Protein Family IF06855

Metagenome Isolate
175 Members
54 Samples
163 Scaffolds
415.93 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_175521|Ga0466722_175521_52_1377
Length
441 aa
Sequence
MGAAEPARFVEAANPPFMEHKEQNMGFPVNSYTKSAEAFKRALKVIPSGIYGHQGPAEGCFVPVSAFPFFSERAKGAYFWDIDGNRFIDYMCAYGPNVLGYNDGEIDEAAAKQRVRGDCITAPSFAMIDFAELLVDTVACADWAFFAKNGGDVTTLAVITARAHTRRKKIVFFKGYYHGVAPWTQKIDYPGILEEDVANNIYVPWNDYDKLAGVFAENKGEIAAVISQPYLHGNFADNVLPAEGFWPKVRKLCDDSGAVLIIDDVRAGFRLDLAGSDHYFGFKADLICFCKALANGYNVSALCGQEFLRNTVSALTYTGSYWLSAVPFAAGVACINKMKRIDLPRLLRERGTKLRDGLVAVAKKHGHDLRVTGEPALFYLRLADDDHGGAPSLMLHQRWIAEMVKRGVYVTSHHNHFINAALSEEDIAFTVAVADEAFAAL

📊 Sample Types

Isolate 6.9%
Metagenome 93.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 30.2%
Unclassified 28.3%
Kalotermitidae 26.4%
Termopsidae 5.7%
Culicidae 3.8%
Rhinotermitidae 3.8%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 156
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
2 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
3 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
7 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
11 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
14 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
24 2820558799 Unclassified Firmicutes Emb289P3bin74 Isolate Unclassified
25 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
26 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
29 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
30 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
31 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
32 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
33 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
41 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
42 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
43 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
44 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
45 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
46 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
47 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
48 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
49 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
50 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_103599 3300042612 Bacteria 12828
2 Ga0123355_10034597 3300009826 Unclassified 8214
3 Ga0466735_115096 3300042624 Bacteria 3578
4 Ga0466709_286039 3300042648 Bacteria 5662
5 Ga0466690_111128 3300042590 Bacteria 5757
6 Ga0466690_328233 3300042590 Unclassified 4275
7 Ga0466690_424200 3300042590 Bacteria 3335
8 Ga0466692_180232 3300042591 Bacteria 17562
9 Ga0466696_173051 3300042596 Unclassified 5115
10 Ga0466715_219712 3300042616 Bacteria 4033
11 Ga0466723_135869 3300042618 Bacteria 11379
12 Ga0466723_171814 3300042618 Bacteria 39604
13 Ga0466723_361590 3300042618 Bacteria 3864
14 Ga0466728_067475 3300042620 Bacteria 3127
15 Ga0123355_10000500 3300009826 Bacteria 52249
