Protein Family IF06882
Metagenome
Isolate
249
Members
208
Samples
93
Scaffolds
91.22
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_201323|Ga0466722_201323_12636_12950
- Length
- 104 aa
- Sequence
- VYHLNIFTHFREEYMNKAELIAAMAERAELSKKDAEKALTAFIDTVTDTLKEGEKVSLVGFGTFEARERAARVGINPRTKEKMNILATKTPSFKAGKAFKEVLK
Sample Types
Isolate
62.6%
Metagenome
37.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
42.1%
Termitidae
8.2%
Drosophilidae
6.7%
Formicidae
6.2%
Anthocoridae
4.6%
Kalotermitidae
4.6%
Halictidae
4.1%
Elmidae
2.6%
Curculionidae
2.6%
Apidae
2.1%
Tenebrionidae
2.1%
Rhinotermitidae
1.5%
Talitridae
1.5%
Palinuridae
1.5%
Majidae
1.0%
Blattidae
1.0%
Culicidae
0.5%
Scarabaeidae
0.5%
Nephropidae
0.5%
Thripidae
0.5%
Artemiidae
0.5%
Passalidae
0.5%
Calliphoridae
0.5%
Pteromalidae
0.5%
Pentatomidae
0.5%
Gryllidae
0.5%
Crambidae
0.5%
Termopsidae
0.5%
Lysianassidae
0.5%
Hodotermitidae
0.5%
Penaeidae
0.5%
Taxonomy
Archaea
0
Bacteria
225
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 2 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 3 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 4 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 5 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 6 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 7 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 8 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 9 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 10 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 11 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 12 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 17 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 18 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 19 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 20 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 21 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 22 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 23 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 24 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 28 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 29 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 30 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 31 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 32 | 2820096063 | Unclassified Proteobacteria Lab288P3bin136 | Isolate | Unclassified |
| 33 | 2820097968 | Unclassified Proteobacteria Lab288P3bin104 | Isolate | Unclassified |
| 34 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 35 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 36 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 37 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 38 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 39 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 40 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 41 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 44 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 45 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 46 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 47 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 48 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 49 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 50 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 51 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300007766 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 4 gut | Metagenome | Drosophilidae |
| 54 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 55 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 56 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 57 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 58 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 59 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 60 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 61 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 62 | 2820141685 | Unclassified Proteobacteria Emb289P3bin118 | Isolate | Unclassified |
| 63 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 64 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 65 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 66 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 67 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 68 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 69 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 70 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 71 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 72 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 73 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 74 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 75 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 76 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 77 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 78 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 79 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 80 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 81 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 82 | 2820100407 | Unclassified Proteobacteria Lab288P1bin48 | Isolate | Unclassified |
| 83 | 2820136564 | Unclassified Proteobacteria Emb289P3bin18 | Isolate | Unclassified |
| 84 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 85 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 86 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 87 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 88 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 89 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 90 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 91 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 92 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 93 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 94 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 95 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 96 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 97 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 98 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 99 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 100 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 101 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 102 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 103 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 104 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 105 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 