Protein Family IF06915

Metagenome Isolate
148 Members
47 Samples
141 Scaffolds
344.73 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_254353|Ga0466722_254353_1394_2614
Length
406 aa
Sequence
VNRFDFLPLLPPACAKYLKSMLTLFQKVFRFIMTKIYILSFLLSGHPRKPAWRGQRTGGRGAMAIEIIATGRAIPPRRVTNDDLAARIDTTDEWIRSHTGIGARHIAEADVAASDLALEAANNALSLAIERGAVTEKSIEELALTIDLIVLGTTTQDYYGCPATACIVQDKLGAYNAGAMDITVACSSFVYGLEAAAGLLTVSPERKRALVIGAETLSRIADWNDRSICVLFGDGAGAVLIEKTGAPAVGPGRRGLVRSVLGADGSGAQALIVRRGGGRNPLSAGEILDRAPGIEMDGQAVYRFAVAAVTGTIEKLLLYEGITISDIDRIVPHQANARIVQAAGKRLGINEEKFYLNIEEYANTSSASIPIALDELNRAEKLRRGDVVMTVGFGAGLTYGGNLIIW

📊 Sample Types

Isolate 4.0%
Metagenome 96.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.6%
Kalotermitidae 31.1%
Unclassified 20.0%
Rhinotermitidae 6.7%
Termopsidae 6.7%

🌳 Taxonomy

Archaea 0
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
14 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
23 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
24 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
25 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
30 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
31 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
36 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_075496 3300042656 Bacteria 2434
2 Ga0466732_164865 3300042656 Bacteria 1677
3 Ga0466716_293854 3300042605 Bacteria 8099
4 Ga0466719_118394 3300042606 Bacteria 2808
5 Ga0466722_106030 3300042609 Bacteria 7219
6 Ga0466722_224143 3300042609 Bacteria 2271
7 Ga0466705_497425 3300042612 Bacteria 6020
8 Ga0466715_449231 3300042616 Bacteria 13036
9 Ga0466726_069480 3300042619 Bacteria 23044
10 Ga0466726_162096 3300042619 Bacteria 1520
11 Ga0466728_109346 3300042620 Bacteria 2608
12 Ga0466728_365193 3300042620 Bacteria 9580
13 Ga0466735_119287 3300042624 Unclassified 1451
14 Ga0466709_408723 3300042648 Bacteria 2866
15 Ga0415639_008352 3300038395 Bacteria 5892
16 Ga0466690_392329 3300042590 Bacteria 2327
17 Ga0466695_106127 3300042595 Bacteria 4413
18 Ga0466733_019501 3300042659 Bacteria 21602
19 Ga0466707_400853 3300042601 Bacteria 2430
20 Ga0466722_183400 3300042609 Bacteria 9904
21 Ga0466711_241704 3300042615 Bacteria 15416
22 Ga0466703_157496 3300042636 Bacteria 1366
23 Ga0466703_336614 3300042636 Bacteria 6835
24 Ga0466709_362037 3300042648 Bacteria 7394
25 Ga0456237_0002024 3300041968 Bacteria 3274
26 Ga0466690_014585 3300042590 Bacteria 4703
27 Ga0466690_207404 3300042590 Bacteria 3193
28 Ga0466691_002246 3300042593 Bacteria 7226
29 Ga0466691_013193 3300042593 Bacteria 17542
30 Ga0466694_373505 3300042594 Bacteria 3081
31 AustNasuHG_c1008623 3300000089 Bacteria 3607
32 Ga0072940_1012311 3300005200 Bacteria 3230
33 Ga0466707_082803 3300042601 Bacteria 1340
34 Ga0466722_151471 3300042609 Bacteria 5349
35 Ga0466722_254353 3300042609 Bacteria 4371
