Protein Family IF06882

Metagenome Isolate
249 Members
208 Samples
93 Scaffolds
91.22 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_201323|Ga0466722_201323_12636_12950
Length
104 aa
Sequence
VYHLNIFTHFREEYMNKAELIAAMAERAELSKKDAEKALTAFIDTVTDTLKEGEKVSLVGFGTFEARERAARVGINPRTKEKMNILATKTPSFKAGKAFKEVLK

📊 Sample Types

Isolate 62.6%
Metagenome 37.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 42.1%
Termitidae 8.2%
Drosophilidae 6.7%
Formicidae 6.2%
Anthocoridae 4.6%
Kalotermitidae 4.6%
Halictidae 4.1%
Elmidae 2.6%
Curculionidae 2.6%
Apidae 2.1%
Tenebrionidae 2.1%
Rhinotermitidae 1.5%
Talitridae 1.5%
Palinuridae 1.5%
Majidae 1.0%
Blattidae 1.0%
Culicidae 0.5%
Scarabaeidae 0.5%
Nephropidae 0.5%
Thripidae 0.5%
Artemiidae 0.5%
Passalidae 0.5%
Calliphoridae 0.5%
Pteromalidae 0.5%
Pentatomidae 0.5%
Gryllidae 0.5%
Crambidae 0.5%
Termopsidae 0.5%
Lysianassidae 0.5%
Hodotermitidae 0.5%
Penaeidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 225
Eukaryota 0
Viruses 0
Unclassified 24

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2511231129 Vibrio sp. EJY3 Isolate Unclassified
2 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
3 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
4 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
5 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
6 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
7 2871771314 Pantoea sp. Ae16 Isolate Culicidae
8 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
9 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
10 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
11 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
12 2908136803 Vibrio owensii 1700302 Isolate Unclassified
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 640963010 Vibrio harveyi HY01 Isolate Unclassified
17 648276708 Pantoea sp. aB Isolate Unclassified
18 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
19 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
20 8022345672 Vibrio sp. 070316B Isolate Unclassified
21 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
22 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
23 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
24 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
28 2603880173 Pseudomonas SP. Isolate Unclassified
29 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
30 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
31 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
32 2820096063 Unclassified Proteobacteria Lab288P3bin136 Isolate Unclassified
33 2820097968 Unclassified Proteobacteria Lab288P3bin104 Isolate Unclassified
34 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
35 2850895757 Vibrio campbellii 170502 Isolate Unclassified
36 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
37 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
38 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
39 2872471378 Vibrio owensii V180403 Isolate Unclassified
40 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
41 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
44 651324086 Plautia crossota stali symbiont Isolate Unclassified
45 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
46 8022087107 Vibrio sp. OULL4 Isolate Unclassified
47 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
48 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
49 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
50 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
51 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
52 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
53 3300007766 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 4 gut Metagenome Drosophilidae
54 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
55 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
56 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
