Protein Family IF06874

Metagenome Isolate
181 Members
57 Samples
175 Scaffolds
180.02 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_195473|Ga0466722_195473_5725_6291
Length
188 aa
Sequence
MAERQAKFYVLRAVSGKENKVREYIEAEMKNSDLGDHVLQVLIPTEKTFTVRNGKKVMKERAYLPGYVLVEADLVGEVVHRLRNIPNVIGFLGVKDTRDGAKDNQPVPLRPSEVARVLGTVDELQEQEEEMDVRFYTGETVKVTYGPFNGFDGTIEEVNTEKKKLKVMVKIFGRKTPIELSYVQVEKE

📊 Sample Types

Isolate 3.3%
Metagenome 96.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.4%
Kalotermitidae 24.6%
Blattidae 8.8%
Termopsidae 7.0%
Unclassified 7.0%
Rhinotermitidae 5.3%
Passalidae 5.3%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 167
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
12 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
13 2923982719 Parabacteroides sp. 52 Isolate Blattidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
25 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
26 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
27 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
28 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
33 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
34 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
39 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
51 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
52 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
53 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
54 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
57 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_032449 3300042659 Bacteria 75954
2 Ga0466690_050653 3300042590 Bacteria 29405
3 Ga0466699_008495 3300042597 Bacteria 2196
4 Ga0466703_102327 3300042636 Bacteria 38440
5 Ga0466709_014514 3300042648 Bacteria 492815
6 Ga0466708_228295 3300042652 Bacteria 20202
7 Ga0466725_035410 3300042654 Bacteria 15741
8 Ga0466727_194661 3300042655 Bacteria 11133
9 Ga0466722_015704 3300042609 Bacteria 71312
10 Ga0466722_061307 3300042609 Bacteria 5586
11 Ga0466711_017007 3300042615 Bacteria 3131
12 Ga0466715_123796 3300042616 Bacteria 41840
13 Ga0466726_071920 3300042619 Bacteria 12800
14 Ga0466726_331043 3300042619 Bacteria 1414
15 Ga0466728_093817 3300042620 Bacteria 21218
16 Ga0466728_294380 3300042620 Bacteria 1500
17 2227476549 2225789004 Bacteria 881
18 IMNBL1DRAFT_c0011347 3300000062 Bacteria 4170
19 JGI24698J34947_10083571 3300002449 Bacteria 1489
20 JGI24702J35022_10080012 3300002462 Unclassified 1769
21 Ga0466733_146149 3300042659 Bacteria 8985
22 Ga0466691_157960 3300042593 Bacteria 19718
23 Ga0466696_394022 3300042596 Bacteria 212291
24 Ga0466703_394273 3300042636 Bacteria 22669
25 Ga0466704_020547 3300042643 Unclassified 1268
26 Ga0466704_380863 3300042643 Bacteria 21447
27 Ga0466727_242249 3300042655 Bacteria 19089
28 Ga0466727_249957 3300042655 Bacteria 36639
29 Ga0466700_345407 3300042600 Bacteria 1595
30 Ga0466713_041439 3300042602 Bacteria 39210
31 Ga0466713_047328 3300042602 Bacteria 1761
32 Ga0466713_135469 3300042602 Bacteria 58117