16 Ga0123356_10000145 3300010049 Bacteria 79704
17 Ga0466703_071731 3300042636 Bacteria 8492
18 Ga0466708_121906 3300042652 Bacteria 7706
19 Ga0466708_213137 3300042652 Unclassified 2697
20 Ga0466706_087379 3300042599 Bacteria 18943
21 Ga0466713_027578 3300042602 Bacteria 1397
22 Ga0160435_1003081 3300012857 Bacteria 3977
23 Ga0415639_009925 3300038395 Bacteria 63362
24 Ga0415639_038077 3300038395 Bacteria 4307
25 Ga0466690_280054 3300042590 Unclassified 3683
26 Ga0466690_399999 3300042590 Bacteria 6386
27 Ga0466692_142303 3300042591 Bacteria 11124
28 Ga0466691_116197 3300042593 Bacteria 2925
29 Ga0466696_027259 3300042596 Bacteria 4642
30 Ga0466711_101269 3300042615 Bacteria 28356
31 Ga0466711_392673 3300042615 Bacteria 22721
32 Ga0466715_407765 3300042616 Bacteria 3078
33 Ga0466726_163522 3300042619 Bacteria 7138
34 Ga0466705_063549 3300042612 Bacteria 3020
35 Ga0123353_10001817 3300010167 Bacteria 26257
36 Ga0123353_10002747 3300010167 Bacteria 21955
37 Ga0123353_10023412 3300010167 Bacteria 9350
38 Ga0123353_10116793 3300010167 Bacteria 4293
39 Ga0123353_10194171 3300010167 Bacteria 3201
40 Ga0466735_118918 3300042624 Bacteria 1863
41 Ga0466709_010192 3300042648 Bacteria 10835
42 Ga0466727_120975 3300042655 Unclassified 17072
43 Ga0466707_098630 3300042601 Bacteria 2282
44 Ga0466707_220394 3300042601 Bacteria 2203
45 Ga0466716_271829 3300042605 Bacteria 4404
46 Ga0466719_037365 3300042606 Bacteria 7204
47 Ga0466722_149183 3300042609 Bacteria 5250
48 Ga0466722_175521 3300042609 Bacteria 2680
49 Ga0415639_073844 3300038395 Bacteria 1773
50 Ga0466690_121706 3300042590 Bacteria 67510
51 Ga0466692_202197 3300042591 Bacteria 80474
52 Ga0466696_202422 3300042596 Bacteria 9593
53 Ga0466696_305521 3300042596 Bacteria 23613
54 JGI24702J35022_10010554 3300002462 Bacteria 5158
55 Ga0466711_023522 3300042615 Bacteria 3968
56 Ga0466723_260044 3300042618 Unclassified 10323
57 Ga0466728_048749 3300042620 Bacteria 4251
58 Ga0466705_194068 3300042612 Bacteria 1891
59 Ga0123353_10000932 3300010167 Bacteria 35762
60 Ga0123353_10190185 3300010167 Bacteria 3241
61 Ga0466704_130747 3300042643 Bacteria 1939
62 Ga0466709_275749 3300042648 Bacteria 2675
63 Ga0466708_345248 3300042652 Bacteria 9453
64 Ga0466690_078766 3300042590 Unclassified 2398
65 Ga0466691_076227 3300042593 Bacteria 10240
66 Ga0466694_398806 3300042594 Bacteria 1095
67 Ga0466696_135038 3300042596 Bacteria 1776
68 Ga0466696_252968 3300042596 Bacteria 15340
69 Ga0466715_463274 3300042616 Bacteria 11063
70 Ga0466723_334202 3300042618 Unclassified 13620
71 Ga0466705_321362 3300042612 Bacteria 4553
72 Ga0123353_10002690 3300010167 Bacteria 22148
73 Ga0123353_10003264 3300010167 Bacteria 20470
74 Ga0123353_10018876 3300010167 Bacteria 10219
75 Ga0466702_337227 3300042635 Bacteria 1696
76 Ga0466703_167076 3300042636 Bacteria 4342
77 Ga0466703_423403 3300042636 Bacteria 132694
78 Ga0466704_052120 3300042643 Bacteria 11883
79 Ga0466708_040155 3300042652 Bacteria 3662
