Protein Family IF06849

Metagenome Isolate
137 Members
63 Samples
118 Scaffolds
392.17 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_170101|Ga0466722_170101_2657_3934
Length
425 aa
Sequence
MRGHGKKPASTTFYAKTDFWSNVGLKGEKTMILDKIFQLMGEKQASDIFISAGAPINIKIQGISLPVNQQIMTPSMIEKVAYELMTPKQAKTFEVSKEMNLFYSVTGLGNFRINIFRQRASISIVVRYILGRIPSLDTLNLPSILPDLIMEKRGLILVTGSTGSGKSTTIAAMLDHRNANQTGHILTIEDPIEFLFRHKKSIVNQRELGMDTLGWEHALKNAMRQAPDCILIGEIRDRETMQAAISYAQSGHLCLATLHANNSYHALNRIINFFPLENRTSLYLDLSACLKAIISQRLVRKIDGKRIPCAEILLNTLHIQELIAKGDILSIREAMEQSLAPDSQTFEQDLFRLYKEGTITIDEALTNSDSPTNLSWLINNSSDAPQHPGKPVTDLPFSEINVSGTSFKAFTLNFDEESRVEQNAA

📊 Sample Types

Isolate 13.9%
Metagenome 86.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 29.0%
Termitidae 27.4%
Kalotermitidae 22.6%
Termopsidae 6.5%
Formicidae 4.8%
Rhinotermitidae 4.8%
Elmidae 3.2%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
2 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
14 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
15 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
16 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
17 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
22 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
26 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
37 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
38 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
39 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
44 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
45 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
46 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
47 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
48 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
49 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
50 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
51 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
52 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
56 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
57 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
58 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
59 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
60 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
61 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
62 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
63 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466702_142510 3300042635 Bacteria 7061
2 Ga0466703_023508 3300042636 Bacteria 9396
3 Ga0466704_426686 3300042643 Bacteria 34793
4 Ga0466704_576904 3300042643 Bacteria 2999
5 Ga0466709_152709 3300042648 Bacteria 8494
6 Ga0466725_172860 3300042654 Bacteria 5614
7 Ga0466707_301059 3300042601 Bacteria 29327
8 Ga0466713_107714 3300042602 Bacteria 8973
9 Ga0466719_089617 3300042606 Bacteria 27723
10 Ga0123353_10207008 3300010167 Bacteria 3081
11 Ga0123354_10000684 3300010882 Bacteria 36048
12 Ga0466711_184150 3300042615 Bacteria 3402
13 Ga0466711_359037 3300042615 Bacteria 49677
14 Ga0466715_321341 3300042616 Bacteria 31269
15 Ga0466729_058012 3300042621 Bacteria 9532
16 Ga0466729_072556 3300042621 Bacteria 9913
17 Ga0466657_296096 3300042582 Bacteria 2444
18 Ga0102734_1017847 3300007129 Bacteria 1740