36 Ga0466715_413880 3300042616 Bacteria 3482
37 Ga0466703_205642 3300042636 Bacteria 23905
38 Ga0466704_043323 3300042643 Bacteria 77338
39 Ga0466704_340515 3300042643 Bacteria 4814
40 Ga0466709_032203 3300042648 Bacteria 3164
41 Ga0466727_230491 3300042655 Bacteria 44965
42 Ga0466696_017753 3300042596 Bacteria 6503
43 Ga0466699_299668 3300042597 Bacteria 1424
44 Ga0466699_317895 3300042597 Bacteria 2291
45 JGI24702J35022_10015485 3300002462 Bacteria 4196
46 JGI24702J35022_10063631 3300002462 Bacteria 1977
47 JGI24702J35022_10109825 3300002462 Bacteria 1516
48 Ga0068305_10132018 3300005083 Bacteria 17470
49 Ga0072940_1064735 3300005200 Bacteria 5643
50 Ga0072941_1001094 3300005201 Bacteria 56271
51 Ga0466705_163188 3300042612 Bacteria 8054
52 Ga0466716_047820 3300042605 Bacteria 3574
53 Ga0466720_067212 3300042607 Bacteria 6814
54 Ga0466722_033216 3300042609 Bacteria 2211
55 Ga0466711_083245 3300042615 Bacteria 1929
56 Ga0466715_217968 3300042616 Bacteria 21229
57 Ga0466723_148232 3300042618 Bacteria 7514
58 Ga0466728_134017 3300042620 Bacteria 5815
59 Ga0466704_113543 3300042643 Bacteria 47006
60 Ga0466691_129158 3300042593 Bacteria 30130
61 Ga0466696_083696 3300042596 Bacteria 32412
62 Ga0466705_047043 3300042612 Bacteria 38569
63 Ga0466705_054731 3300042612 Bacteria 1633
64 Ga0123353_10011959 3300010167 Bacteria 12280
65 Ga0466717_125711 3300042604 Bacteria 2188
66 Ga0466719_179269 3300042606 Bacteria 7064
67 Ga0466719_534081 3300042606 Bacteria 1739
68 Ga0466723_045433 3300042618 Bacteria 14123
69 Ga0466723_096958 3300042618 Bacteria 15636
70 Ga0466726_374281 3300042619 Bacteria 1527
71 Ga0466703_021465 3300042636 Bacteria 13133
72 Ga0466703_201089 3300042636 Bacteria 5196
73 Ga0466703_243942 3300042636 Bacteria 5937
74 Ga0466704_029582 3300042643 Bacteria 40583
75 Ga0466709_044014 3300042648 Bacteria 5647
76 Ga0466709_050803 3300042648 Bacteria 6568
77 Ga0466691_060086 3300042593 Bacteria 24330
78 Ga0072941_1040142 3300005201 Bacteria 5805
79 Ga0466705_034182 3300042612 Unclassified 8587
80 Ga0466705_306326 3300042612 Bacteria 7918
81 Ga0466732_430379 3300042656 Bacteria 2354
82 Ga0123353_10276674 3300010167 Bacteria 2581
83 Ga0123353_10449098 3300010167 Bacteria 1899
84 Ga0466707_036814 3300042601 Bacteria 1226
85 Ga0466716_020630 3300042605 Bacteria 6725
86 Ga0466716_359429 3300042605 Bacteria 9631
87 Ga0466720_053995 3300042607 Bacteria 3446
88 Ga0466722_055897 3300042609 Bacteria 3161
89 Ga0466698_215245 3300042610 Bacteria 4356
90 Ga0466711_285988 3300042615 Bacteria 4124
91 Ga0466728_027754 3300042620 Bacteria 2582
92 Ga0466735_024280 3300042624 Bacteria 10134
93 Ga0466703_177637 3300042636 Bacteria 197398
94 Ga0466703_341512 3300042636 Bacteria 3346
95 Ga0466704_083248 3300042643 Bacteria 1395
96 Ga0466704_283971 3300042643 Bacteria 1613
97 Ga0466708_087612 3300042652 Bacteria 5602
