Protein Family IF06900

Metagenome Isolate
139 Members
62 Samples
118 Scaffolds
170.96 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_232470|Ga0466722_232470_35008_35559
Length
183 aa
Sequence
MKKEDKAKIIEQLSEVVKEYPNFYLTDIEALNAGKTSALRRECFKQGVKLMVVKNTLLKKVFENIEEDYSALNVALKGNTAIMLSHTTNVAARLIKEFTKASKDKKNIRPQLKAAYVQESFYVGADYLEALVNIKSKEELLGDIIALLQSPAKNIILALQSSGQTILGVLKTLEEDKVIVYSK

📊 Sample Types

Isolate 15.1%
Metagenome 84.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.9%
Blattidae 26.2%
Kalotermitidae 21.3%
Unclassified 11.5%
Rhinotermitidae 4.9%
Passalidae 4.9%
Termopsidae 1.6%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 137
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
8 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
9 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
10 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
11 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
14 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
15 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
16 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
19 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
20 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
21 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
22 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
23 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
26 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
27 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
31 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
32 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
33 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
39 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
40 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
41 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
42 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
43 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
47 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
48 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
51 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
52 2923982719 Parabacteroides sp. 52 Isolate Blattidae
53 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
54 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
55 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
56 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
57 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
58 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
59 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
60 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
61 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
62 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_275291 3300042611 Unclassified 1038
2 Ga0466733_068075 3300042659 Bacteria 14154
3 Ga0466733_117626 3300042659 Bacteria 1997
4 Ga0466733_158876 3300042659 Bacteria 3877
5 Ga0466691_221380 3300042593 Bacteria 15148
6 Ga0466696_394022 3300042596 Bacteria 212291
7 Ga0123357_10396321 3300009784 Bacteria 1262
8 Ga0123356_10633588 3300010049 Unclassified 1235
9 Ga0123353_10218071 3300010167 Bacteria 2986
10 Ga0123353_10252269 3300010167 Bacteria 2732
11 Ga0466706_019580 3300042599 Bacteria 3095
12 Ga0466706_183342 3300042599 Bacteria 5616