19 Ga0466709_083675 3300042648 Bacteria 3326
20 Ga0466717_078302 3300042604 Bacteria 5987
21 Ga0466721_211392 3300042608 Bacteria 23167
22 Ga0466722_151500 3300042609 Bacteria 2919
23 Ga0466722_170101 3300042609 Bacteria 9003
24 Ga0123356_10016494 3300010049 Bacteria 7044
25 Ga0123353_10032820 3300010167 Bacteria 8071
26 Ga0123354_10000081 3300010882 Bacteria 72300
27 Ga0466711_277226 3300042615 Bacteria 3594
28 Ga0466690_009299 3300042590 Bacteria 6437
29 Ga0466690_346309 3300042590 Bacteria 9609
30 Ga0466691_087850 3300042593 Unclassified 7945
31 Ga0102740_1004779 3300007140 Bacteria 2640
32 Ga0102737_1000278 3300007142 Bacteria 17271
33 Ga0466705_234824 3300042612 Bacteria 7151
34 Ga0466708_051209 3300042652 Bacteria 6443
35 Ga0466725_424414 3300042654 Bacteria 7366
36 Ga0466707_296704 3300042601 Bacteria 12116
37 Ga0466716_438613 3300042605 Unclassified 1226
38 Ga0123356_10078924 3300010049 Bacteria 3108
39 Ga0466729_015681 3300042621 Bacteria 43972
40 Ga0466690_177200 3300042590 Bacteria 28135
41 Ga0466692_105856 3300042591 Bacteria 36933
42 Ga0466696_084066 3300042596 Bacteria 4455
43 JGI24702J35022_10003708 3300002462 Bacteria 9188
44 JGI24702J35022_10003761 3300002462 Bacteria 9120
45 JGI24705J35276_12236362 3300002504 Unclassified 7909
46 Ga0072941_1189926 3300005201 Bacteria 12803
47 Ga0123357_10000840 3300009784 Bacteria 31229
48 Ga0466733_153306 3300042659 Bacteria 32113
49 Ga0466735_115387 3300042624 Bacteria 2865
50 Ga0466703_174532 3300042636 Bacteria 30809
51 Ga0466708_435232 3300042652 Bacteria 9313
52 Ga0466719_051666 3300042606 Bacteria 9917
53 Ga0466722_156264 3300042609 Bacteria 4502
54 Ga0466710_181391 3300042613 Bacteria 2223
55 Ga0466723_136737 3300042618 Unclassified 13873
56 Ga0466726_045842 3300042619 Bacteria 1721
57 Ga0466691_167641 3300042593 Bacteria 5186
58 Ga0466696_181990 3300042596 Bacteria 7244
59 Ga0072941_1012140 3300005201 Bacteria 22777
60 Ga0466705_304848 3300042612 Bacteria 36073
61 Ga0466727_128668 3300042655 Bacteria 3776
62 Ga0466701_092574 3300042598 Bacteria 8610
63 Ga0466719_087102 3300042606 Bacteria 2458
64 Ga0466712_167070 3300042614 Bacteria 6094
65 Ga0466715_034383 3300042616 Bacteria 1786
66 Ga0466715_202160 3300042616 Bacteria 9104
67 Ga0466723_072694 3300042618 Bacteria 28050
68 Ga0415639_155627 3300038395 Bacteria 5158
69 Ga0466656_329481 3300042550 Bacteria 2386
70 Ga0466657_086731 3300042582 Bacteria 6203
71 Ga0466657_137725 3300042582 Bacteria 60772
72 Ga0466657_161237 3300042582 Bacteria 13764
73 Ga0466690_008529 3300042590 Bacteria 1896
74 Ga0466696_259906 3300042596 Bacteria 1849
75 Ga0466703_408112 3300042636 Bacteria 11766
76 Ga0466704_128168 3300042643 Bacteria 26461
77 Ga0466708_281203 3300042652 Bacteria 40046
78 Ga0466713_047949 3300042602 Bacteria 2278
79 Ga0123356_10089923 3300010049 Bacteria 2922
80 Ga0123356_10364038 3300010049 Bacteria 1574
81 Ga0123354_10053250 3300010882 Bacteria 6087
82 Ga0466710_279852 3300042613 Bacteria 5099
83 Ga0466710_348801 3300042613 Bacteria 54409
84 Ga0466728_067450 3300042620 Bacteria 2009
85 Ga0466692_117162 3300042591 Bacteria 24746
86 Ga0466692_150354 3300042591 Bacteria 25586
87 Ga0072941_1111542 3300005201 Bacteria 12790
88 Ga0466705_009059 3300042612 Bacteria 5439