57 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
58 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
59 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
60 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
61 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
62 2820141685 Unclassified Proteobacteria Emb289P3bin118 Isolate Unclassified
63 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
64 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
65 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
66 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
67 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
68 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
69 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
70 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
71 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
72 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
73 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
74 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
75 2585427605 Colwellia sp. MT2012 Isolate
76 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
77 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
78 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
79 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
80 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
81 2791355473 Vibrio barjaei 3062 Isolate Unclassified
82 2820100407 Unclassified Proteobacteria Lab288P1bin48 Isolate Unclassified
83 2820136564 Unclassified Proteobacteria Emb289P3bin18 Isolate Unclassified
84 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
85 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
86 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
87 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
88 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
89 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
90 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
91 8051534459 Vibrio vulnificus Vv004 Isolate
92 8099192374 Erwinia typographi IC4 Isolate Curculionidae
93 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
94 3000861951 Budvicia diplopodorum D9 Isolate
95 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
96 3006242587 Vibrio sp. RE86 Isolate Unclassified
97 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
98 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
99 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
100 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
101 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
102 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
103 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
104 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
105 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
106 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
107 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
108 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
109 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
110 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
111 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
112 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
113 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
114 8103002986 Erwinia sp. S38 Isolate Curculionidae
115 8103008710 Erwinia sp. S43 Isolate Curculionidae
116 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
117 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
118 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
119 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
120 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
121 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
122 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
123 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