33 Ga0466716_118364 3300042605 Bacteria 14527
34 Ga0466719_226421 3300042606 Unclassified 2961
35 Ga0466722_215146 3300042609 Bacteria 10662
36 Ga0466711_182646 3300042615 Bacteria 12320
37 Ga0466711_198310 3300042615 Bacteria 16707
38 Ga0466715_077069 3300042616 Bacteria 2855
39 Ga0466715_185354 3300042616 Bacteria 6442
40 Ga0466723_307718 3300042618 Bacteria 90883
41 Ga0466726_290125 3300042619 Bacteria 7644
42 IMNBL1DRAFT_c0003160 3300000062 Bacteria 10827
43 Ga0466705_106782 3300042612 Bacteria 11995
44 Ga0466692_047378 3300042591 Bacteria 93081
45 Ga0466694_384618 3300042594 Bacteria 1382
46 Ga0466696_131555 3300042596 Bacteria 5983
47 Ga0466704_256165 3300042643 Unclassified 2707
48 Ga0466727_191168 3300042655 Bacteria 2023
49 Ga0466713_058214 3300042602 Bacteria 26989
50 Ga0466722_148707 3300042609 Bacteria 7298
51 Ga0466722_195473 3300042609 Bacteria 14303
52 Ga0466698_056649 3300042610 Bacteria 2816
53 Ga0466710_142051 3300042613 Bacteria 1894
54 Ga0466710_371909 3300042613 Bacteria 1328
55 Ga0466728_202737 3300042620 Bacteria 14768
56 Ga0466729_010781 3300042621 Bacteria 16724
57 JGI24702J35022_10013322 3300002462 Bacteria 4556
58 Ga0466697_270836 3300042611 Bacteria 3358
59 Ga0466705_091456 3300042612 Bacteria 20257
60 Ga0466705_278201 3300042612 Bacteria 13432
61 Ga0466656_204708 3300042550 Bacteria 13840
62 Ga0466690_384953 3300042590 Bacteria 5227
63 Ga0466696_029934 3300042596 Bacteria 1847
64 Ga0466735_119142 3300042624 Unclassified 1196
65 Ga0466704_258054 3300042643 Bacteria 19952
66 Ga0466725_378000 3300042654 Bacteria 1239
67 Ga0466707_015416 3300042601 Bacteria 12912
68 Ga0466707_358841 3300042601 Bacteria 13443
69 Ga0466713_009753 3300042602 Bacteria 19425
70 Ga0466713_032013 3300042602 Bacteria 64924
71 Ga0466717_116989 3300042604 Bacteria 1978
72 Ga0466719_076192 3300042606 Bacteria 17216
73 Ga0466719_084719 3300042606 Bacteria 20043
74 Ga0466711_035602 3300042615 Bacteria 27116
75 Ga0466718_046598 3300042617 Bacteria 2056
76 Ga0466723_281374 3300042618 Bacteria 18481
77 2227297451 2225789004 Bacteria 6645
78 IMNBL1DRAFT_c0001329 3300000062 Bacteria 18611
79 IMNBL1DRAFT_c0069950 3300000062 Bacteria 1017
80 JGI24702J35022_10001523 3300002462 Bacteria 14396
81 JGI24702J35022_10003759 3300002462 Bacteria 9121
82 JGI24702J35022_10010998 3300002462 Bacteria 5047
83 JGI24699J35502_11133854 3300002509 Bacteria 17140
84 Ga0068305_10011238 3300005083 Bacteria 1893
85 Ga0068305_10025899 3300005083 Bacteria 21025
86 Ga0466705_327310 3300042612 Bacteria 4205
87 Ga0466733_010750 3300042659 Bacteria 35772
88 Ga0466690_021422 3300042590 Bacteria 41181
89 Ga0466693_432662 3300042592 Bacteria 3597
90 Ga0466694_133825 3300042594 Unclassified 1029
91 Ga0466731_280324 3300042622 Bacteria 1505
92 Ga0466735_072871 3300042624 Bacteria 6769
93 Ga0466703_173046 3300042636 Bacteria 32889
94 Ga0466704_076372 3300042643 Bacteria 18331
95 Ga0466709_110644 3300042648 Bacteria 26395
96 Ga0466709_117347 3300042648 Bacteria 10931
97 Ga0466706_145688 3300042599 Bacteria 20534