98 Ga0466727_129071 3300042655 Bacteria 5069
99 Ga0264413_131113 3300024493 Bacteria 3156
100 Ga0466696_167460 3300042596 Bacteria 2263
101 AustNasuHG_c1000622 3300000089 Bacteria 12543
102 Ga0072940_1050518 3300005200 Bacteria 4106
103 Ga0072941_1001095 3300005201 Bacteria 13049
104 Ga0466705_022323 3300042612 Bacteria 2232
105 Ga0466705_056022 3300042612 Bacteria 2882
106 Ga0466733_112678 3300042659 Bacteria 2140
107 Ga0466733_141867 3300042659 Bacteria 123412
108 Ga0123354_10086539 3300010882 Bacteria 4380
109 Ga0466719_002776 3300042606 Bacteria 1609
110 Ga0466726_355114 3300042619 Bacteria 22564
111 Ga0466704_292852 3300042643 Bacteria 24612
112 Ga0466704_449099 3300042643 Bacteria 67975
113 Ga0466708_018782 3300042652 Bacteria 2221
114 Ga0466708_245252 3300042652 Bacteria 2146
115 Ga0466727_139438 3300042655 Bacteria 1726
116 Ga0466727_332188 3300042655 Bacteria 29400
117 Ga0456237_0006399 3300041968 Bacteria 1848
118 Ga0466692_159283 3300042591 Bacteria 3946
119 Ga0466691_017213 3300042593 Bacteria 12816
120 Ga0466694_368231 3300042594 Bacteria 3566
121 Ga0072941_1001096 3300005201 Bacteria 35810
122 Ga0466705_016129 3300042612 Bacteria 11821
123 Ga0466705_133917 3300042612 Bacteria 2593
124 Ga0466705_284683 3300042612 Bacteria 6547
125 Ga0466733_125796 3300042659 Bacteria 3093
126 Ga0123354_10023356 3300010882 Bacteria 9753
127 Ga0466713_041904 3300042602 Bacteria 4287
128 Ga0466719_380576 3300042606 Unclassified 1493
129 Ga0466720_076911 3300042607 Bacteria 1354
130 Ga0466720_210719 3300042607 Bacteria 2002
131 Ga0466715_054701 3300042616 Bacteria 2481
132 Ga0466723_264860 3300042618 Bacteria 3003
133 Ga0466735_038450 3300042624 Bacteria 5059
134 Ga0466703_048664 3300042636 Bacteria 11042
135 Ga0466704_339474 3300042643 Bacteria 18180
136 Ga0466690_106666 3300042590 Bacteria 2928
137 Ga0466692_099962 3300042591 Bacteria 5697
138 Ga0466693_255896 3300042592 Bacteria 4273
139 Ga0466691_225951 3300042593 Bacteria 7850
140 Ga0466699_028523 3300042597 Bacteria 23057
141 JGI24698J34947_10000882 3300002449 Bacteria 15178

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_380576 Ga0466719_380576_582_1457 279
2 3300042606 Ga0466719_002776 Ga0466719_002776_598_1554 303
3 3300042612 Ga0466705_306326 Ga0466705_306326_2392_3402 325
4 3300042612 Ga0466705_133917 Ga0466705_133917_360_1457 326
5 3300042612 Ga0466705_497425 Ga0466705_497425_4982_6010 329
6 3300042618 Ga0466723_096958 Ga0466723_096958_142_1167 332
7 3300042648 Ga0466709_032203 Ga0466709_032203_455_1453 332
8 3300042593 Ga0466691_129158 Ga0466691_129158_25407_26408 333
9 3300042606 Ga0466719_179269 Ga0466719_179269_4298_5299 333
10 3300042612 Ga0466705_163188 Ga0466705_163188_433_1434 333
11 3300042616 Ga0466715_054701 Ga0466715_054701_899_1900 333
12 3300042643 Ga0466704_043323 Ga0466704_043323_10672_11673 333