80 Ga0466707_262011 3300042601 Bacteria 1418
81 Ga0466713_035904 3300042602 Bacteria 5576
82 Ga0466713_078267 3300042602 Bacteria 4498
83 Ga0466713_135795 3300042602 Bacteria 36705
84 Ga0466693_360885 3300042592 Bacteria 1728
85 Ga0466695_254812 3300042595 Bacteria 3082
86 Ga0466696_079428 3300042596 Bacteria 2088
87 JGI24695J34938_10006985 3300002450 Bacteria 6691
88 Ga0072941_1104951 3300005201 Bacteria 17552
89 Ga0466718_015822 3300042617 Bacteria 9482
90 Ga0466723_052437 3300042618 Bacteria 33868
91 Ga0466723_128718 3300042618 Bacteria 16666
92 Ga0466723_212304 3300042618 Unclassified 23653
93 Ga0466726_220005 3300042619 Bacteria 2150
94 Ga0466726_331352 3300042619 Bacteria 1804
95 Ga0466728_052660 3300042620 Bacteria 10231
96 Ga0466732_300370 3300042656 Bacteria 1853
97 Ga0123356_10001657 3300010049 Bacteria 24369
98 Ga0123353_10001824 3300010167 Bacteria 26202
99 Ga0466731_340251 3300042622 Bacteria 1294
100 Ga0466704_061565 3300042643 Unclassified 11080
101 Ga0466704_293753 3300042643 Bacteria 3546
102 Ga0466709_242859 3300042648 Bacteria 8049
103 Ga0466708_043629 3300042652 Unclassified 1565
104 Ga0466727_329608 3300042655 Bacteria 19061
105 Ga0466706_210135 3300042599 Bacteria 3338
106 Ga0466713_082859 3300042602 Bacteria 3398
107 Ga0466713_127906 3300042602 Bacteria 4192
108 Ga0466716_094012 3300042605 Bacteria 1745
109 Ga0466716_392770 3300042605 Unclassified 5624
110 Ga0466719_071256 3300042606 Bacteria 12912
111 Ga0466719_525657 3300042606 Bacteria 30104
112 Ga0466722_084229 3300042609 Bacteria 96990
113 Ga0160434_101265 3300012850 Unclassified 4911
114 Ga0466690_140177 3300042590 Bacteria 66755
115 Ga0466691_074743 3300042593 Unclassified 2450
116 Ga0466696_221663 3300042596 Bacteria 20321
117 JGI24698J34947_10002698 3300002449 Bacteria 9577
118 Ga0466715_136168 3300042616 Bacteria 23992
119 Ga0466723_214421 3300042618 Bacteria 2315
120 Ga0466726_343428 3300042619 Bacteria 6021
121 Ga0466726_441548 3300042619 Bacteria 39085
122 Ga0123353_10003749 3300010167 Bacteria 19343
123 Ga0466703_000572 3300042636 Bacteria 29739
124 Ga0466704_159009 3300042643 Bacteria 6917
125 Ga0466709_083419 3300042648 Bacteria 49529
126 Ga0466707_163658 3300042601 Bacteria 2799
127 Ga0466707_257734 3300042601 Bacteria 6879
128 Ga0466713_007858 3300042602 Unclassified 1959
129 Ga0466713_013713 3300042602 Bacteria 305540
130 Ga0466713_098200 3300042602 Bacteria 22626
131 Ga0466716_234278 3300042605 Bacteria 2069
132 Ga0466719_570958 3300042606 Bacteria 3044
133 Ga0466722_213587 3300042609 Bacteria 3283
134 Ga0466696_152798 3300042596 Bacteria 1715
135 Ga0466711_170116 3300042615 Bacteria 14512
136 Ga0466711_284996 3300042615 Bacteria 10578
137 Ga0466715_137255 3300042616 Bacteria 107557
138 Ga0466726_065503 3300042619 Bacteria 42219
139 Ga0466726_185112 3300042619 Bacteria 38517
140 Ga0466705_192026 3300042612 Unclassified 6380
141 Ga0123356_10037819 3300010049 Bacteria 4500
142 Ga0123353_10018628 3300010167 Bacteria 10273