13 Ga0466716_166359 3300042605 Bacteria 5403
14 Ga0466722_216312 3300042609 Bacteria 6465
15 Ga0466735_019509 3300042624 Bacteria 1396
16 Ga0466703_344027 3300042636 Bacteria 12646
17 Ga0466703_394273 3300042636 Bacteria 22669
18 Ga0466724_07812 3300042649 Bacteria 1560
19 Ga0466725_080611 3300042654 Bacteria 3004
20 IMNBL1DRAFT_c0003160 3300000062 Bacteria 10827
21 IMNBL1DRAFT_c0006011 3300000062 Bacteria 6766
22 Ga0265387_1068802 3300024582 Bacteria 677
23 Ga0466715_123796 3300042616 Bacteria 41840
24 Ga0466715_165538 3300042616 Bacteria 16153
25 Ga0466728_093817 3300042620 Bacteria 21218
26 Ga0466714_016336 3300042603 Bacteria 3156
27 Ga0466716_201587 3300042605 Bacteria 2415
28 Ga0466722_015704 3300042609 Bacteria 71312
29 Ga0466722_144286 3300042609 Bacteria 1129
30 Ga0466735_053633 3300042624 Bacteria 1790
31 Ga0466703_378604 3300042636 Bacteria 14079
32 Ga0466732_082349 3300042656 Bacteria 5142
33 Ga0466723_360028 3300042618 Bacteria 13095
34 Ga0466728_306064 3300042620 Bacteria 1757
35 Ga0466729_010781 3300042621 Bacteria 16724
36 Ga0123356_10110251 3300010049 Bacteria 2657
37 Ga0466706_036814 3300042599 Bacteria 5066
38 Ga0466706_175840 3300042599 Bacteria 8687
39 Ga0466716_514970 3300042605 Bacteria 14004
40 Ga0466721_186390 3300042608 Bacteria 7274
41 Ga0466697_039353 3300042611 Bacteria 6345
42 Ga0466735_001533 3300042624 Bacteria 10722
43 Ga0466724_08735 3300042649 Bacteria 2383
44 2227547988 2225789004 Bacteria 2891
45 JGI24702J35022_10003774 3300002462 Bacteria 9104
46 JGI24702J35022_10013322 3300002462 Bacteria 4556
47 Ga0466697_105408 3300042611 Bacteria 2231
48 Ga0466697_270836 3300042611 Bacteria 3358
49 Ga0466733_185216 3300042659 Bacteria 77937
50 Ga0466696_363698 3300042596 Bacteria 1024
51 Ga0466710_045644 3300042613 Bacteria 14150
52 Ga0123356_11581992 3300010049 Bacteria 811
53 Ga0466706_036251 3300042599 Bacteria 1673
54 Ga0466722_232470 3300042609 Bacteria 73289
55 Ga0466703_060828 3300042636 Bacteria 8175
56 2227480184 2225789004 Bacteria 78831
57 2227516308 2225789004 Bacteria 17630
58 IMNBL1DRAFT_c0001329 3300000062 Bacteria 18611
59 IMNBL1DRAFT_c0013585 3300000062 Bacteria 3642
60 JGI24702J35022_10001523 3300002462 Bacteria 14396
61 JGI24699J35502_11133854 3300002509 Bacteria 17140
62 JGI24696J40584_12957527 3300002834 Bacteria 3561
63 Ga0068305_10005158 3300005083 Bacteria 2384
64 Ga0466705_273715 3300042612 Bacteria 53499
65 Ga0415639_275667 3300038395 Bacteria 1443
66 Ga0466690_227552 3300042590 Bacteria 11759
67 Ga0466690_256751 3300042590 Bacteria 42016
68 Ga0123356_10881042 3300010049 Bacteria 1066
69 Ga0123356_10982266 3300010049 Bacteria 1015
70 Ga0466714_162927 3300042603 Bacteria 1975
71 Ga0466716_456732 3300042605 Bacteria 12328
72 2227452194 2225789004 Bacteria 1012
73 Ga0466733_122875 3300042659 Bacteria 7035
74 Ga0466690_241545 3300042590 Bacteria 13899
75 Ga0466691_076024 3300042593 Bacteria 14619
76 Ga0466691_189088 3300042593 Bacteria 1048
77 Ga0466710_266877 3300042613 Bacteria 7625
78 Ga0466711_093162 3300042615 Bacteria 19638
79 Ga0466711_194622 3300042615 Bacteria 2367
80 Ga0466715_299034 3300042616 Bacteria 37987
81 Ga0466713_028689 3300042602 Bacteria 1844
82 Ga0466709_117347 3300042648 Bacteria 10931
83 IMNBL1DRAFT_c0000530 3300000062 Bacteria 31244
84 JGI24702J35022_10061098 3300002462 Bacteria 2015