13 3300042643 Ga0466704_113543 Ga0466704_113543_9274_10326 334
14 3300042592 Ga0466693_255896 Ga0466693_255896_165_1247 335
15 3300005083 Ga0068305_10132018 Ga0068305_101320186 336
16 3300042620 Ga0466728_109346 Ga0466728_109346_1199_2209 336
17 3300042648 Ga0466709_044014 Ga0466709_044014_750_1760 336
18 3300042596 Ga0466696_167460 Ga0466696_167460_241_1254 337
19 3300042605 Ga0466716_293854 Ga0466716_293854_6963_7976 337
20 3300042612 Ga0466705_056022 Ga0466705_056022_285_1298 337
21 3300042590 Ga0466690_014585 Ga0466690_014585_356_1372 338
22 3300042593 Ga0466691_013193 Ga0466691_013193_5718_6734 338
23 3300042601 Ga0466707_036814 Ga0466707_036814_196_1212 338
24 3300042618 Ga0466723_148232 Ga0466723_148232_251_1267 338
25 3300024493 Ga0264413_131113 Ga0264413_1311134 339
26 3300041968 Ga0456237_0002024 Ga0456237_0002024_2093_3112 339
27 3300042590 Ga0466690_106666 Ga0466690_106666_142_1161 339
28 3300042593 Ga0466691_017213 Ga0466691_017213_7488_8507 339
29 3300042596 Ga0466696_083696 Ga0466696_083696_17227_18294 339
30 3300042605 Ga0466716_359429 Ga0466716_359429_2071_3090 339
31 3300042606 Ga0466719_118394 Ga0466719_118394_1472_2491 339
32 3300042607 Ga0466720_053995 Ga0466720_053995_1130_2149 339
33 3300042607 Ga0466720_067212 Ga0466720_067212_1522_2541 339
34 3300042607 Ga0466720_076911 Ga0466720_076911_154_1173 339
35 3300042607 Ga0466720_210719 Ga0466720_210719_354_1373 339
36 3300042609 Ga0466722_183400 Ga0466722_183400_2363_3382 339
37 3300042616 Ga0466715_217968 Ga0466715_217968_2758_3777 339
38 3300042620 Ga0466728_027754 Ga0466728_027754_193_1212 339
39 3300042636 Ga0466703_177637 Ga0466703_177637_168228_169247 339
40 3300042643 Ga0466704_339474 Ga0466704_339474_17064_18083 339
41 3300042652 Ga0466708_245252 Ga0466708_245252_800_1819 339
42 iso_pr_bacteria 2781125695 2781439129 339
43 3300000089 AustNasuHG_c1008623 AustNasuHG_10086232 340
44 3300002462 JGI24702J35022_10015485 JGI24702J35022_100154854 340
45 3300005201 Ga0072941_1001094 Ga0072941_100109452 340
46 3300042590 Ga0466690_207404 Ga0466690_207404_1165_2187 340
47 3300042593 Ga0466691_225951 Ga0466691_225951_477_1499 340
48 3300042596 Ga0466696_017753 Ga0466696_017753_1983_3005 340
49 3300042605 Ga0466716_020630 Ga0466716_020630_3176_4198 340
50 3300042636 Ga0466703_021465 Ga0466703_021465_4570_5592 340
51 3300042648 Ga0466709_050803 Ga0466709_050803_3987_5009 340
52 3300042656 Ga0466732_164865 Ga0466732_164865_107_1129 340
53 3300000089 AustNasuHG_c1000622 AustNasuHG_10006229 341
54 3300002462 JGI24702J35022_10109825 JGI24702J35022_101098252 341
55 3300005200 Ga0072940_1012311 Ga0072940_10123112 341
56 3300005201 Ga0072941_1040142 Ga0072941_10401422 341
57 3300010167 Ga0123353_10011959 Ga0123353_100119597 341
58 3300042602 Ga0466713_041904 Ga0466713_041904_1577_2653 341
59 3300042619 Ga0466726_374281 Ga0466726_374281_38_1063 341