124 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
125 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
126 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
127 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
128 2554235022 Vibrio parahaemolyticus v110 Isolate
129 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
130 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
131 2820052737 Unclassified Proteobacteria Th196P3bin127 Isolate Unclassified
132 2820064859 Unclassified Proteobacteria Nt197P3bin78 Isolate Unclassified
133 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
134 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
135 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
136 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
137 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
138 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
139 2912570088 Vibrio parahaemolyticus CHN25 Isolate
140 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
141 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
142 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
143 8051551332 Vibrio vulnificus Vv003 Isolate
144 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
145 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
146 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
147 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
148 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
149 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
150 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
151 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
152 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
153 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
154 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
155 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
156 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
157 2864768727 Aeromonas veronii S00020 Isolate Elmidae
158 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
159 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
160 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
161 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
162 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
163 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
164 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
165 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
166 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
167 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
168 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
169 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
170 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
171 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
172 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
173 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
174 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
175 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
176 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
177 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
178 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
179 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
180 2585428048 Colwellia sp. NBT2012 Isolate
181 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
182 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
183 2684622551 Vibrio campbellii E1 Isolate Unclassified
184 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
185 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
186 2820154698 Unclassified Proteobacteria Cu122P5bin26 Isolate Unclassified
187 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
188 2864791955 Aeromonas veronii S00030 Isolate Elmidae
189 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
190 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