89 Ga0466735_201589 3300042624 Bacteria 3349
90 Ga0466708_258890 3300042652 Bacteria 8017
91 Ga0466707_092161 3300042601 Unclassified 8179
92 Ga0466707_128695 3300042601 Bacteria 21572
93 Ga0466719_425966 3300042606 Bacteria 2264
94 Ga0123356_10000182 3300010049 Bacteria 71892
95 Ga0466723_020513 3300042618 Bacteria 8101
96 Ga0466726_269311 3300042619 Bacteria 8214
97 Ga0466726_401106 3300042619 Bacteria 9199
98 Ga0466728_270227 3300042620 Bacteria 28359
99 Ga0466691_047915 3300042593 Bacteria 9383
100 Ga0068302_10056959 3300005071 Bacteria 4109
101 Ga0072941_1312252 3300005201 Bacteria 2001
102 Ga0123357_10000003 3300009784 Bacteria 349727
103 Ga0466735_218782 3300042624 Bacteria 1260
104 Ga0466703_115902 3300042636 Bacteria 2247
105 Ga0466709_012927 3300042648 Bacteria 10506
106 Ga0466708_034245 3300042652 Bacteria 25211
107 Ga0466708_204336 3300042652 Bacteria 6983
108 Ga0466708_251180 3300042652 Bacteria 15531
109 Ga0466708_327201 3300042652 Bacteria 7264
110 Ga0466706_149105 3300042599 Bacteria 3833
111 Ga0466707_154822 3300042601 Bacteria 6281
112 Ga0466716_202338 3300042605 Bacteria 7569
113 Ga0466719_203114 3300042606 Bacteria 5517
114 Ga0466719_210698 3300042606 Unclassified 7105
115 Ga0466719_395040 3300042606 Bacteria 5512
116 Ga0466710_315191 3300042613 Bacteria 2130
117 Ga0466715_486078 3300042616 Bacteria 17131
118 Ga0123357_10002008 3300009784 Bacteria 22306

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042613 Ga0466710_315191 Ga0466710_315191_1090_2118 342
2 3300042601 Ga0466707_301059 Ga0466707_301059_7749_8813 354
3 3300042615 Ga0466711_277226 Ga0466711_277226_2512_3576 354
4 iso_pr_bacteria 2820405014 2820405154 355
5 3300042550 Ga0466656_329481 Ga0466656_329481_921_1997 358
6 3300038395 Ga0415639_155627 Ga0415639_155627_3725_4822 365
7 3300042608 Ga0466721_211392 Ga0466721_211392_7566_8663 365
8 3300010049 Ga0123356_10000182 Ga0123356_1000018266 366
9 3300042613 Ga0466710_181391 Ga0466710_181391_675_1829 366
10 3300042652 Ga0466708_034245 Ga0466708_034245_15410_16576 366
11 3300042601 Ga0466707_128695 Ga0466707_128695_12400_13551 370
12 3300042596 Ga0466696_259906 Ga0466696_259906_26_1141 371
13 3300042624 Ga0466735_218782 Ga0466735_218782_135_1250 371
14 3300042591 Ga0466692_105856 Ga0466692_105856_18799_19977 375
15 3300042591 Ga0466692_150354 Ga0466692_150354_10140_11318 377
16 3300042598 Ga0466701_092574 Ga0466701_092574_997_2172 377
17 3300042590 Ga0466690_009299 Ga0466690_009299_3900_5039 379
18 3300042643 Ga0466704_128168 Ga0466704_128168_3872_5011 379
19 3300005201 Ga0072941_1111542 Ga0072941_11115429 380
20 3300042636 Ga0466703_174532 Ga0466703_174532_25041_26234 383
21 iso_pr_bacteria 2864808494 2864810330 383
22 iso_pr_bacteria 2864812326 2864814163 383
23 3300042606 Ga0466719_087102 Ga0466719_087102_327_1484 385
24 3300042591 Ga0466692_117162 Ga0466692_117162_12920_14080 386
25 3300042605 Ga0466716_438613 Ga0466716_438613_17_1177 386
26 3300042582 Ga0466657_296096 Ga0466657_296096_459_1622 387
27 3300042616 Ga0466715_321341 Ga0466715_321341_23659_24840 387
28 3300042636 Ga0466703_023508 Ga0466703_023508_6396_7559 387
29 3300042648 Ga0466709_152709 Ga0466709_152709_4638_5801 387
30 3300042612 Ga0466705_304848 Ga0466705_304848_29408_30574 388