143 Ga0466735_164315 3300042624 Unclassified 1426
144 Ga0466703_091497 3300042636 Bacteria 4821
145 Ga0466704_133420 3300042643 Bacteria 18220
146 Ga0466709_393295 3300042648 Bacteria 11437
147 Ga0466727_184974 3300042655 Bacteria 7833
148 Ga0466727_195673 3300042655 Bacteria 15830
149 Ga0466716_051855 3300042605 Bacteria 5225
150 Ga0466716_147493 3300042605 Bacteria 2491
151 Ga0466716_246630 3300042605 Bacteria 4295
152 Ga0466719_076378 3300042606 Bacteria 8093
153 Ga0466719_264689 3300042606 Bacteria 6993
154 Ga0466722_020741 3300042609 Bacteria 1368
155 Ga0466698_244392 3300042610 Bacteria 2474
156 Ga0466699_160540 3300042597 Unclassified 2361
157 Ga0068305_10087089 3300005083 Bacteria 21067
158 Ga0466711_077314 3300042615 Bacteria 6016
159 Ga0466711_219336 3300042615 Bacteria 2836
160 Ga0466711_511827 3300042615 Bacteria 7235
161 Ga0466715_052710 3300042616 Bacteria 76160
162 Ga0466723_219366 3300042618 Bacteria 3311
163 Ga0466723_364183 3300042618 Bacteria 7041

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042648 Ga0466709_083419 Ga0466709_083419_33436_34485 349
2 3300042594 Ga0466694_398806 Ga0466694_398806_19_1080 353
3 3300010167 Ga0123353_10003264 Ga0123353_1000326420 379
4 3300042612 Ga0466705_063549 Ga0466705_063549_1860_3005 381
5 3300042624 Ga0466735_118918 Ga0466735_118918_665_1813 382
6 3300002450 JGI24695J34938_10006985 JGI24695J34938_100069857 387
7 3300002462 JGI24702J35022_10010554 JGI24702J35022_100105545 389
8 3300042590 Ga0466690_328233 Ga0466690_328233_1964_3220 390
9 3300042615 Ga0466711_023522 Ga0466711_023522_1911_3083 390
10 3300010049 Ga0123356_10001657 Ga0123356_1000165723 395
11 3300042622 Ga0466731_340251 Ga0466731_340251_53_1243 396
12 3300042602 Ga0466713_007858 Ga0466713_007858_728_1927 399
13 3300042616 Ga0466715_463274 Ga0466715_463274_9076_10329 402
14 3300042596 Ga0466696_152798 Ga0466696_152798_243_1460 405
15 3300042612 Ga0466705_321362 Ga0466705_321362_780_2000 406
16 3300042635 Ga0466702_337227 Ga0466702_337227_365_1621 408
17 3300042655 Ga0466727_329608 Ga0466727_329608_16164_17399 411
18 3300038395 Ga0415639_038077 Ga0415639_038077_2025_3263 412
19 3300042590 Ga0466690_111128 Ga0466690_111128_2395_3633 412
20 3300042591 Ga0466692_142303 Ga0466692_142303_3823_5061 412
21 3300042591 Ga0466692_180232 Ga0466692_180232_11704_12942 412
22 3300042595 Ga0466695_254812 Ga0466695_254812_235_1473 412
23 3300042596 Ga0466696_202422 Ga0466696_202422_6412_7650 412
24 3300042596 Ga0466696_252968 Ga0466696_252968_1465_2703 412
25 3300042596 Ga0466696_305521 Ga0466696_305521_7512_8750 412
26 3300042597 Ga0466699_160540 Ga0466699_160540_563_1801 412
27 3300042602 Ga0466713_098200 Ga0466713_098200_10908_12146 412
28 3300042605 Ga0466716_147493 Ga0466716_147493_158_1396 412
29 3300042610 Ga0466698_244392 Ga0466698_244392_319_1557 412
30 3300042615 Ga0466711_392673 Ga0466711_392673_19160_20398 412
31 3300042618 Ga0466723_128718 Ga0466723_128718_6906_8144 412