98 Ga0466714_079129 3300042603 Bacteria 4453
99 Ga0466719_129534 3300042606 Bacteria 13143
100 Ga0466719_273011 3300042606 Bacteria 1733
101 Ga0466715_299034 3300042616 Bacteria 37987
102 Ga0466726_336827 3300042619 Bacteria 13204
103 Ga0466726_404423 3300042619 Bacteria 1845
104 IMNBL1DRAFT_c0000530 3300000062 Bacteria 31244
105 Ga0068302_10201357 3300005071 Bacteria 748
106 Ga0466697_114936 3300042611 Bacteria 1532
107 Ga0466697_133731 3300042611 Bacteria 1753
108 Ga0466705_246551 3300042612 Bacteria 20411
109 Ga0466690_256751 3300042590 Bacteria 42016
110 Ga0466692_172495 3300042591 Bacteria 15440
111 Ga0466691_102040 3300042593 Bacteria 39028
112 Ga0466696_429379 3300042596 Bacteria 1220
113 Ga0466703_281595 3300042636 Bacteria 16908
114 Ga0466709_117007 3300042648 Unclassified 3887
115 Ga0466727_131064 3300042655 Bacteria 28730
116 Ga0466727_307077 3300042655 Bacteria 3818
117 Ga0466713_044001 3300042602 Bacteria 42258
118 Ga0466713_056227 3300042602 Unclassified 2092
119 Ga0466716_058478 3300042605 Bacteria 30197
120 Ga0466716_163313 3300042605 Bacteria 6326
121 Ga0466715_187003 3300042616 Bacteria 2578
122 Ga0466718_009529 3300042617 Bacteria 1933
123 Ga0466723_254775 3300042618 Unclassified 1063
124 Ga0466729_072533 3300042621 Bacteria 11377
125 2227426932 2225789004 Bacteria 1040
126 JGI24702J35022_10002246 3300002462 Bacteria 11872
127 JGI24702J35022_10299616 3300002462 Bacteria 948
128 Ga0068302_10046659 3300005071 Bacteria 1817
129 Ga0466690_407298 3300042590 Bacteria 9434
130 Ga0466693_366944 3300042592 Bacteria 1436
131 Ga0466694_307155 3300042594 Unclassified 1291
132 Ga0466696_205463 3300042596 Bacteria 14851
133 Ga0123356_11190125 3300010049 Bacteria 928
134 Ga0466731_134541 3300042622 Bacteria 1007
135 Ga0466735_208518 3300042624 Bacteria 6138
136 Ga0466703_320533 3300042636 Bacteria 31058
137 Ga0466704_226601 3300042643 Bacteria 45308
138 Ga0466704_409278 3300042643 Unclassified 1704
139 Ga0466708_013558 3300042652 Bacteria 23219
140 Ga0466727_305684 3300042655 Bacteria 3825
141 Ga0466707_388330 3300042601 Bacteria 11315
142 Ga0466711_125896 3300042615 Bacteria 8224
143 Ga0466711_140047 3300042615 Bacteria 6511
144 Ga0466715_169547 3300042616 Bacteria 17957
145 Ga0466715_302955 3300042616 Bacteria 14273
146 Ga0466715_446053 3300042616 Bacteria 21540
147 Ga0466726_291963 3300042619 Bacteria 1866
148 Ga0466728_172522 3300042620 Bacteria 21138
149 2227035910 2225789003 Bacteria 20847
150 IMNBL1DRAFT_c0002427 3300000062 Bacteria 12971
151 JGI24698J34947_10007360 3300002449 Bacteria 6053
152 JGI24702J35022_10141245 3300002462 Bacteria 1344
153 JGI24705J35276_12222374 3300002504 Bacteria 2416
154 Ga0068302_10125739 3300005071 Bacteria 1936
155 Ga0068305_10001980 3300005083 Bacteria 22123
156 Ga0068305_10010489 3300005083 Bacteria 8679
157 Ga0068305_10112966 3300005083 Bacteria 1859
158 Ga0072940_1312627 3300005200 Bacteria 1388
159 Ga0466657_242066 3300042582 Bacteria 3290
160 Ga0466690_016395 3300042590 Unclassified 1479
161 Ga0466690_092689 3300042590 Bacteria 81043