31 3300042621 Ga0466729_058012 Ga0466729_058012_5595_6806 388
32 3300042582 Ga0466657_086731 Ga0466657_086731_3197_4366 389
33 3300042593 Ga0466691_047915 Ga0466691_047915_5060_6229 389
34 3300042618 Ga0466723_020513 Ga0466723_020513_1223_2392 389
35 iso_pr_bacteria 2820131053 2820132514 389
36 3300010049 Ga0123356_10089923 Ga0123356_100899233 390
37 3300042582 Ga0466657_161237 Ga0466657_161237_2570_3742 390
38 3300042609 Ga0466722_151500 Ga0466722_151500_405_1577 390
39 3300042613 Ga0466710_279852 Ga0466710_279852_2535_3707 390
40 3300042654 Ga0466725_172860 Ga0466725_172860_3093_4265 390
41 3300042659 Ga0466733_153306 Ga0466733_153306_5996_7168 390
42 iso_pr_bacteria 2820089333 2820089993 390
43 iso_pr_bacteria 2820121232 2820122248 390
44 3300005071 Ga0068302_10056959 Ga0068302_100569593 391
45 3300009784 Ga0123357_10000840 Ga0123357_1000084028 391
46 3300010167 Ga0123353_10207008 Ga0123353_102070082 391
47 3300010882 Ga0123354_10000684 Ga0123354_1000068427 391
48 3300042590 Ga0466690_346309 Ga0466690_346309_4313_5488 391
49 3300042601 Ga0466707_296704 Ga0466707_296704_8082_9257 391
50 3300042606 Ga0466719_425966 Ga0466719_425966_894_2069 391
51 3300042612 Ga0466705_009059 Ga0466705_009059_1650_2825 391
52 3300042613 Ga0466710_348801 Ga0466710_348801_49551_50726 391
53 3300042615 Ga0466711_184150 Ga0466711_184150_1491_2666 391
54 3300042618 Ga0466723_072694 Ga0466723_072694_7434_8609 391
55 3300042624 Ga0466735_201589 Ga0466735_201589_1910_3118 391
56 3300042648 Ga0466709_083675 Ga0466709_083675_1008_2183 391
57 iso_pr_bacteria 2820042117 2820043675 391
58 iso_pr_bacteria 2820042117 2820044033 391
59 3300002504 JGI24705J35276_12236362 JGI24705J35276_122363623 392
60 3300042582 Ga0466657_137725 Ga0466657_137725_44272_45450 392
61 3300042599 Ga0466706_149105 Ga0466706_149105_2132_3310 392
62 3300042606 Ga0466719_089617 Ga0466719_089617_7883_9061 392
63 3300042654 Ga0466725_424414 Ga0466725_424414_5387_6565 392
64 iso_pr_bacteria 2820084079 2820084213 392
65 iso_pr_bacteria 2820086750 2820087633 392
66 iso_pr_bacteria 2820132692 2820134216 392
67 3300010049 Ga0123356_10078924 Ga0123356_100789244 393
68 3300010049 Ga0123356_10364038 Ga0123356_103640382 393
69 3300010882 Ga0123354_10000081 Ga0123354_1000008154 393
70 3300042601 Ga0466707_154822 Ga0466707_154822_2181_3362 393
71 3300042652 Ga0466708_258890 Ga0466708_258890_2075_3256 393
72 iso_pr_bacteria 2820050117 2820050231 393
73 iso_pr_bacteria 2820123897 2820124178 393
74 iso_pr_bacteria 2820152154 2820152461 393
75 3300002462 JGI24702J35022_10003761 JGI24702J35022_1000376110 394
76 3300009784 Ga0123357_10000003 Ga0123357_10000003277 394
77 3300042593 Ga0466691_087850 Ga0466691_087850_5102_6286 394
78 3300042614 Ga0466712_167070 Ga0466712_167070_386_1570 394
79 3300042652 Ga0466708_327201 Ga0466708_327201_5566_6750 394
80 iso_pr_bacteria 2820047982 2820050007 394
81 3300005201 Ga0072941_1012140 Ga0072941_101214011 395
82 3300005201 Ga0072941_1189926 Ga0072941_118992612 395
83 3300005201 Ga0072941_1312252 Ga0072941_13122521 395
84 3300042590 Ga0466690_177200 Ga0466690_177200_20064_21251 395
85 3300042606 Ga0466719_210698 Ga0466719_210698_3003_4190 395
86 3300042618 Ga0466723_136737 Ga0466723_136737_2316_3503 395