32 3300042618 Ga0466723_260044 Ga0466723_260044_1102_2340 412
33 3300042618 Ga0466723_364183 Ga0466723_364183_3334_4572 412
34 3300042620 Ga0466728_052660 Ga0466728_052660_3008_4246 412
35 3300042636 Ga0466703_071731 Ga0466703_071731_3805_5043 412
36 3300042643 Ga0466704_130747 Ga0466704_130747_537_1775 412
37 3300042643 Ga0466704_159009 Ga0466704_159009_3311_4549 412
38 3300042648 Ga0466709_242859 Ga0466709_242859_1095_2333 412
39 3300042652 Ga0466708_213137 Ga0466708_213137_1155_2393 412
40 3300042656 Ga0466732_300370 Ga0466732_300370_372_1610 412
41 iso_pr_bacteria 2781125629 2781263884 412
42 3300010049 Ga0123356_10037819 Ga0123356_100378193 413
43 3300010167 Ga0123353_10018628 Ga0123353_100186289 413
44 3300038395 Ga0415639_073844 Ga0415639_073844_491_1732 413
45 iso_pr_bacteria 2781125630 2781265548 413
46 3300002449 JGI24698J34947_10002698 JGI24698J34947_100026989 414
47 3300010167 Ga0123353_10001824 Ga0123353_1000182434 414
48 3300010167 Ga0123353_10018876 Ga0123353_100188762 414
49 3300042602 Ga0466713_082859 Ga0466713_082859_2092_3336 414
50 3300042619 Ga0466726_343428 Ga0466726_343428_4732_5976 414
51 3300042643 Ga0466704_293753 Ga0466704_293753_491_1735 414
52 3300010167 Ga0123353_10002690 Ga0123353_1000269026 415
53 3300042602 Ga0466713_035904 Ga0466713_035904_1976_3223 415
54 3300042619 Ga0466726_441548 Ga0466726_441548_32472_33719 415
55 3300042599 Ga0466706_087379 Ga0466706_087379_11770_13020 416
56 3300042615 Ga0466711_511827 Ga0466711_511827_264_1514 416
57 3300042616 Ga0466715_137255 Ga0466715_137255_59194_60444 416
58 iso_pr_bacteria 2820290662 2820291318 416
59 iso_pr_bacteria 2820420508 2820420737 416
60 3300010167 Ga0123353_10003749 Ga0123353_1000374911 417
61 3300042593 Ga0466691_074743 Ga0466691_074743_651_1904 417
62 3300042596 Ga0466696_173051 Ga0466696_173051_3411_4664 417
63 3300042599 Ga0466706_210135 Ga0466706_210135_1833_3086 417
64 3300042601 Ga0466707_257734 Ga0466707_257734_1086_2339 417
65 3300042601 Ga0466707_262011 Ga0466707_262011_114_1367 417
66 3300042609 Ga0466722_149183 Ga0466722_149183_1720_2973 417
67 3300042615 Ga0466711_077314 Ga0466711_077314_3401_4654 417
68 3300042616 Ga0466715_136168 Ga0466715_136168_4668_5921 417
69 3300042616 Ga0466715_219712 Ga0466715_219712_1898_3151 417
70 3300042618 Ga0466723_171814 Ga0466723_171814_32415_33668 417
71 3300042618 Ga0466723_334202 Ga0466723_334202_7682_8935 417
72 3300042619 Ga0466726_065503 Ga0466726_065503_4491_5744 417
73 3300042619 Ga0466726_220005 Ga0466726_220005_865_2118 417
74 3300042636 Ga0466703_091497 Ga0466703_091497_3391_4644 417
75 3300042648 Ga0466709_286039 Ga0466709_286039_3488_4741 417
76 3300042652 Ga0466708_121906 Ga0466708_121906_903_2156 417
77 3300042655 Ga0466727_184974 Ga0466727_184974_2611_3864 417
78 3300042655 Ga0466727_195673 Ga0466727_195673_11313_12566 417
79 iso_pr_bacteria 2781125694 2781435010 417
80 3300005083 Ga0068305_10087089 Ga0068305_1008708922 418