162 Ga0466693_367804 3300042592 Unclassified 1027
163 Ga0466691_155305 3300042593 Bacteria 5444
164 Ga0466695_313501 3300042595 Bacteria 1219
165 Ga0123353_10320117 3300010167 Bacteria 2354
166 Ga0466731_306348 3300042622 Bacteria 1220
167 Ga0466709_179015 3300042648 Bacteria 32482
168 Ga0466708_435851 3300042652 Bacteria 53327
169 Ga0466713_005670 3300042602 Bacteria 17868
170 Ga0466719_040334 3300042606 Bacteria 9091
171 Ga0466698_032639 3300042610 Bacteria 2032
172 Ga0466715_257341 3300042616 Bacteria 23626
173 Ga0466723_118143 3300042618 Bacteria 49080
174 2227529906 2225789004 Bacteria 3170
175 Ga0068305_10342568 3300005083 Unclassified 1520

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042613 Ga0466710_142051 Ga0466710_142051_1251_1709 152
2 3300042594 Ga0466694_384618 Ga0466694_384618_733_1275 160
3 3300042594 Ga0466694_133825 Ga0466694_133825_284_826 170
4 3300042593 Ga0466691_155305 Ga0466691_155305_245_784 179
5 3300042602 Ga0466713_041439 Ga0466713_041439_9090_9629 179
6 3300042619 Ga0466726_404423 Ga0466726_404423_1045_1584 179
7 3300042621 Ga0466729_072533 Ga0466729_072533_356_895 179
8 3300042636 Ga0466703_173046 Ga0466703_173046_9297_9836 179
9 2225789003 2227035910 2227396222 180
10 2225789004 2227297451 2227747695 180
11 2225789004 2227426932 2227867132 180
12 2225789004 2227476549 2227929228 180
13 2225789004 2227529906 2228040955 180
14 3300005083 Ga0068305_10011238 Ga0068305_100112383 180
15 3300005083 Ga0068305_10342568 Ga0068305_103425681 180
16 3300010167 Ga0123353_10320117 Ga0123353_103201172 180
17 3300042550 Ga0466656_204708 Ga0466656_204708_779_1321 180
18 3300042582 Ga0466657_242066 Ga0466657_242066_166_708 180
19 3300042590 Ga0466690_016395 Ga0466690_016395_239_781 180
20 3300042590 Ga0466690_021422 Ga0466690_021422_32570_33112 180
21 3300042590 Ga0466690_050653 Ga0466690_050653_18310_18852 180
22 3300042590 Ga0466690_092689 Ga0466690_092689_30552_31094 180
23 3300042590 Ga0466690_256751 Ga0466690_256751_16401_16943 180
24 3300042590 Ga0466690_384953 Ga0466690_384953_4651_5193 180
25 3300042590 Ga0466690_407298 Ga0466690_407298_5133_5675 180
26 3300042591 Ga0466692_047378 Ga0466692_047378_2834_3376 180
27 3300042591 Ga0466692_172495 Ga0466692_172495_3205_3747 180
28 3300042592 Ga0466693_366944 Ga0466693_366944_244_786 180
29 3300042592 Ga0466693_367804 Ga0466693_367804_233_775 180
30 3300042592 Ga0466693_432662 Ga0466693_432662_303_845 180
31 3300042593 Ga0466691_102040 Ga0466691_102040_13742_14284 180
32 3300042593 Ga0466691_157960 Ga0466691_157960_10648_11190 180
33 3300042594 Ga0466694_307155 Ga0466694_307155_126_668 180
34 3300042595 Ga0466695_313501 Ga0466695_313501_252_794 180
35 3300042596 Ga0466696_029934 Ga0466696_029934_991_1533 180
36 3300042596 Ga0466696_131555 Ga0466696_131555_2630_3172 180
37 3300042596 Ga0466696_394022 Ga0466696_394022_70263_70805 180
38 3300042596 Ga0466696_429379 Ga0466696_429379_89_631 180
39 3300042597 Ga0466699_008495 Ga0466699_008495_87_629 180