106 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 107 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 108 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 109 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 110 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 111 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 112 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 113 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 114 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 115 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 116 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 117 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 118 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 119 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 120 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 121 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 122 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 123 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 124 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 125 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 126 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 127 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 128 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 129 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 130 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 131 | 2820052737 | Unclassified Proteobacteria Th196P3bin127 | Isolate | Unclassified |
| 132 | 2820064859 | Unclassified Proteobacteria Nt197P3bin78 | Isolate | Unclassified |
| 133 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 134 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 135 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 136 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 137 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 138 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 139 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 140 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 141 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 142 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 143 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 144 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 145 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 146 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 147 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 148 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 149 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 150 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 151 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 152 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 153 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 154 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 155 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 156 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 157 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 158 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 159 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 160 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 161 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 162 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 163 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 164 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 165 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 166 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 167 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 168 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 169 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 170 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 171 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 172 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 173 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 174 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 175 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 176 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 177 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 178 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 179 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 180 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 181 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 182 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 183 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 184 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 185 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 186 | 2820154698 | Unclassified Proteobacteria Cu122P5bin26 | Isolate | Unclassified |
| 187 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 188 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 189 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 190 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 191 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 192 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 193 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 194 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 195 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 196 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 197 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 198 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 199 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 200 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 201 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 202 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 203 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 204 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 205 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 206 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 207 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 208 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_266504 | 3300042612 | Unclassified | 5590 |
| 2 | Ga0466707_318640 | 3300042601 | Bacteria | 4174 |
| 3 | Ga0123357_10339065 | 3300009784 | Bacteria | 1456 |
| 4 | Ga0123355_10322250 | 3300009826 | Bacteria | 2081 |
| 5 | Ga0123356_11137771 | 3300010049 | Bacteria | 948 |
| 6 | Ga0123353_10000545 | 3300010167 | Bacteria | 46462 |
| 7 | Ga0160465_110040 | 3300012803 | Unclassified | 766 |
| 8 | 2227524716 | 2225789004 | Bacteria | 652 |
| 9 | JGI24702J35022_10463652 | 3300002462 | Unclassified | 773 |
