 Ga0466694_027531_5395_6477 360
170 3300042606 Ga0466719_061898 Ga0466719_061898_739_1821 360
171 3300042643 Ga0466704_103406 Ga0466704_103406_297_1379 360
172 3300042616 Ga0466715_080521 Ga0466715_080521_7051_8136 361
173 3300042594 Ga0466694_231615 Ga0466694_231615_229_1317 362
174 iso_pr_bacteria 8078130113 8078135478 365
175 3300042591 Ga0466692_168180 Ga0466692_168180_5365_6501 378
176 iso_pr_bacteria 8023752828 8023757027 380
177 iso_pr_bacteria 8024014383 8024018933 380
178 iso_pr_bacteria 8024044713 8024050169 380
179 iso_pr_bacteria 8025666332 8025669295 380
180 iso_pr_bacteria 8069775773 8069779972 380
181 iso_pr_bacteria 8102020860 8102025178 380
182 iso_pr_bacteria 8102054868 8102058950 380
183 iso_pr_bacteria 8102081745 8102085879 380
184 iso_pr_bacteria 8102246966 8102249929 380
185 3300042643 Ga0466704_049599 Ga0466704_049599_2317_3465 382
186 iso_pr_bacteria 8025708040 8025712873 383
187 iso_pr_bacteria 8102014801 8102020337 383
188 iso_pr_bacteria 8102094248 8102098885 383
189 iso_pr_bacteria 8102193924 8102198755 383
190 3300012857 Ga0160435_1001560 Ga0160435_10015604 384
191 iso_pr_bacteria 8024037630 8024042647 384
192 iso_pr_bacteria 8025716094 8025720136 384
193 iso_pr_bacteria 8025740903 8025745250 384
194 iso_pr_bacteria 8069748016 8069754845 384
195 iso_pr_bacteria 8069763219 8069767566 384
196 iso_pr_bacteria 8101951471 8101955867 384
197 iso_pr_bacteria 8101960468 8101964821 384
198 iso_pr_bacteria 8101967387 8101971735 384
199 iso_pr_bacteria 8101974301 8101978666 384
200 iso_pr_bacteria 8101981714 8101985928 384
201 iso_pr_bacteria 8101988189 8101992389 384
202 iso_pr_bacteria 8101994502 8101998846 384
203 iso_pr_bacteria 8102001125 8102005466 384
204 iso_pr_bacteria 8102007614 8102011952 384
205 iso_pr_bacteria 8102026984 8102031341 384
206 iso_pr_bacteria 8102033761 8102039343 384
207 iso_pr_bacteria 8102047609 8102052012 384
208 iso_pr_bacteria 8102067727 8102072037 384
209 iso_pr_bacteria 8102102351 8102107179 384
210 iso_pr_bacteria 8102109360 8102113714 384
211 iso_pr_bacteria 8102117041 8102121599 384
212 iso_pr_bacteria 8102124461 8102129238 384
213 iso_pr_bacteria 8102131453 8102133841 384
214 iso_pr_bacteria 8102186987 8102191027 384
215 iso_pr_bacteria 8102264549 8102269706 384
216 iso_pr_bacteria 8102271933 8102277097 384
217 iso_pr_bacteria 8102279326 8102284590 384
218 iso_pr_bacteria 8102286609 8102291975 384
219 iso_pr_bacteria 8102312426 8102316681 384
220 3300012812 Ga0160471_100980 Ga0160471_1009807 385
221 3300012849 Ga0160447_100066 Ga0160447_10006671 385
222 iso_pr_bacteria 8025723035 8025726981 386
223 iso_pr_bacteria 8102181083 8102185029 386
224 iso_pr_bacteria 8024025509 8024030543 392
225 3300042609 Ga0466722_262071 Ga0466722_262071_17843_19045 400
226 iso_pr_bacteria 8102138357 8102142830 400

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01263 Aldose_epim Aldose 1-epimerase 66 395 0.97

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.