60 3300042620 Ga0466728_134017 Ga0466728_134017_984_2009 341
61 3300042636 Ga0466703_341512 Ga0466703_341512_1109_2134 341
62 3300042652 Ga0466708_018782 Ga0466708_018782_422_1489 342
63 3300042656 Ga0466732_075496 Ga0466732_075496_292_1320 342
64 3300002462 JGI24702J35022_10063631 JGI24702J35022_100636312 343
65 3300042591 Ga0466692_099962 Ga0466692_099962_311_1342 343
66 3300005200 Ga0072940_1064735 Ga0072940_10647352 344
67 3300010167 Ga0123353_10276674 Ga0123353_102766742 344
68 3300041968 Ga0456237_0006399 Ga0456237_0006399_258_1292 344
69 3300042605 Ga0466716_047820 Ga0466716_047820_2303_3337 344
70 3300042609 Ga0466722_151471 Ga0466722_151471_3354_4388 344
71 3300042609 Ga0466722_224143 Ga0466722_224143_733_1767 344
72 3300042612 Ga0466705_034182 Ga0466705_034182_72_1106 344
73 3300042612 Ga0466705_284683 Ga0466705_284683_4799_5833 344
74 3300042615 Ga0466711_083245 Ga0466711_083245_237_1271 344
75 3300042618 Ga0466723_045433 Ga0466723_045433_9429_10463 344
76 3300042619 Ga0466726_069480 Ga0466726_069480_2221_3255 344
77 3300042620 Ga0466728_365193 Ga0466728_365193_7423_8457 344
78 3300042624 Ga0466735_038450 Ga0466735_038450_1001_2035 344
79 3300042636 Ga0466703_048664 Ga0466703_048664_73_1107 344
80 3300042636 Ga0466703_201089 Ga0466703_201089_313_1347 344
81 3300042643 Ga0466704_083248 Ga0466704_083248_89_1123 344
82 3300042643 Ga0466704_283971 Ga0466704_283971_110_1144 344
83 3300042643 Ga0466704_292852 Ga0466704_292852_6645_7679 344
84 3300042655 Ga0466727_139438 Ga0466727_139438_146_1180 344
85 iso_pr_bacteria 2772190978 2773731034 344
86 3300042597 Ga0466699_317895 Ga0466699_317895_172_1248 345
87 3300042612 Ga0466705_054731 Ga0466705_054731_382_1419 345
88 3300042619 Ga0466726_355114 Ga0466726_355114_21095_22132 345
89 3300042655 Ga0466727_230491 Ga0466727_230491_1860_2897 345
90 3300042597 Ga0466699_028523 Ga0466699_028523_21014_22054 346
91 3300042612 Ga0466705_022323 Ga0466705_022323_506_1546 346
92 3300042612 Ga0466705_047043 Ga0466705_047043_32481_33521 346
93 3300042636 Ga0466703_205642 Ga0466703_205642_10369_11409 346
94 3300042636 Ga0466703_336614 Ga0466703_336614_4836_5876 346
95 3300042643 Ga0466704_029582 Ga0466704_029582_32260_33300 346
96 3300042656 Ga0466732_430379 Ga0466732_430379_641_1681 346
97 3300002449 JGI24698J34947_10000882 JGI24698J34947_100008822 347
98 3300010167 Ga0123353_10449098 Ga0123353_104490982 347
99 3300042606 Ga0466719_534081 Ga0466719_534081_392_1471 347
100 3300042624 Ga0466735_024280 Ga0466735_024280_8895_9938 347
101 3300042648 Ga0466709_408723 Ga0466709_408723_831_1874 347
102 3300042655 Ga0466727_332188 Ga0466727_332188_17783_18826 347
103 3300042590 Ga0466690_392329 Ga0466690_392329_253_1299 348
104 3300042591 Ga0466692_159283 Ga0466692_159283_2097_3143 348
105 3300042609 Ga0466722_033216 Ga0466722_033216_1052_2098 348