191 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
192 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
193 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
194 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
195 8022096067 Vibrio sp. SALL6 Isolate Unclassified
196 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
197 8051461712 Vibrio vulnificus Vv002 Isolate
198 8060845732 Vibrio vulnificus Vv006 Isolate
199 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
200 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
201 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
202 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
203 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
204 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
205 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
206 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
207 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
208 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_266504 3300042612 Unclassified 5590
2 Ga0466707_318640 3300042601 Bacteria 4174
3 Ga0123357_10339065 3300009784 Bacteria 1456
4 Ga0123355_10322250 3300009826 Bacteria 2081
5 Ga0123356_11137771 3300010049 Bacteria 948
6 Ga0123353_10000545 3300010167 Bacteria 46462
7 Ga0160465_110040 3300012803 Unclassified 766
8 2227524716 2225789004 Bacteria 652
9 JGI24702J35022_10463652 3300002462 Unclassified 773
10 JGI24702J35022_10540750 3300002462 Bacteria 717
11 CVPL010W_10033673 3300002931 Unclassified 1857
12 Ga0103266_1001197 3300007067 Unclassified 4580
13 Ga0102735_1002799 3300007080 Bacteria 2552
14 Ga0103267_1000173 3300007190 Bacteria 66101
15 Ga0466694_050565 3300042594 Bacteria 23836
16 Ga0466699_307763 3300042597 Bacteria 107526
17 Ga0466712_046182 3300042614 Bacteria 9211
18 Ga0466704_376554 3300042643 Bacteria 16572
19 Ga0562378_0034 3300056814 Bacteria 488617
20 Ga0123356_10001118 3300010049 Bacteria 29695
21 Ga0123353_10000016 3300010167 Bacteria 196885
22 JGI24705J35276_12174437 3300002504 Unclassified 1317
23 Ga0103265_1002189 3300007068 Unclassified 4096
24 Ga0102735_1000004 3300007080 Bacteria 71686
25 Ga0104050_1000314 3300007153 Bacteria 5200
26 Ga0466729_007634 3300042621 Bacteria 3580
27 Ga0466705_042592 3300042612 Unclassified 2623
28 Ga0466716_507267 3300042605 Unclassified 1177
29 Ga0466720_236615 3300042607 Unclassified 3367
30 Ga0123357_10022413 3300009784 Bacteria 8463
31 Ga0123356_10410776 3300010049 Bacteria 1493
32 CVPL010W_10031916 3300002931 Unclassified 3135
33 Ga0063521_1000020 3300003973 Bacteria 138309
34 Ga0103263_102552 3300007042 Unclassified 2237
35 Ga0102734_1038004 3300007129 Bacteria 1252
36 Ga0102740_1000585 3300007140 Unclassified 9952
37 Ga0104019_1001797 3300007150 Bacteria 7170
38 Ga0103264_1000258 3300007188 Bacteria 30154
39 Ga0105003_1004694 3300007766 Bacteria 3309
40 Ga0466696_451039 3300042596 Bacteria 2568
41 Ga0466710_016777 3300042613 Bacteria 1524
42 Ga0466703_160963 3300042636 Bacteria 4525
43 Ga0466704_435605 3300042643 Unclassified 1709
44 Ga0466725_052767 3300042654 Bacteria 46776
45 Ga0466725_070062 3300042654 Bacteria 11381
46 Ga0466705_200093 3300042612 Unclassified 38183
47 Ga0466701_051774 3300042598 Bacteria 3268
48 CVPL005L_10021075 3300002938 Unclassified 3227
49 Ga0063521_1000156 3300003973 Bacteria 51654
50 Ga0103268_1000056 3300007192 Bacteria 49388
51 Ga0466710_053729 3300042613 Bacteria 15441
52 Ga0466729_106262 3300042621 Bacteria 4005
53 Ga0466706_019733 3300042599 Bacteria 2063
54 Ga0123357_10192818 3300009784 Bacteria 2342
55 FGTW_contig00063 2065487013 Bacteria 28686
56 CVPL005L_10030350 3300002938 Bacteria 1825
57 Ga0415639_162927 3300038395 Bacteria 2495
58 Ga0466692_205494 3300042591 Bacteria 113668
59 Ga0466704_275446 3300042643 Bacteria 25021
60 Ga0466701_090359 3300042598 Bacteria 1183
61 Ga0160454_100283 3300012798 Bacteria 43827