85 JGI24702J35022_10328474 3300002462 Bacteria 909
86 Ga0466732_112622 3300042656 Bacteria 2032
87 Ga0466657_134140 3300042582 Bacteria 4288
88 Ga0466657_242066 3300042582 Bacteria 3290
89 Ga0466696_020992 3300042596 Bacteria 1025
90 Ga0466711_035701 3300042615 Bacteria 9190
91 Ga0466715_257341 3300042616 Bacteria 23626
92 Ga0123353_10002158 3300010167 Bacteria 24325
93 Ga0466706_033947 3300042599 Bacteria 3035
94 Ga0466714_020760 3300042603 Bacteria 14729
95 Ga0466714_025369 3300042603 Bacteria 1117
96 Ga0466714_151868 3300042603 Bacteria 1192
97 Ga0466735_147550 3300042624 Bacteria 1226
98 Ga0466708_435851 3300042652 Bacteria 53327
99 IMNBL1DRAFT_c0044120 3300000062 Bacteria 1468
100 Ga0466690_407298 3300042590 Bacteria 9434
101 Ga0466696_205463 3300042596 Bacteria 14851
102 Ga0466696_258694 3300042596 Bacteria 2903
103 Ga0466711_140047 3300042615 Bacteria 6511
104 Ga0466711_413274 3300042615 Bacteria 6092
105 Ga0466723_139489 3300042618 Bacteria 11970
106 Ga0123357_10006569 3300009784 Bacteria 14225
107 Ga0466707_256860 3300042601 Bacteria 2543
108 Ga0466714_002012 3300042603 Bacteria 2083
109 Ga0466714_059729 3300042603 Bacteria 25353
110 Ga0466703_348168 3300042636 Bacteria 8397
111 Ga0466704_048987 3300042643 Bacteria 1659
112 Ga0466709_086078 3300042648 Bacteria 4530
113 2227035910 2225789003 Bacteria 20847
114 2227513528 2225789004 Bacteria 18058
115 IMNBL1DRAFT_c0002427 3300000062 Bacteria 12971
116 IMNBL1DRAFT_c0009148 3300000062 Bacteria 4938
117 JGI24702J35022_10017399 3300002462 Bacteria 3928
118 JGI24705J35276_12234556 3300002504 Bacteria 5628

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_227552 Ga0466690_227552_1125_1661 156
2 3300042590 Ga0466690_256751 Ga0466690_256751_14627_15157 158
3 3300042593 Ga0466691_189088 Ga0466691_189088_293_823 158
4 3300042616 Ga0466715_123796 Ga0466715_123796_15727_16257 158
5 3300042620 Ga0466728_093817 Ga0466728_093817_8707_9237 158
6 2225789004 2227547988 2228075214 159
7 3300042596 Ga0466696_258694 Ga0466696_258694_1099_1632 159
8 3300042609 Ga0466722_015704 Ga0466722_015704_55842_56372 159
9 3300042615 Ga0466711_093162 Ga0466711_093162_12261_12797 159
10 3300042643 Ga0466704_048987 Ga0466704_048987_630_1163 159
11 3300000062 IMNBL1DRAFT_c0002427 IMNBL1DRAFT_000242711 160
12 3300042593 Ga0466691_221380 Ga0466691_221380_9477_9998 160
13 3300042615 Ga0466711_140047 Ga0466711_140047_2670_3206 160
14 3300042615 Ga0466711_413274 Ga0466711_413274_4827_5363 160
15 3300042596 Ga0466696_394022 Ga0466696_394022_72048_72578 161
16 3300042605 Ga0466716_514970 Ga0466716_514970_9831_10367 161
17 3300042636 Ga0466703_348168 Ga0466703_348168_4635_5171 161
18 3300042652 Ga0466708_435851 Ga0466708_435851_22313_22849 161
19 3300042605 Ga0466716_456732 Ga0466716_456732_10019_10555 162
20 3300042615 Ga0466711_194622 Ga0466711_194622_1790_2326 162
21 3300042590 Ga0466690_407298 Ga0466690_407298_3355_3891 163
22 3300042605 Ga0466716_201587 Ga0466716_201587_1130_1666 163
23 3300042616 Ga0466715_257341 Ga0466715_257341_17528_18064 163
24 3300042636 Ga0466703_060828 Ga0466703_060828_4642_5178 163
25 3300042636 Ga0466703_344027 Ga0466703_344027_2506_3042 163
26 3300042648 Ga0466709_086078 Ga0466709_086078_1785_2321 163
27 3300042648 Ga0466709_117347 Ga0466709_117347_4079_4615 163
