Protein Family IF06845

Metagenome Isolate
463 Members
305 Samples
221 Scaffolds
487.07 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_165364|Ga0466722_165364_1863_3497
Length
544 aa
Sequence
VAEYNDRRDAVLFHNFAEHSNRKASRRQFQIADTAVVKENQMNTKNLTFWFIIGSQFLYGAETLAQVEVDCRHMTDGMNEAGRMPWPIKLKGVMKTAAEIEKVCKEANNDDSCAGIITFCHTFSPSKMWIGGLAQLQKPWLHFHTQFNREIPNDAIDMDYMNLHQSAHGDREHGFIGARMRFPRKVVVGDWGDEKPQKKIAAWMRAAVGAAVSRDLKVMRFGDNMREVAVTEGDKVEAQIKLGWQVNTWPVGQLAEEMSAVTKAEIDELVEEYRTRYDFPDSAKKDASAAATAIVDTIRYQAREQIAMRKMLDAEACFAFTNTFQDLYGMKQLPGLATQDLMARGYGYGGEGDWKTAAMTALIKAMSAGTGEKALSGGTSFMEDYVYDFAAGLSLGAHMLEVCPSVASGKPRIEVHPLGIGDREPPARLVFEGKAGFATVYSLVDMGGRFRLIAQDIECVAPTQAMPNLPVARVMWRPMPDLERGAEAWILAGGAHHTTLSYDISADIMRDWARIMGIEFVYIDSETNPIALERDLMISSAVYR

πŸ“Š Sample Types

Isolate 52.3%
Metagenome 47.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 26.3%
Apidae 22.9%
Blattidae 10.6%
Drosophilidae 7.5%
Termitidae 6.8%
Kalotermitidae 4.4%
Elmidae 3.8%
Tenebrionidae 2.4%
Scarabaeidae 1.7%
Curculionidae 1.7%
Rhinotermitidae 1.4%
Formicidae 1.4%
Armadillidiidae 1.0%
Passalidae 1.0%
Aphididae 0.7%
Termopsidae 0.7%
Cerambycidae 0.7%
Rhaphidophoridae 0.3%
Noctuidae 0.3%
Libellulidae 0.3%
Rhopalidae 0.3%
Carabidae 0.3%
Daphniidae 0.3%
Thomisidae 0.3%
Bombycidae 0.3%
Culicidae 0.3%
Hodotermitidae 0.3%
Thripidae 0.3%
Nephropidae 0.3%
Dytiscidae 0.3%
Anthocoridae 0.3%
Hydrophilidae 0.3%