40 3300042599 Ga0466706_145688 Ga0466706_145688_10685_11227 180
41 3300042600 Ga0466700_345407 Ga0466700_345407_452_994 180
42 3300042601 Ga0466707_015416 Ga0466707_015416_649_1191 180
43 3300042601 Ga0466707_358841 Ga0466707_358841_663_1205 180
44 3300042601 Ga0466707_388330 Ga0466707_388330_4741_5283 180
45 3300042602 Ga0466713_005670 Ga0466713_005670_645_1187 180
46 3300042602 Ga0466713_009753 Ga0466713_009753_8008_8550 180
47 3300042602 Ga0466713_044001 Ga0466713_044001_15701_16243 180
48 3300042602 Ga0466713_047328 Ga0466713_047328_377_919 180
49 3300042602 Ga0466713_056227 Ga0466713_056227_377_919 180
50 3300042602 Ga0466713_058214 Ga0466713_058214_17303_17845 180
51 3300042602 Ga0466713_135469 Ga0466713_135469_9912_10454 180
52 3300042604 Ga0466717_116989 Ga0466717_116989_78_620 180
53 3300042605 Ga0466716_058478 Ga0466716_058478_5881_6423 180
54 3300042605 Ga0466716_118364 Ga0466716_118364_12482_13024 180
55 3300042605 Ga0466716_163313 Ga0466716_163313_5115_5657 180
56 3300042606 Ga0466719_040334 Ga0466719_040334_8327_8869 180
57 3300042606 Ga0466719_076192 Ga0466719_076192_5212_5754 180
58 3300042606 Ga0466719_084719 Ga0466719_084719_10971_11513 180
59 3300042606 Ga0466719_129534 Ga0466719_129534_10620_11162 180
60 3300042606 Ga0466719_226421 Ga0466719_226421_1154_1696 180
61 3300042606 Ga0466719_273011 Ga0466719_273011_524_1066 180
62 3300042609 Ga0466722_015704 Ga0466722_015704_57611_58153 180
63 3300042609 Ga0466722_061307 Ga0466722_061307_3841_4383 180
64 3300042609 Ga0466722_148707 Ga0466722_148707_2314_2856 180
65 3300042609 Ga0466722_215146 Ga0466722_215146_5613_6155 180
66 3300042610 Ga0466698_032639 Ga0466698_032639_719_1261 180
67 3300042610 Ga0466698_056649 Ga0466698_056649_567_1109 180
68 3300042611 Ga0466697_114936 Ga0466697_114936_899_1441 180
69 3300042611 Ga0466697_133731 Ga0466697_133731_282_824 180
70 3300042611 Ga0466697_270836 Ga0466697_270836_2638_3180 180
71 3300042612 Ga0466705_091456 Ga0466705_091456_12748_13290 180
72 3300042612 Ga0466705_106782 Ga0466705_106782_8385_8927 180
73 3300042612 Ga0466705_246551 Ga0466705_246551_536_1078 180
74 3300042612 Ga0466705_278201 Ga0466705_278201_12477_13019 180
75 3300042612 Ga0466705_327310 Ga0466705_327310_1755_2297 180
76 3300042613 Ga0466710_371909 Ga0466710_371909_555_1097 180
77 3300042615 Ga0466711_017007 Ga0466711_017007_2006_2548 180
78 3300042615 Ga0466711_035602 Ga0466711_035602_10738_11280 180
79 3300042615 Ga0466711_125896 Ga0466711_125896_1570_2112 180
80 3300042615 Ga0466711_140047 Ga0466711_140047_887_1429 180
81 3300042615 Ga0466711_182646 Ga0466711_182646_2411_2953 180
82 3300042615 Ga0466711_198310 Ga0466711_198310_12581_13123 180
83 3300042616 Ga0466715_077069 Ga0466715_077069_1292_1834 180
84 3300042616 Ga0466715_123796 Ga0466715_123796_13941_14483 180
85 3300042616 Ga0466715_169547 Ga0466715_169547_12566_13108 180
86 3300042616 Ga0466715_185354 Ga0466715_185354_1758_2300 180
87 3300042616 Ga0466715_187003 Ga0466715_187003_706_1248 180
88 3300042616 Ga0466715_257341 Ga0466715_257341_19307_19849 180