28 3300042593 Ga0466691_076024 Ga0466691_076024_8439_8975 164
29 3300042601 Ga0466707_256860 Ga0466707_256860_317_853 165
30 3300042621 Ga0466729_010781 Ga0466729_010781_10270_10806 165
31 3300042624 Ga0466735_019509 Ga0466735_019509_817_1353 165
32 3300042616 Ga0466715_299034 Ga0466715_299034_3556_4095 166
33 3300000062 IMNBL1DRAFT_c0013585 IMNBL1DRAFT_00135853 168
34 3300000062 IMNBL1DRAFT_c0009148 IMNBL1DRAFT_00091483 169
35 3300005083 Ga0068305_10005158 Ga0068305_100051585 170
36 3300042611 Ga0466697_275291 Ga0466697_275291_106_618 170
37 iso_pr_bacteria 8100166142 8100168315 170
38 2225789004 2227452194 2227888952 171
39 3300042596 Ga0466696_363698 Ga0466696_363698_358_873 171
40 3300042599 Ga0466706_036251 Ga0466706_036251_73_588 171
41 3300042599 Ga0466706_183342 Ga0466706_183342_4338_4853 171
42 3300042605 Ga0466716_166359 Ga0466716_166359_2103_2618 171
43 3300042616 Ga0466715_165538 Ga0466715_165538_6024_6539 171
44 3300042649 Ga0466724_07812 Ga0466724_07812_498_1013 171
45 3300042656 Ga0466732_082349 Ga0466732_082349_2236_2751 171
46 iso_pr_bacteria 2820751898 2820752615 171
47 iso_pr_bacteria 2820757377 2820757900 171
48 3300000062 IMNBL1DRAFT_c0044120 IMNBL1DRAFT_00441202 172
49 3300002462 JGI24702J35022_10328474 JGI24702J35022_103284742 172
50 3300002504 JGI24705J35276_12234556 JGI24705J35276_1223455610 172
51 3300002509 JGI24699J35502_11133854 JGI24699J35502_111338544 172
52 3300009784 Ga0123357_10006569 Ga0123357_1000656911 172
53 3300042582 Ga0466657_134140 Ga0466657_134140_63_581 172
54 3300042582 Ga0466657_242066 Ga0466657_242066_1969_2487 172
55 3300042612 Ga0466705_273715 Ga0466705_273715_39573_40091 172
56 3300042613 Ga0466710_045644 Ga0466710_045644_669_1187 172
57 3300042613 Ga0466710_266877 Ga0466710_266877_2343_2861 172
58 3300042649 Ga0466724_08735 Ga0466724_08735_1526_2044 172
59 3300042654 Ga0466725_080611 Ga0466725_080611_1187_1705 172
60 2225789004 2227480184 2227939007 173
61 3300038395 Ga0415639_275667 Ga0415639_275667_193_714 173
62 3300042590 Ga0466690_241545 Ga0466690_241545_4609_5130 173
63 3300042608 Ga0466721_186390 Ga0466721_186390_2559_3080 173
64 3300042609 Ga0466722_216312 Ga0466722_216312_575_1096 173
65 3300042611 Ga0466697_039353 Ga0466697_039353_1042_1563 173
66 3300042615 Ga0466711_035701 Ga0466711_035701_4338_4859 173
67 3300042618 Ga0466723_360028 Ga0466723_360028_3614_4135 173
68 3300042624 Ga0466735_001533 Ga0466735_001533_6270_6791 173
69 3300042636 Ga0466703_378604 Ga0466703_378604_9010_9531 173
70 3300042656 Ga0466732_112622 Ga0466732_112622_1473_1994 173
71 iso_pr_bacteria 2820736622 2820737539 173
72 iso_pr_bacteria 2820740053 2820741487 173
73 2225789003 2227035910 2227396219 174
74 2225789004 2227513528 2228010089 174
75 2225789004 2227516308 2228015489 174
76 3300002462 JGI24702J35022_10003774 JGI24702J35022_1000377414 174
77 3300002462 JGI24702J35022_10017399 JGI24702J35022_100173993 174
78 3300002834 JGI24696J40584_12957527 JGI24696J40584_129575273 174
79 3300010049 Ga0123356_10110251 Ga0123356_101102513 174
80 3300010049 Ga0123356_10633588 Ga0123356_106335882 174
81 3300010049 Ga0123356_10881042 Ga0123356_108810422 174
82 3300010049 Ga0123356_10982266 Ga0123356_109822662 174
83 3300010167 Ga0123353_10002158 Ga0123353_100021587 174
84 3300010167 Ga0123353_10252269 Ga0123353_102522694 174