81 3300010167 Ga0123353_10000932 Ga0123353_1000093235 418
82 3300010167 Ga0123353_10023412 Ga0123353_100234125 418
83 3300042591 Ga0466692_202197 Ga0466692_202197_63590_64846 418
84 3300042592 Ga0466693_360885 Ga0466693_360885_35_1291 418
85 3300042593 Ga0466691_076227 Ga0466691_076227_3251_4507 418
86 3300042596 Ga0466696_079428 Ga0466696_079428_353_1609 418
87 3300042596 Ga0466696_221663 Ga0466696_221663_18208_19464 418
88 3300042601 Ga0466707_098630 Ga0466707_098630_95_1351 418
89 3300042605 Ga0466716_271829 Ga0466716_271829_2674_3930 418
90 3300042606 Ga0466719_071256 Ga0466719_071256_2060_3316 418
91 3300042609 Ga0466722_213587 Ga0466722_213587_886_2142 418
92 3300042615 Ga0466711_219336 Ga0466711_219336_744_2000 418
93 3300042618 Ga0466723_135869 Ga0466723_135869_1669_2925 418
94 3300042618 Ga0466723_214421 Ga0466723_214421_96_1352 418
95 3300042618 Ga0466723_361590 Ga0466723_361590_1886_3142 418
96 3300042619 Ga0466726_163522 Ga0466726_163522_2130_3386 418
97 3300042620 Ga0466728_048749 Ga0466728_048749_1348_2604 418
98 3300042636 Ga0466703_423403 Ga0466703_423403_8216_9472 418
99 3300042648 Ga0466709_393295 Ga0466709_393295_9157_10413 418
100 3300005201 Ga0072941_1104951 Ga0072941_11049512 419
101 3300010167 Ga0123353_10190185 Ga0123353_101901852 419
102 3300038395 Ga0415639_009925 Ga0415639_009925_26991_28250 419
103 3300042590 Ga0466690_280054 Ga0466690_280054_700_1980 419
104 3300042609 Ga0466722_084229 Ga0466722_084229_63679_64938 419
105 3300042615 Ga0466711_284996 Ga0466711_284996_5386_6645 419
106 3300042617 Ga0466718_015822 Ga0466718_015822_3448_4707 419
107 3300042618 Ga0466723_052437 Ga0466723_052437_1549_2808 419
108 iso_pr_bacteria 2820240463 2820241169 419
109 iso_pr_bacteria 2820429680 2820431145 419
110 3300010167 Ga0123353_10001817 Ga0123353_1000181723 420
111 3300010167 Ga0123353_10116793 Ga0123353_101167932 420
112 3300042602 Ga0466713_013713 Ga0466713_013713_257622_258884 420
113 3300042605 Ga0466716_094012 Ga0466716_094012_100_1362 420
114 3300042609 Ga0466722_020741 Ga0466722_020741_66_1328 420
115 3300042615 Ga0466711_170116 Ga0466711_170116_53_1315 420
116 3300042616 Ga0466715_052710 Ga0466715_052710_31426_32688 420
117 3300042616 Ga0466715_407765 Ga0466715_407765_577_1839 420
118 3300042618 Ga0466723_219366 Ga0466723_219366_780_2075 420
119 3300042619 Ga0466726_185112 Ga0466726_185112_11299_12561 420
120 3300042619 Ga0466726_331352 Ga0466726_331352_73_1335 420
121 3300042636 Ga0466703_000572 Ga0466703_000572_8899_10161 420
122 iso_pr_bacteria 2820424542 2820426105 420
123 3300010167 Ga0123353_10002747 Ga0123353_100027477 421
124 3300042590 Ga0466690_140177 Ga0466690_140177_34078_35343 421
125 3300042602 Ga0466713_078267 Ga0466713_078267_1761_3026 421
126 3300042624 Ga0466735_115096 Ga0466735_115096_859_2124 421
127 iso_pr_bacteria 2820474468 2820474922 421
128 iso_pr_bacteria 2820584674 2820586079 421
129 iso_pr_bacteria 2820705605 2820706829 421
130 3300009826 Ga0123355_10000500 Ga0123355_100005004 422