62 JGI24705J35276_12197549 3300002504 Unclassified 1556
63 Ga0103266_1000058 3300007067 Bacteria 46132
64 Ga0415639_161392 3300038395 Bacteria 4365
65 Ga0466690_316526 3300042590 Unclassified 3108
66 Ga0466735_012244 3300042624 Bacteria 3665
67 Ga0466735_102148 3300042624 Bacteria 1399
68 Ga0466702_425749 3300042635 Bacteria 2335
69 Ga0466704_422796 3300042643 Bacteria 63367
70 Ga0466705_112814 3300042612 Unclassified 1046
71 Ga0466707_284362 3300042601 Bacteria 185230
72 Ga0123356_13614188 3300010049 Bacteria 535
73 Ga0123353_10821721 3300010167 Bacteria 1279
74 Ga0160465_110033 3300012803 Bacteria 767
75 Ga0068305_11085601 3300005083 Bacteria 1221
76 Ga0103268_1000001 3300007192 Bacteria 136024
77 Ga0466728_459838 3300042620 Bacteria 2885
78 Ga0466735_036091 3300042624 Bacteria 1475
79 Ga0466724_24217 3300042649 Unclassified 21131
80 Ga0562377_0183 3300056842 Bacteria 165152
81 Ga0466706_063043 3300042599 Bacteria 1495
82 Ga0466706_183754 3300042599 Bacteria 2566
83 Ga0466722_201323 3300042609 Bacteria 18762
84 Ga0123357_10725508 3300009784 Unclassified 702
85 Ga0123356_11763665 3300010049 Bacteria 769
86 Ga0123353_10723902 3300010167 Bacteria 1391
87 Ga0102739_1001062 3300007095 Unclassified 4724
88 Ga0104050_1030697 3300007153 Unclassified 2021
89 Ga0123357_10000641 3300009784 Bacteria 34765
90 Ga0160430_100029 3300012852 Bacteria 200966
91 Ga0466691_106311 3300042593 Unclassified 5794
92 Ga0466723_297939 3300042618 Bacteria 11572
93 Ga0466728_457296 3300042620 Bacteria 126268

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_266504 Ga0466705_266504_3990_4253 87
2 3300007153 Ga0104050_1030697 Ga0104050_10306972 89
3 2225789004 2227524716 2228031604 90
4 3300038395 Ga0415639_162927 Ga0415639_162927_1049_1321 90
5 3300042590 Ga0466690_316526 Ga0466690_316526_1120_1392 90
6 3300042593 Ga0466691_106311 Ga0466691_106311_1034_1306 90
7 3300042594 Ga0466694_050565 Ga0466694_050565_182_454 90
8 3300042596 Ga0466696_451039 Ga0466696_451039_2118_2390 90
9 3300042597 Ga0466699_307763 Ga0466699_307763_71883_72155 90
10 3300042598 Ga0466701_051774 Ga0466701_051774_2960_3232 90
11 3300042598 Ga0466701_090359 Ga0466701_090359_328_600 90
12 3300042599 Ga0466706_183754 Ga0466706_183754_592_864 90
13 3300042601 Ga0466707_284362 Ga0466707_284362_24584_24856 90
14 3300042605 Ga0466716_507267 Ga0466716_507267_696_968 90
15 3300042607 Ga0466720_236615 Ga0466720_236615_2190_2462 90
16 3300042612 Ga0466705_042592 Ga0466705_042592_1811_2083 90
17 3300042612 Ga0466705_200093 Ga0466705_200093_8773_9045 90
18 3300042613 Ga0466710_053729 Ga0466710_053729_14532_14804 90
19 3300042614 Ga0466712_046182 Ga0466712_046182_8145_8417 90
20 3300042618 Ga0466723_297939 Ga0466723_297939_3477_3749 90
21 3300042620 Ga0466728_457296 Ga0466728_457296_123041_123313 90
22 3300042620 Ga0466728_459838 Ga0466728_459838_1034_1306 90
23 3300042621 Ga0466729_007634 Ga0466729_007634_2950_3222 90
24 3300042621 Ga0466729_106262 Ga0466729_106262_1265_1537 90
25 3300042624 Ga0466735_012244 Ga0466735_012244_2058_2330 90
26 3300042624 Ga0466735_036091 Ga0466735_036091_856_1128 90
27 3300042624 Ga0466735_102148 Ga0466735_102148_939_1211 90
28 3300042635 Ga0466702_425749 Ga0466702_425749_439_711 90
29 3300042636 Ga0466703_160963 Ga0466703_160963_4200_4472 90
30 3300042643 Ga0466704_376554 Ga0466704_376554_326_598 90
31 3300042643 Ga0466704_422796 Ga0466704_422796_51721_51993 90
32 3300042643 Ga0466704_435605 Ga0466704_435605_734_1006 90
33 3300042649 Ga0466724_24217 Ga0466724_24217_17139_17411 90
34 3300042654 Ga0466725_052767 Ga0466725_052767_12109_12381 90
35 3300042654 Ga0466725_070062 Ga0466725_070062_4718_4990 90
36 3300056814 Ga0562378_0034 Ga0562378_0034_171821_172093 90
37 iso_pr_bacteria 2501651205 2501715003 90
38 iso_pr_bacteria 2511231129 2511730327 90
39 iso_pr_bacteria 2528768159 2529055115 90
40 iso_pr_bacteria 2531839005 2531866331 90