85 3300024582 Ga0265387_1068802 Ga0265387_10688021 174
86 3300042599 Ga0466706_019580 Ga0466706_019580_1708_2232 174
87 3300042599 Ga0466706_033947 Ga0466706_033947_466_990 174
88 3300042599 Ga0466706_036814 Ga0466706_036814_4419_4943 174
89 3300042599 Ga0466706_175840 Ga0466706_175840_5107_5631 174
90 3300042603 Ga0466714_002012 Ga0466714_002012_121_645 174
91 3300042603 Ga0466714_016336 Ga0466714_016336_1232_1756 174
92 3300042603 Ga0466714_020760 Ga0466714_020760_8968_9492 174
93 3300042603 Ga0466714_025369 Ga0466714_025369_434_958 174
94 3300042603 Ga0466714_059729 Ga0466714_059729_2692_3216 174
95 3300042603 Ga0466714_151868 Ga0466714_151868_468_992 174
96 3300042603 Ga0466714_162927 Ga0466714_162927_1383_1907 174
97 3300042611 Ga0466697_105408 Ga0466697_105408_897_1421 174
98 3300042624 Ga0466735_147550 Ga0466735_147550_57_581 174
99 3300042659 Ga0466733_068075 Ga0466733_068075_4635_5159 174
100 3300042659 Ga0466733_117626 Ga0466733_117626_1429_1953 174
101 3300042659 Ga0466733_158876 Ga0466733_158876_2712_3236 174
102 3300042659 Ga0466733_185216 Ga0466733_185216_38802_39326 174
103 iso_pr_bacteria 2923982719 2923985060 174
104 iso_pr_bacteria 2940202316 2940202892 174
105 iso_pr_bacteria 2940371297 2940372220 174
106 3300000062 IMNBL1DRAFT_c0000530 IMNBL1DRAFT_000053019 175
107 3300000062 IMNBL1DRAFT_c0001329 IMNBL1DRAFT_000132915 175
108 3300000062 IMNBL1DRAFT_c0006011 IMNBL1DRAFT_00060113 175
109 3300002462 JGI24702J35022_10061098 JGI24702J35022_100610981 175
110 3300009784 Ga0123357_10396321 Ga0123357_103963212 175
111 3300010049 Ga0123356_11581992 Ga0123356_115819922 175
112 3300010167 Ga0123353_10218071 Ga0123353_102180712 175
113 3300042659 Ga0466733_122875 Ga0466733_122875_2235_2762 175
114 3300042596 Ga0466696_205463 Ga0466696_205463_5898_6428 176
115 3300042602 Ga0466713_028689 Ga0466713_028689_321_851 176
116 3300042609 Ga0466722_144286 Ga0466722_144286_531_1061 176
117 3300042611 Ga0466697_270836 Ga0466697_270836_835_1365 176
118 3300042636 Ga0466703_394273 Ga0466703_394273_12538_13068 176
119 iso_pr_bacteria 2940195863 2940197639 176
120 iso_pr_bacteria 2940205530 2940207491 176
121 iso_pr_bacteria 2940212447 2940214319 176
122 iso_pr_bacteria 2940298504 2940300373 176
123 iso_pr_bacteria 2940302308 2940304181 176
124 iso_pr_bacteria 2940306115 2940308392 176
125 iso_pr_bacteria 2940309933 2940312231 176
126 iso_pr_bacteria 2940313741 2940316090 176
127 iso_pr_bacteria 2940317558 2940319859 176
128 iso_pr_bacteria 2940321370 2940323464 176
129 iso_pr_bacteria 2940325180 2940327051 176
130 iso_pr_bacteria 2940328985 2940330939 176
131 iso_pr_bacteria 2940332795 2940335095 176
132 3300000062 IMNBL1DRAFT_c0003160 IMNBL1DRAFT_000316016 177
133 3300002462 JGI24702J35022_10001523 JGI24702J35022_100015234 177
134 3300002462 JGI24702J35022_10013322 JGI24702J35022_100133226 177
135 3300042596 Ga0466696_020992 Ga0466696_020992_417_953 178
136 3300042618 Ga0466723_139489 Ga0466723_139489_6652_7188 178
137 3300042620 Ga0466728_306064 Ga0466728_306064_494_1030 178
138 3300042624 Ga0466735_053633 Ga0466735_053633_648_1184 178
139 3300042609 Ga0466722_232470 Ga0466722_232470_35008_35559 183

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00466 Ribosomal_L10 Ribosomal protein L10 1 100 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.