106 3300042619 Ga0466726_162096 Ga0466726_162096_409_1455 348
107 3300042624 Ga0466735_119287 Ga0466735_119287_330_1376 348
108 3300042652 Ga0466708_087612 Ga0466708_087612_3962_5008 348
109 iso_pr_bacteria 2781125685 2781417362 348
110 iso_pr_bacteria 2781125686 2781418343 348
111 iso_pr_bacteria 2781125687 2781421039 348
112 3300005200 Ga0072940_1050518 Ga0072940_10505183 349
113 3300005201 Ga0072941_1001095 Ga0072941_100109514 349
114 3300010882 Ga0123354_10023356 Ga0123354_100233562 349
115 3300010882 Ga0123354_10086539 Ga0123354_100865394 349
116 3300042597 Ga0466699_299668 Ga0466699_299668_47_1096 349
117 3300042648 Ga0466709_362037 Ga0466709_362037_3735_4784 349
118 3300042601 Ga0466707_400853 Ga0466707_400853_1110_2162 350
119 3300042615 Ga0466711_285988 Ga0466711_285988_765_1817 350
120 3300042636 Ga0466703_157496 Ga0466703_157496_225_1277 350
121 3300042659 Ga0466733_141867 Ga0466733_141867_28927_29979 350
122 3300042636 Ga0466703_243942 Ga0466703_243942_1239_2294 351
123 3300042643 Ga0466704_340515 Ga0466704_340515_2326_3381 351
124 3300042659 Ga0466733_112678 Ga0466733_112678_380_1435 351
125 iso_pr_bacteria 2781125692 2781432173 351
126 3300042615 Ga0466711_241704 Ga0466711_241704_13293_14351 352
127 3300042618 Ga0466723_264860 Ga0466723_264860_368_1507 352
128 3300005201 Ga0072941_1040142 Ga0072941_10401423 353
129 3300042593 Ga0466691_060086 Ga0466691_060086_17294_18355 353
130 3300042655 Ga0466727_129071 Ga0466727_129071_2023_3087 354
131 3300042593 Ga0466691_002246 Ga0466691_002246_5082_6149 355
132 3300042612 Ga0466705_016129 Ga0466705_016129_49_1116 355
133 3300042643 Ga0466704_449099 Ga0466704_449099_55309_56376 355
134 3300042609 Ga0466722_106030 Ga0466722_106030_4250_5320 356
135 3300042659 Ga0466733_019501 Ga0466733_019501_18858_19928 356
136 3300042609 Ga0466722_055897 Ga0466722_055897_252_1325 357
137 3300042594 Ga0466694_373505 Ga0466694_373505_683_1759 358
138 3300042616 Ga0466715_449231 Ga0466715_449231_2219_3298 359
139 3300042616 Ga0466715_413880 Ga0466715_413880_434_1537 360
140 3300042601 Ga0466707_082803 Ga0466707_082803_145_1233 362
141 3300038395 Ga0415639_008352 Ga0415639_008352_4674_5768 364
142 3300042594 Ga0466694_368231 Ga0466694_368231_1268_2365 365
143 3300042610 Ga0466698_215245 Ga0466698_215245_1934_3031 365
144 3300005201 Ga0072941_1001096 Ga0072941_100109611 372
145 3300042604 Ga0466717_125711 Ga0466717_125711_999_2129 376
146 3300042659 Ga0466733_125796 Ga0466733_125796_1802_2947 381
147 3300042595 Ga0466695_106127 Ga0466695_106127_126_1292 388
148 3300042609 Ga0466722_254353 Ga0466722_254353_1394_2614 406

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08541 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 320 406 0.97
PF08545 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 180 264 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.