| 10 | JGI24702J35022_10540750 | 3300002462 | Bacteria | 717 |
| 11 | CVPL010W_10033673 | 3300002931 | Unclassified | 1857 |
| 12 | Ga0103266_1001197 | 3300007067 | Unclassified | 4580 |
| 13 | Ga0102735_1002799 | 3300007080 | Bacteria | 2552 |
| 14 | Ga0103267_1000173 | 3300007190 | Bacteria | 66101 |
| 15 | Ga0466694_050565 | 3300042594 | Bacteria | 23836 |
| 16 | Ga0466699_307763 | 3300042597 | Bacteria | 107526 |
| 17 | Ga0466712_046182 | 3300042614 | Bacteria | 9211 |
| 18 | Ga0466704_376554 | 3300042643 | Bacteria | 16572 |
| 19 | Ga0562378_0034 | 3300056814 | Bacteria | 488617 |
| 20 | Ga0123356_10001118 | 3300010049 | Bacteria | 29695 |
| 21 | Ga0123353_10000016 | 3300010167 | Bacteria | 196885 |
| 22 | JGI24705J35276_12174437 | 3300002504 | Unclassified | 1317 |
| 23 | Ga0103265_1002189 | 3300007068 | Unclassified | 4096 |
| 24 | Ga0102735_1000004 | 3300007080 | Bacteria | 71686 |
| 25 | Ga0104050_1000314 | 3300007153 | Bacteria | 5200 |
| 26 | Ga0466729_007634 | 3300042621 | Bacteria | 3580 |
| 27 | Ga0466705_042592 | 3300042612 | Unclassified | 2623 |
| 28 | Ga0466716_507267 | 3300042605 | Unclassified | 1177 |
| 29 | Ga0466720_236615 | 3300042607 | Unclassified | 3367 |
| 30 | Ga0123357_10022413 | 3300009784 | Bacteria | 8463 |
| 31 | Ga0123356_10410776 | 3300010049 | Bacteria | 1493 |
| 32 | CVPL010W_10031916 | 3300002931 | Unclassified | 3135 |
| 33 | Ga0063521_1000020 | 3300003973 | Bacteria | 138309 |
| 34 | Ga0103263_102552 | 3300007042 | Unclassified | 2237 |
| 35 | Ga0102734_1038004 | 3300007129 | Bacteria | 1252 |
| 36 | Ga0102740_1000585 | 3300007140 | Unclassified | 9952 |
| 37 | Ga0104019_1001797 | 3300007150 | Bacteria | 7170 |
| 38 | Ga0103264_1000258 | 3300007188 | Bacteria | 30154 |
| 39 | Ga0105003_1004694 | 3300007766 | Bacteria | 3309 |
| 40 | Ga0466696_451039 | 3300042596 | Bacteria | 2568 |
| 41 | Ga0466710_016777 | 3300042613 | Bacteria | 1524 |
| 42 | Ga0466703_160963 | 3300042636 | Bacteria | 4525 |
| 43 | Ga0466704_435605 | 3300042643 | Unclassified | 1709 |
| 44 | Ga0466725_052767 | 3300042654 | Bacteria | 46776 |
| 45 | Ga0466725_070062 | 3300042654 | Bacteria | 11381 |
| 46 | Ga0466705_200093 | 3300042612 | Unclassified | 38183 |
| 47 | Ga0466701_051774 | 3300042598 | Bacteria | 3268 |
| 48 | CVPL005L_10021075 | 3300002938 | Unclassified | 3227 |
| 49 | Ga0063521_1000156 | 3300003973 | Bacteria | 51654 |
| 50 | Ga0103268_1000056 | 3300007192 | Bacteria | 49388 |
| 51 | Ga0466710_053729 | 3300042613 | Bacteria | 15441 |
| 52 | Ga0466729_106262 | 3300042621 | Bacteria | 4005 |
| 53 | Ga0466706_019733 | 3300042599 | Bacteria | 2063 |
| 54 | Ga0123357_10192818 | 3300009784 | Bacteria | 2342 |
| 55 | FGTW_contig00063 | 2065487013 | Bacteria | 28686 |
| 56 | CVPL005L_10030350 | 3300002938 | Bacteria | 1825 |
| 57 | Ga0415639_162927 | 3300038395 | Bacteria | 2495 |
| 58 | Ga0466692_205494 | 3300042591 | Bacteria | 113668 |
| 59 | Ga0466704_275446 | 3300042643 | Bacteria | 25021 |
| 60 | Ga0466701_090359 | 3300042598 | Bacteria | 1183 |
| 61 | Ga0160454_100283 | 3300012798 | Bacteria | 43827 |
| 62 | JGI24705J35276_12197549 | 3300002504 | Unclassified | 1556 |
| 63 | Ga0103266_1000058 | 3300007067 | Bacteria | 46132 |
| 64 | Ga0415639_161392 | 3300038395 | Bacteria | 4365 |
| 65 | Ga0466690_316526 | 3300042590 | Unclassified | 3108 |
| 66 | Ga0466735_012244 | 3300042624 | Bacteria | 3665 |
| 67 | Ga0466735_102148 | 3300042624 | Bacteria | 1399 |
| 68 | Ga0466702_425749 | 3300042635 | Bacteria | 2335 |
| 69 | Ga0466704_422796 | 3300042643 | Bacteria | 63367 |
| 70 | Ga0466705_112814 | 3300042612 | Unclassified | 1046 |
| 71 | Ga0466707_284362 | 3300042601 | Bacteria | 185230 |
| 72 | Ga0123356_13614188 | 3300010049 | Bacteria | 535 |
| 73 | Ga0123353_10821721 | 3300010167 | Bacteria | 1279 |
| 74 | Ga0160465_110033 | 3300012803 | Bacteria | 767 |
| 75 | Ga0068305_11085601 | 3300005083 | Bacteria | 1221 |
| 76 | Ga0103268_1000001 | 3300007192 | Bacteria | 136024 |
| 77 | Ga0466728_459838 | 3300042620 | Bacteria | 2885 |
| 78 | Ga0466735_036091 | 3300042624 | Bacteria | 1475 |
| 79 | Ga0466724_24217 | 3300042649 | Unclassified | 21131 |
| 80 | Ga0562377_0183 | 3300056842 | Bacteria | 165152 |
| 81 | Ga0466706_063043 | 3300042599 | Bacteria | 1495 |
| 82 | Ga0466706_183754 | 3300042599 | Bacteria | 2566 |
| 83 | Ga0466722_201323 | 3300042609 | Bacteria | 18762 |
| 84 | Ga0123357_10725508 | 3300009784 | Unclassified | 702 |
| 85 | Ga0123356_11763665 | 3300010049 | Bacteria | 769 |
| 86 | Ga0123353_10723902 | 3300010167 | Bacteria | 1391 |
| 87 | Ga0102739_1001062 | 3300007095 | Unclassified | 4724 |
| 88 | Ga0104050_1030697 | 3300007153 | Unclassified | 2021 |
| 89 | Ga0123357_10000641 | 3300009784 | Bacteria | 34765 |
| 90 | Ga0160430_100029 | 3300012852 | Bacteria | 200966 |
| 91 | Ga0466691_106311 | 3300042593 | Unclassified | 5794 |
| 92 | Ga0466723_297939 | 3300042618 | Bacteria | 11572 |
| 93 | Ga0466728_457296 | 3300042620 | Bacteria | 126268 |
Family Sequences
Functional Annotation
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1huu-assembly1.cif.gz_A-2 | DNA-BINDING PROTEIN HU FROM BACILLUS STEAROTHERMOPHILUS | 0.963 | 15 | 104 |
| 4yew-assembly1.cif.gz_A | HUab-19bp | 0.954 | 15 | 104 |
| 4p3v-assembly1.cif.gz_A-2 | Crystal structure of the E. coli HU beta2 protein | 0.948 | 15 | 104 |
| 6o8q-assembly1.cif.gz_D | HUaa 19bp SYM DNA pH 4.5 | 0.947 | 14 | 104 |
| 2o97-assembly1.cif.gz_B | Crystal Structure of E. coli HU heterodimer | 0.945 | 15 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6n2lA00 | Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins | 0.9159 | 12 | 103 | 4.10.520.10 |
| 4yexA00 | Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins | 0.9093 | 15 | 104 | 4.10.520.10 |
| 5fbmA00 | Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins | 0.88 | 16 | 103 | 4.10.520.10 |
| 4dkyA00 | Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins | 0.8731 | 15 | 103 | 4.10.520.10 |
| 5cvxA00 | Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins | 0.8586 | 14 | 103 | 4.10.520.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840YFA2-F1-model_v4 | Uncharacterized/unreviewed | 0.9709 | 12 | 102 |
GO:0005829
GO:0003677 GO:0030527 GO:0030261 |
| AF-A0A381QUW0-F1-model_v4 | DNA-binding protein HU | 0.9677 | 11 | 103 |
GO:0005829
GO:0032991 GO:0003677 GO:0042802 GO:0030527 GO:0030261 GO:0010467 |
| AF-A0A496PD49-F1-model_v4 | Uncharacterized/unreviewed | 0.9646 | 15 | 103 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.66 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.