41 iso_pr_bacteria 2551306507 2553346316 90
42 iso_pr_bacteria 2551306520 2553399770 90
43 iso_pr_bacteria 2551306520 2553401190 90
44 iso_pr_bacteria 2554235022 2554335538 90
45 iso_pr_bacteria 2565956518 2566024712 90
46 iso_pr_bacteria 2571042430 2572513613 90
47 iso_pr_bacteria 2571042554 2572926248 90
48 iso_pr_bacteria 2585427605 2585889015 90
49 iso_pr_bacteria 2585428048 2587693714 90
50 iso_pr_bacteria 2600255074 2600845638 90
51 iso_pr_bacteria 2603880173 2606035725 90
52 iso_pr_bacteria 2609459925 2610645080 90
53 iso_pr_bacteria 2609459958 2610823150 90
54 iso_pr_bacteria 2627853677 2628496429 90
55 iso_pr_bacteria 2627854002 2629834374 90
56 iso_pr_bacteria 2630968716 2632958086 90
57 iso_pr_bacteria 2636415542 2636992677 90
58 iso_pr_bacteria 2636415586 2637166025 90
59 iso_pr_bacteria 2648501158 2648748901 90
60 iso_pr_bacteria 2648501820 2651398465 90
61 iso_pr_bacteria 2654587515 2654658498 90
62 iso_pr_bacteria 2663763317 2666535780 90
63 iso_pr_bacteria 2667527830 2669651275 90
64 iso_pr_bacteria 2667527887 2669887801 90
65 iso_pr_bacteria 2684622551 2684819427 90
66 iso_pr_bacteria 2687453754 2690041053 90
67 iso_pr_bacteria 2687453755 2690042759 90
68 iso_pr_bacteria 2687453756 2690046948 90
69 iso_pr_bacteria 2693429575 2693742921 90
70 iso_pr_bacteria 2700989396 2702442658 90
71 iso_pr_bacteria 2711768158 2712481437 90
72 iso_pr_bacteria 2731957638 2732530803 90
73 iso_pr_bacteria 2785510762 2785804340 90
74 iso_pr_bacteria 2791355471 2794375395 90
75 iso_pr_bacteria 2791355473 2794381984 90
76 iso_pr_bacteria 2820052737 2820053052 90
77 iso_pr_bacteria 2820064859 2820065600 90
78 iso_pr_bacteria 2820096063 2820096548 90
79 iso_pr_bacteria 2820097968 2820098014 90
80 iso_pr_bacteria 2820100407 2820100741 90
81 iso_pr_bacteria 2820103659 2820104860 90
82 iso_pr_bacteria 2820136564 2820137379 90
83 iso_pr_bacteria 2820154698 2820155132 90
84 iso_pr_bacteria 2820344559 2820346747 90
85 iso_pr_bacteria 2843904799 2843905603 90
86 iso_pr_bacteria 2844251356 2844252021 90
87 iso_pr_bacteria 2848339753 2848341954 90
88 iso_pr_bacteria 2850895757 2850896696 90
89 iso_pr_bacteria 2855798354 2855802156 90
90 iso_pr_bacteria 2858407585 2858412589 90
91 iso_pr_bacteria 2860776474 2860778531 90
92 iso_pr_bacteria 2864764899 2864765383 90
93 iso_pr_bacteria 2864768727 2864771016 90
94 iso_pr_bacteria 2864777284 2864778145 90
95 iso_pr_bacteria 2864791955 2864793368 90
96 iso_pr_bacteria 2864796242 2864799258 90
97 iso_pr_bacteria 2868883784 2868887198 90
98 iso_pr_bacteria 2870361953 2870363450 90
99 iso_pr_bacteria 2871760914 2871763277 90
100 iso_pr_bacteria 2871771314 2871773877 90
101 iso_pr_bacteria 2872471378 2872473578 90
102 iso_pr_bacteria 2873884416 2873884870 90
103 iso_pr_bacteria 2875320051 2875322376 90
104 iso_pr_bacteria 2877638525 2877639640 90
105 iso_pr_bacteria 2877647439 2877649521 90
106 iso_pr_bacteria 2880115952 2880116912 90
107 iso_pr_bacteria 2889908211 2889910733 90
108 iso_pr_bacteria 2896925746 2896929714 90
109 iso_pr_bacteria 2900349738 2900353955 90
110 iso_pr_bacteria 2902438364 2902440772 90
111 iso_pr_bacteria 2902451016 2902452966 90
112 iso_pr_bacteria 2902469402 2902472493 90
113 iso_pr_bacteria 2902896024 2902896285 90
114 iso_pr_bacteria 2902916284 2902919660 90
115 iso_pr_bacteria 2908136803 2908138510 90
116 iso_pr_bacteria 2912570088 2912571083 90
117 iso_pr_bacteria 2912636047 2912638564 90
118 iso_pr_bacteria 2989793055 2989794175 90
119 iso_pr_bacteria 2997380424 2997382829 90
120 iso_pr_bacteria 3000478755 3000479814 90
121 iso_pr_bacteria 3000861951 3000863210 90
122 iso_pr_bacteria 3001459110 3001459267 90
123 iso_pr_bacteria 3001462594 3001463665 90
124 iso_pr_bacteria 3006225627 3006229315 90
125 iso_pr_bacteria 3006242587 3006245401 90
126 iso_pr_bacteria 3007478678 3007479339 90
127 iso_pr_bacteria 640963010 641030674 90