89 3300042616 Ga0466715_299034 Ga0466715_299034_1779_2321 180
90 3300042616 Ga0466715_302955 Ga0466715_302955_839_1381 180
91 3300042616 Ga0466715_446053 Ga0466715_446053_10188_10730 180
92 3300042617 Ga0466718_009529 Ga0466718_009529_1355_1897 180
93 3300042617 Ga0466718_046598 Ga0466718_046598_329_871 180
94 3300042618 Ga0466723_118143 Ga0466723_118143_19145_19687 180
95 3300042618 Ga0466723_254775 Ga0466723_254775_496_1038 180
96 3300042618 Ga0466723_281374 Ga0466723_281374_4874_5416 180
97 3300042618 Ga0466723_307718 Ga0466723_307718_33244_33786 180
98 3300042619 Ga0466726_071920 Ga0466726_071920_11543_12085 180
99 3300042619 Ga0466726_290125 Ga0466726_290125_229_771 180
100 3300042619 Ga0466726_291963 Ga0466726_291963_148_690 180
101 3300042619 Ga0466726_331043 Ga0466726_331043_178_720 180
102 3300042620 Ga0466728_093817 Ga0466728_093817_6921_7463 180
103 3300042620 Ga0466728_172522 Ga0466728_172522_18883_19425 180
104 3300042620 Ga0466728_202737 Ga0466728_202737_10553_11095 180
105 3300042620 Ga0466728_294380 Ga0466728_294380_300_842 180
106 3300042621 Ga0466729_010781 Ga0466729_010781_12041_12583 180
107 3300042622 Ga0466731_134541 Ga0466731_134541_116_658 180
108 3300042622 Ga0466731_280324 Ga0466731_280324_187_729 180
109 3300042622 Ga0466731_306348 Ga0466731_306348_21_563 180
110 3300042624 Ga0466735_072871 Ga0466735_072871_3752_4294 180
111 3300042624 Ga0466735_119142 Ga0466735_119142_617_1159 180
112 3300042624 Ga0466735_208518 Ga0466735_208518_4932_5474 180
113 3300042636 Ga0466703_102327 Ga0466703_102327_25950_26492 180
114 3300042636 Ga0466703_281595 Ga0466703_281595_10512_11054 180
115 3300042636 Ga0466703_320533 Ga0466703_320533_18612_19154 180
116 3300042636 Ga0466703_394273 Ga0466703_394273_14319_14861 180
117 3300042643 Ga0466704_020547 Ga0466704_020547_457_999 180
118 3300042643 Ga0466704_076372 Ga0466704_076372_8073_8615 180
119 3300042643 Ga0466704_226601 Ga0466704_226601_22565_23107 180
120 3300042643 Ga0466704_256165 Ga0466704_256165_1550_2092 180
121 3300042643 Ga0466704_258054 Ga0466704_258054_17987_18529 180
122 3300042643 Ga0466704_380863 Ga0466704_380863_8996_9538 180
123 3300042643 Ga0466704_409278 Ga0466704_409278_326_868 180
124 3300042648 Ga0466709_110644 Ga0466709_110644_13418_13960 180
125 3300042648 Ga0466709_117007 Ga0466709_117007_2911_3453 180
126 3300042648 Ga0466709_117347 Ga0466709_117347_2294_2836 180
127 3300042648 Ga0466709_179015 Ga0466709_179015_10791_11333 180
128 3300042652 Ga0466708_013558 Ga0466708_013558_10975_11517 180
129 3300042652 Ga0466708_228295 Ga0466708_228295_8700_9242 180
130 3300042652 Ga0466708_435851 Ga0466708_435851_24089_24631 180
131 3300042654 Ga0466725_035410 Ga0466725_035410_12865_13407 180
132 3300042654 Ga0466725_378000 Ga0466725_378000_96_638 180
133 3300042655 Ga0466727_131064 Ga0466727_131064_13211_13753 180
134 3300042655 Ga0466727_191168 Ga0466727_191168_544_1086 180
135 3300042655 Ga0466727_194661 Ga0466727_194661_492_1034 180
136 3300042655 Ga0466727_249957 Ga0466727_249957_1750_2292 180