131 3300009826 Ga0123355_10034597 Ga0123355_100345972 422
132 3300010167 Ga0123353_10194171 Ga0123353_101941713 422
133 3300042590 Ga0466690_424200 Ga0466690_424200_1301_2569 422
134 3300042593 Ga0466691_116197 Ga0466691_116197_148_1416 422
135 3300042602 Ga0466713_027578 Ga0466713_027578_62_1330 422
136 3300042605 Ga0466716_051855 Ga0466716_051855_3151_4419 422
137 3300042605 Ga0466716_392770 Ga0466716_392770_1421_2689 422
138 3300042615 Ga0466711_101269 Ga0466711_101269_15323_16591 422
139 3300042618 Ga0466723_212304 Ga0466723_212304_19458_20726 422
140 3300042636 Ga0466703_167076 Ga0466703_167076_1383_2651 422
141 3300042643 Ga0466704_061565 Ga0466704_061565_6303_7571 422
142 3300042648 Ga0466709_010192 Ga0466709_010192_3295_4563 422
143 3300042652 Ga0466708_040155 Ga0466708_040155_295_1563 422
144 iso_pr_bacteria 2820558799 2820558988 422
145 3300010049 Ga0123356_10000145 Ga0123356_1000014547 423
146 3300042601 Ga0466707_220394 Ga0466707_220394_223_1494 423
147 3300042602 Ga0466713_135795 Ga0466713_135795_15648_16919 423
148 3300042605 Ga0466716_246630 Ga0466716_246630_752_2023 423
149 3300042606 Ga0466719_525657 Ga0466719_525657_1498_2769 423
150 3300042612 Ga0466705_103599 Ga0466705_103599_5380_6651 423
151 3300042612 Ga0466705_192026 Ga0466705_192026_4108_5379 423
152 3300042612 Ga0466705_194068 Ga0466705_194068_18_1289 423
153 3300042620 Ga0466728_067475 Ga0466728_067475_1554_2825 423
154 3300042624 Ga0466735_164315 Ga0466735_164315_20_1291 423
155 3300042643 Ga0466704_052120 Ga0466704_052120_8026_9297 423
156 3300042652 Ga0466708_043629 Ga0466708_043629_126_1397 423
157 3300042590 Ga0466690_078766 Ga0466690_078766_25_1299 424
158 3300042602 Ga0466713_127906 Ga0466713_127906_1690_2964 424
159 3300042590 Ga0466690_399999 Ga0466690_399999_3188_4465 425
160 3300042596 Ga0466696_027259 Ga0466696_027259_587_1864 425
161 3300042596 Ga0466696_135038 Ga0466696_135038_281_1558 425
162 3300042590 Ga0466690_121706 Ga0466690_121706_34789_36069 426
163 3300042605 Ga0466716_234278 Ga0466716_234278_189_1469 426
164 3300042606 Ga0466719_037365 Ga0466719_037365_3404_4684 426
165 3300042606 Ga0466719_264689 Ga0466719_264689_4275_5555 426
166 3300042606 Ga0466719_570958 Ga0466719_570958_346_1626 426
167 3300042643 Ga0466704_133420 Ga0466704_133420_5684_6964 426
168 3300042648 Ga0466709_275749 Ga0466709_275749_799_2079 426
169 3300042652 Ga0466708_345248 Ga0466708_345248_5354_6634 426
170 3300042601 Ga0466707_163658 Ga0466707_163658_399_1682 427
171 3300012850 Ga0160434_101265 Ga0160434_1012654 428
172 3300012857 Ga0160435_1003081 Ga0160435_10030813 428
173 3300042606 Ga0466719_076378 Ga0466719_076378_4393_5682 429
174 3300042655 Ga0466727_120975 Ga0466727_120975_6436_7725 429
175 3300042609 Ga0466722_175521 Ga0466722_175521_52_1377 441

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00202 Aminotran_3 Aminotransferase class-III 66 418 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.