87 3300042620 Ga0466728_270227 Ga0466728_270227_24206_25393 395
88 3300042636 Ga0466703_408112 Ga0466703_408112_7238_8425 395
89 3300042652 Ga0466708_051209 Ga0466708_051209_2107_3294 395
90 3300042652 Ga0466708_435232 Ga0466708_435232_4838_6025 395
91 3300042616 Ga0466715_486078 Ga0466715_486078_6379_7569 396
92 3300042619 Ga0466726_269311 Ga0466726_269311_4486_5676 396
93 3300042635 Ga0466702_142510 Ga0466702_142510_914_2104 396
94 3300042652 Ga0466708_281203 Ga0466708_281203_7155_8372 396
95 iso_pr_bacteria 2891720358 2891721216 396
96 3300042616 Ga0466715_034383 Ga0466715_034383_411_1604 397
97 3300042636 Ga0466703_115902 Ga0466703_115902_21_1214 397
98 3300042590 Ga0466690_008529 Ga0466690_008529_664_1860 398
99 3300042593 Ga0466691_167641 Ga0466691_167641_1126_2322 398
100 3300042596 Ga0466696_084066 Ga0466696_084066_895_2091 398
101 3300042596 Ga0466696_181990 Ga0466696_181990_4164_5360 398
102 3300042602 Ga0466713_047949 Ga0466713_047949_683_1879 398
103 3300042602 Ga0466713_107714 Ga0466713_107714_6908_8104 398
104 3300042605 Ga0466716_202338 Ga0466716_202338_2279_3475 398
105 3300042619 Ga0466726_045842 Ga0466726_045842_21_1217 398
106 3300042620 Ga0466728_067450 Ga0466728_067450_459_1655 398
107 3300042655 Ga0466727_128668 Ga0466727_128668_128_1324 398
108 3300007129 Ga0102734_1017847 Ga0102734_10178472 399
109 3300007140 Ga0102740_1004779 Ga0102740_10047792 399
110 3300042601 Ga0466707_092161 Ga0466707_092161_2217_3458 399
111 3300042606 Ga0466719_203114 Ga0466719_203114_2368_3567 399
112 3300042621 Ga0466729_072556 Ga0466729_072556_367_1569 400
113 3300042652 Ga0466708_251180 Ga0466708_251180_7511_8767 400
114 3300042609 Ga0466722_156264 Ga0466722_156264_3024_4229 401
115 3300042612 Ga0466705_234824 Ga0466705_234824_563_1768 401
116 3300007142 Ga0102737_1000278 Ga0102737_100027815 402
117 3300042621 Ga0466729_015681 Ga0466729_015681_19019_20227 402
118 3300042643 Ga0466704_426686 Ga0466704_426686_6271_7479 402
119 3300002462 JGI24702J35022_10003708 JGI24702J35022_100037084 403
120 3300009784 Ga0123357_10002008 Ga0123357_1000200819 404
121 3300042615 Ga0466711_359037 Ga0466711_359037_26238_27572 404
122 3300042606 Ga0466719_051666 Ga0466719_051666_6963_8180 405
123 3300042606 Ga0466719_395040 Ga0466719_395040_3166_4383 405
124 3300042643 Ga0466704_576904 Ga0466704_576904_1638_2858 406
125 3300042652 Ga0466708_204336 Ga0466708_204336_761_1981 406
126 3300042624 Ga0466735_115387 Ga0466735_115387_898_2184 408
127 3300042648 Ga0466709_012927 Ga0466709_012927_4462_5691 409
128 3300042619 Ga0466726_401106 Ga0466726_401106_6348_7592 414
129 iso_pr_bacteria 2820103659 2820105510 414
130 3300010882 Ga0123354_10053250 Ga0123354_100532502 415
131 3300010049 Ga0123356_10016494 Ga0123356_100164946 417
132 3300010167 Ga0123353_10032820 Ga0123353_100328203 417
133 3300042616 Ga0466715_202160 Ga0466715_202160_5392_6651 419
134 3300042604 Ga0466717_078302 Ga0466717_078302_1324_2589 421
135 iso_pr_bacteria 2820062699 2820063564 421
136 iso_pr_bacteria 2820065746 2820067197 421
137 3300042609 Ga0466722_170101 Ga0466722_170101_2657_3934 425

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00437 T2SSE Type II/IV secretion system protein 143 301 0.71

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.