137 3300042655 Ga0466727_305684 Ga0466727_305684_2395_2937 180
138 3300042655 Ga0466727_307077 Ga0466727_307077_2389_2931 180
139 3300042659 Ga0466733_010750 Ga0466733_010750_21423_21965 180
140 3300042659 Ga0466733_032449 Ga0466733_032449_52734_53276 180
141 iso_pr_bacteria 2820757377 2820757903 180
142 iso_pr_bacteria 2923982719 2923985063 180
143 iso_pr_bacteria 2940199050 2940200259 180
144 iso_pr_bacteria 2940202316 2940202895 180
145 iso_pr_bacteria 2940346213 2940347876 180
146 iso_pr_bacteria 2940371297 2940372217 180
147 3300000062 IMNBL1DRAFT_c0000530 IMNBL1DRAFT_000053016 181
148 3300000062 IMNBL1DRAFT_c0001329 IMNBL1DRAFT_000132912 181
149 3300000062 IMNBL1DRAFT_c0002427 IMNBL1DRAFT_00024278 181
150 3300000062 IMNBL1DRAFT_c0003160 IMNBL1DRAFT_000316013 181
151 3300000062 IMNBL1DRAFT_c0069950 IMNBL1DRAFT_00699502 181
152 3300002449 JGI24698J34947_10007360 JGI24698J34947_100073606 181
153 3300002449 JGI24698J34947_10083571 JGI24698J34947_100835712 181
154 3300002462 JGI24702J35022_10001523 JGI24702J35022_100015237 181
155 3300002462 JGI24702J35022_10002246 JGI24702J35022_100022467 181
156 3300002462 JGI24702J35022_10003759 JGI24702J35022_100037596 181
157 3300002462 JGI24702J35022_10010998 JGI24702J35022_100109986 181
158 3300002462 JGI24702J35022_10013322 JGI24702J35022_100133223 181
159 3300002462 JGI24702J35022_10080012 JGI24702J35022_100800122 181
160 3300002462 JGI24702J35022_10141245 JGI24702J35022_101412453 181
161 3300002504 JGI24705J35276_12222374 JGI24705J35276_122223742 181
162 3300002509 JGI24699J35502_11133854 JGI24699J35502_111338547 181
163 3300005071 Ga0068302_10046659 Ga0068302_100466594 181
164 3300005071 Ga0068302_10201357 Ga0068302_102013571 181
165 3300005083 Ga0068305_10001980 Ga0068305_100019804 181
166 3300005083 Ga0068305_10010489 Ga0068305_100104896 181
167 3300005083 Ga0068305_10025899 Ga0068305_1002589913 181
168 3300005083 Ga0068305_10112966 Ga0068305_101129663 181
169 3300005200 Ga0072940_1312627 Ga0072940_13126273 181
170 3300010049 Ga0123356_11190125 Ga0123356_111901252 181
171 3300042596 Ga0466696_205463 Ga0466696_205463_4109_4654 181
172 3300042648 Ga0466709_014514 Ga0466709_014514_144587_145132 181
173 3300000062 IMNBL1DRAFT_c0011347 IMNBL1DRAFT_00113476 182
174 3300042619 Ga0466726_336827 Ga0466726_336827_7626_8177 183
175 3300042659 Ga0466733_146149 Ga0466733_146149_5447_5998 183
176 3300002462 JGI24702J35022_10299616 JGI24702J35022_102996161 184
177 3300042603 Ga0466714_079129 Ga0466714_079129_3028_3582 184
178 3300042655 Ga0466727_242249 Ga0466727_242249_12811_13365 184
179 3300042602 Ga0466713_032013 Ga0466713_032013_12195_12755 186
180 3300005071 Ga0068302_10125739 Ga0068302_101257393 187
181 3300042609 Ga0466722_195473 Ga0466722_195473_5725_6291 188

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02357 NusG Transcription termination factor nusG 7 117 0.9
PF00467 KOW KOW motif 138 168 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.5 0.5 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.