128 iso_pr_bacteria 651324086 651696277 90
129 iso_pr_bacteria 8001059720 8001060333 90
130 iso_pr_bacteria 8001394582 8001395587 90
131 iso_pr_bacteria 8004571736 8004572686 90
132 iso_pr_bacteria 8004582426 8004587387 90
133 iso_pr_bacteria 8008122225 8008124416 90
134 iso_pr_bacteria 8022087107 8022088020 90
135 iso_pr_bacteria 8022096067 8022100747 90
136 iso_pr_bacteria 8022116796 8022118572 90
137 iso_pr_bacteria 8022345672 8022345749 90
138 iso_pr_bacteria 8022439116 8022443932 90
139 iso_pr_bacteria 8033364368 8033367134 90
140 iso_pr_bacteria 8033368880 8033373398 90
141 iso_pr_bacteria 8042061949 8042065864 90
142 iso_pr_bacteria 8048928574 8048931117 90
143 iso_pr_bacteria 8051461712 8051463249 90
144 iso_pr_bacteria 8051551332 8051552683 90
145 iso_pr_bacteria 8062647588 8062650241 90
146 iso_pr_bacteria 8065462725 8065463687 90
147 iso_pr_bacteria 8065466226 8065466297 90
148 iso_pr_bacteria 8065469765 8065470749 90
149 iso_pr_bacteria 8074288691 8074289627 90
150 iso_pr_bacteria 8074292191 8074294997 90
151 iso_pr_bacteria 8099192374 8099195806 90
152 iso_pr_bacteria 8103002986 8103007892 90
153 iso_pr_bacteria 8103008710 8103013029 90
154 iso_pr_bacteria 8110023836 8110027489 90
155 iso_pr_bacteria 8116627632 8116628844 90
156 3300002462 JGI24702J35022_10463652 JGI24702J35022_104636522 91
157 3300002462 JGI24702J35022_10540750 JGI24702J35022_105407501 91
158 3300002504 JGI24705J35276_12197549 JGI24705J35276_121975492 91
159 3300002931 CVPL010W_10031916 CVPL010W_100319163 91
160 3300002938 CVPL005L_10021075 CVPL005L_100210754 91
161 3300003973 Ga0063521_1000020 Ga0063521_1000020125 91
162 3300005083 Ga0068305_11085601 Ga0068305_110856011 91
163 3300007042 Ga0103263_102552 Ga0103263_1025522 91
164 3300007067 Ga0103266_1000058 Ga0103266_100005836 91
165 3300007067 Ga0103266_1001197 Ga0103266_10011973 91
166 3300007068 Ga0103265_1002189 Ga0103265_10021892 91
167 3300007080 Ga0102735_1000004 Ga0102735_100000430 91
168 3300007080 Ga0102735_1002799 Ga0102735_10027992 91
169 3300007095 Ga0102739_1001062 Ga0102739_10010622 91
170 3300007140 Ga0102740_1000585 Ga0102740_10005852 91
171 3300007150 Ga0104019_1001797 Ga0104019_10017979 91
172 3300007153 Ga0104050_1000314 Ga0104050_10003143 91
173 3300007188 Ga0103264_1000258 Ga0103264_10002588 91
174 3300007192 Ga0103268_1000001 Ga0103268_10000012 91
175 3300007192 Ga0103268_1000056 Ga0103268_10000562 91
176 3300007766 Ga0105003_1004694 Ga0105003_10046945 91
177 3300009784 Ga0123357_10000641 Ga0123357_1000064118 91
178 3300009784 Ga0123357_10192818 Ga0123357_101928183 91
179 3300009784 Ga0123357_10339065 Ga0123357_103390653 91
180 3300010049 Ga0123356_10001118 Ga0123356_1000111820 91
181 3300010049 Ga0123356_10410776 Ga0123356_104107762 91
182 3300010049 Ga0123356_11137771 Ga0123356_111377711 91
183 3300010049 Ga0123356_11763665 Ga0123356_117636651 91
184 3300010167 Ga0123353_10000016 Ga0123353_1000001648 91
185 3300010167 Ga0123353_10000545 Ga0123353_1000054521 91
186 3300012798 Ga0160454_100283 Ga0160454_10028340 91
187 3300012803 Ga0160465_110033 Ga0160465_1100332 91
188 3300012803 Ga0160465_110040 Ga0160465_1100401 91
189 3300012852 Ga0160430_100029 Ga0160430_10002980 91
190 3300038395 Ga0415639_161392 Ga0415639_161392_2095_2370 91
191 3300042599 Ga0466706_063043 Ga0466706_063043_1109_1384 91
192 iso_pr_bacteria 2529292851 2530235916 91
193 iso_pr_bacteria 2558860143 2559000709 91
194 iso_pr_bacteria 2597489902 2597920295 91
195 iso_pr_bacteria 2675903377 2677723500 91
196 iso_pr_bacteria 2820353569 2820354403 91
197 iso_pr_bacteria 2837516909 2837517729 91
198 iso_pr_bacteria 2846386538 2846387692 91
199 iso_pr_bacteria 2850131454 2850135004 91
200 iso_pr_bacteria 2877522083 2877522750 91
201 iso_pr_bacteria 2896187957 2896189943 91
202 iso_pr_bacteria 2902896024 2902896339 91
203 iso_pr_bacteria 2902916284 2902918463 91
204 iso_pr_bacteria 2923762712 2923763435 91
205 iso_pr_bacteria 2936628749 2936628972 91
206 iso_pr_bacteria 2940218408 2940218548 91
207 iso_pr_bacteria 2940261461 2940261602 91
208 iso_pr_bacteria 8002304686 8002305907 91
209 iso_pr_bacteria 8066790652 8066791266 91
210 iso_pr_bacteria 8066792404 8066792979 91
211 iso_pr_bacteria 8066794103 8066795320 91
212 iso_pr_bacteria 8066795793 8066795974 91
213 iso_pr_bacteria 8066797744 8066798326 91
214 iso_pr_bacteria 8066799369 8066799925 91
215 3300003973 Ga0063521_1000156 Ga0063521_100015620 92
216 3300009784 Ga0123357_10022413 Ga0123357_100224132 92
217 3300042599 Ga0466706_019733 Ga0466706_019733_1266_1544 92
218 3300042613 Ga0466710_016777 Ga0466710_016777_662_940 92
219 3300002504 JGI24705J35276_12174437 JGI24705J35276_121744372 93
220 3300002931 CVPL010W_10033673 CVPL010W_100336734 93
221 3300002938 CVPL005L_10030350 CVPL005L_100303504 93
222 3300007129 Ga0102734_1038004 Ga0102734_10380041 93
223 3300009784 Ga0123357_10725508 Ga0123357_107255081 93
224 3300010167 Ga0123353_10723902 Ga0123353_107239022 93
225 3300056842 Ga0562377_0183 Ga0562377_0183_141427_141708 93
226 iso_pr_bacteria 2619619082 2620612656 93
227 iso_pr_bacteria 648276708 648767521 93
228 2065487013 FGTW_contig00063 FGTW_03519000 94
229 iso_pr_bacteria 2885043073 2885043616 94
230 iso_pr_bacteria 2885046828 2885046859 94
231 iso_pr_bacteria 2885050628 2885053090 94
232 iso_pr_bacteria 2885054481 2885054957 94
233 iso_pr_bacteria 2885058212 2885061741 94
234 iso_pr_bacteria 2885061987 2885062447 94
235 iso_pr_bacteria 2885065815 2885066326 94
236 3300042591 Ga0466692_205494 Ga0466692_205494_34454_34741 95
237 3300009826 Ga0123355_10322250 Ga0123355_103222501 96
238 iso_pr_bacteria 2671180705 2673869737 96
239 3300010049 Ga0123356_13614188 Ga0123356_136141881 97
240 iso_pr_bacteria 8051534459 8051537472 97
241 iso_pr_bacteria 8060845732 8060847464 97
242 iso_pr_bacteria 2820141685 2820142066 100
243 3300042612 Ga0466705_112814 Ga0466705_112814_614_919 101
244 3300007190 Ga0103267_1000173 Ga0103267_100017317 102
245 3300042609 Ga0466722_201323 Ga0466722_201323_12636_12950 104
246 iso_pr_bacteria 8048923410 8048925934 109
247 3300042601 Ga0466707_318640 Ga0466707_318640_3111_3443 110
248 3300010167 Ga0123353_10821721 Ga0123353_108217212 118
249 3300042643 Ga0466704_275446 Ga0466704_275446_17323_17682 119

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00216 Bac_DNA_binding Bacterial DNA-binding protein 15 103 0.99
PF18291 HU-HIG HU domain fused to wHTH, Ig, or Glycine-rich motif 11 103 0.82

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
1huu-assembly1.cif.gz_A-2 DNA-BINDING PROTEIN HU FROM BACILLUS STEAROTHERMOPHILUS 0.963 15 104
4yew-assembly1.cif.gz_A HUab-19bp 0.954 15 104
4p3v-assembly1.cif.gz_A-2 Crystal structure of the E. coli HU beta2 protein 0.948 15 104
6o8q-assembly1.cif.gz_D HUaa 19bp SYM DNA pH 4.5 0.947 14 104
2o97-assembly1.cif.gz_B Crystal Structure of E. coli HU heterodimer 0.945 15 104
IDDescriptionScoreStartEndSuperfamily
6n2lA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.9159 12 103 4.10.520.10
4yexA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.9093 15 104 4.10.520.10
5fbmA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.88 16 103 4.10.520.10
4dkyA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8731 15 103 4.10.520.10
5cvxA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8586 14 103 4.10.520.10
IDDescriptionScoreStartEndGO Terms
AF-A0A840YFA2-F1-model_v4 Uncharacterized/unreviewed 0.9709 12 102 GO:0005829
GO:0003677
GO:0030527
GO:0030261
AF-A0A381QUW0-F1-model_v4 DNA-binding protein HU 0.9677 11 103 GO:0005829
GO:0032991
GO:0003677
GO:0042802
GO:0030527
GO:0030261
GO:0010467
AF-A0A496PD49-F1-model_v4 Uncharacterized/unreviewed 0.9646 15 103

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.66 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.