🌳 Taxonomy

Archaea 0
Bacteria 449
Eukaryota 0
Viruses 0
Unclassified 14

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2843337836 Gilliamella apicola N-12-12 Isolate Apidae
2 2849463436 Gilliamella apicola A-8-12 Isolate Apidae
3 2864909992 Bacillus velezensis S00166 Isolate Elmidae
4 2873656248 Gilliamella apicola A-1-24 Isolate Apidae
5 2876016455 Gilliamella apicola N6 Isolate Apidae
6 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
7 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
8 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
9 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
10 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
11 2511231129 Vibrio sp. EJY3 Isolate Unclassified
12 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
13 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
14 2595698199 Melissococcus plutonius 60 Isolate Apidae
15 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
16 2645727860 Winslowiella iniecta B120 Isolate Aphididae
17 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
18 2756170265 Gilliamella apicola DSM 104097 Isolate Unclassified
19 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
20 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
21 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
22 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
23 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
24 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
25 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 648276708 Pantoea sp. aB Isolate Unclassified
31 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
32 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
33 8007237282 Enterococcus sp. DIV0212c Isolate
34 8017489919 Lactobacillus brevis EF Isolate Unclassified
35 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
36 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
37 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
38 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
39 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
40 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
41 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
45 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
46 2846485327 Gilliamella apicola AM4 Isolate Apidae
47 2849471304 Gilliamella apicola NO5 Isolate Apidae
48 2876022486 Gilliamella apicola A8 Isolate Apidae
49 2876027665 Gilliamella apicola P54G Isolate Apidae
50 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
51 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
52 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
53 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
54 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
55 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
56 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
57 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
58 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
59 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
60 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
61 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
62 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
63 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
64 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
65 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
66 2785510747 Gilliamella sp. ESL0443 Isolate Apidae
67 2820438595 Unclassified Firmicutes Lab288P3bin208 Isolate Unclassified
68 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
69 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
70 8088491222 Gilliamella apicola ESL0178 Isolate Apidae
71 8103002986 Erwinia sp. S38 Isolate Curculionidae
72 8103008710 Erwinia sp. S43 Isolate Curculionidae
73 8108568626 Enterococcus sp. DIV1094 Isolate
74 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
75 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
76 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
77 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
78 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
79 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
80 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
81 2846475167 Gilliamella apicola N-G5 Isolate Apidae
82 2857888719 Gilliamella apicola N-15-12 Isolate Apidae
83 2864895409 Bacillus aerius S00152 Isolate Elmidae
84 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
85 2870910722 Gilliamella apicola wkB112 Isolate Apidae
86 2873648542 Gilliamella apicola NO10 Isolate Apidae
87 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
88 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
89 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
90 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
91 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
92 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
93 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
94 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
95 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
96 2595698197 Melissococcus plutonius H6 Isolate Apidae
97 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
98 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
99 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
100 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
101 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
102 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
103 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
104 8022096067 Vibrio sp. SALL6 Isolate Unclassified
105 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
106 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
107 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
108 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
109 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
110 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
111 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
112 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
113 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
114 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
115 2840795165 Gilliamella apicola N-22 Isolate Apidae
116 2854144746 Gilliamella apicola NO6 Isolate Apidae
117 2857870431 Gilliamella apicola A-7-24 Isolate Apidae
118 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
119 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
120 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
121 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
122 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
123 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
124 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
125 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
126 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
127 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
128 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
129 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
130 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
131 2515154047 Candidatus Gilliamella apicola wkB1 Isolate Apidae
132 2574179716 Serratia sp. DD3 Isolate Daphniidae
133 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
134 2595698193 Melissococcus plutonius B5 Isolate Apidae
135 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
136 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
137 2684622925 Gilliamella apicola Ga_178 Isolate Unclassified
138 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
139 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
140 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
141 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
142 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
143 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
144 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
145 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
146 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
147 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
148 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
149 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
150 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
151 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
152 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
153 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
154 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
155 3300000490 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 Metagenome Apidae
156 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
157 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
158 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
159 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
160 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
161 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
162 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
163 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
164 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
165 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
166 2837618715 Gilliamella apicola Aw-17 Isolate Apidae
167 2841195917 Gilliamella apicola wkB7 Isolate Apidae
168 2846495668 Gilliamella apicola ESL0178 Isolate Apidae
169 2849452216 Gilliamella apicola AW11 Isolate Apidae
170 2849455045 Gilliamella apicola NO8 Isolate Apidae
171 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
172 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
173 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
174 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
175 2873636219 Gilliamella apicola App2-1 Isolate Apidae
176 2876033458 Gilliamella apicola AM6 Isolate Apidae
177 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
178 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
179 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
180 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
181 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
182 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
183 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
184 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
185 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
186 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
187 2595698195 Melissococcus plutonius 119 Isolate Apidae
188 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
189 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
190 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
191 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
192 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
193 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
194 8022087107 Vibrio sp. OULL4 Isolate Unclassified
195 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
196 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
197 8102982778 Erwinia sp. S63 Isolate Curculionidae
198 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
199 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
200 3300007766 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 4 gut Metagenome Drosophilidae
201 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
202 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
203 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
204 2854141978 Gilliamella apicola A-12-12 Isolate Apidae
205 2854147632 Gilliamella apicola wkB195 Isolate Apidae
206 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
207 2864801025 Bacillus aerius S00042 Isolate Elmidae
208 2868489326 Gilliamella apicola N10 Isolate Apidae
209 2868499409 Gilliamella apicola N-9-4 Isolate Apidae
210 2870920129 Gilliamella apicola wkB108 Isolate Apidae
211 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
212 2873638493 Gilliamella apicola wkB72 Isolate Apidae
213 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
214 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
215 2912570088 Vibrio parahaemolyticus CHN25 Isolate
216 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
217 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
218 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
219 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
220 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
221 2547132081 Streptomyces sp. S4 Isolate Formicidae
222 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
223 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
224 2648501209 Winslowiella iniecta B149 Isolate Aphididae
225 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
226 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
227 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
228 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
229 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
230 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
231 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
232 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
233 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
234 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
235 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
236 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
237 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
238 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
239 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
240 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
241 8114555646 Enterococcus sp. DIV1094 Isolate
242 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
243 2843334863 Gilliamella apicola A-2-24 Isolate Apidae
244 2849468476 Gilliamella apicola N-28 Isolate Apidae
245 2857883421 Gilliamella apicola N2 Isolate Apidae
246 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
247 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
248 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
249 2868506828 Gilliamella apicola App4-10 Isolate Apidae
250 2870897478 Gilliamella apicola A-7-12 Isolate Apidae
251 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
252 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
253 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
254 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
255 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
256 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
257 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
258 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
259 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
260 2627853628 Melissococcus plutonius 82 Isolate Apidae
261 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
262 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
263 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
264 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
265 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
266 2785510744 Gilliamella sp. ESL0405 Isolate Apidae
267 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
268 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
269 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
270 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
271 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
272 2838840603 Gilliamella apicola A-9-12 Isolate Apidae
273 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
274 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
275 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
276 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
277 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
278 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
279 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
280 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
281 2595698198 Melissococcus plutonius L9 Isolate Apidae
282 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
283 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
284 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
285 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
286 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
287 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
288 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
289 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
290 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
291 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
292 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
293 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
294 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
295 8099192374 Erwinia typographi IC4 Isolate Curculionidae
296 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
297 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
298 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
299 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
300 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
301 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
302 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
303 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
304 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
305 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_090286 3300042659 Bacteria 40500
2 Ga0562379_0014 3300056790 Bacteria 1325122
3 Ga0562379_0082 3300056790 Bacteria 350556
4 Ga0562379_0091 3300056790 Bacteria 324047
5 Ga0562378_0682 3300056814 Unclassified 49755
6 Ga0562377_0011 3300056842 Bacteria 1259346
7 Ga0562376_2748 3300056857 Unclassified 19984
8 Ga0562374_0066 3300057007 Bacteria 347609
9 Ga0466715_026138 3300042616 Bacteria 10500
10 Ga0466723_014909 3300042618 Bacteria 24657
11 Ga0466729_017412 3300042621 Bacteria 2569
12 Ga0466706_264431 3300042599 Bacteria 4579
13 Ga0466707_238278 3300042601 Bacteria 1942
14 Ga0466707_420286 3300042601 Bacteria 8397
15 Ga0466713_104174 3300042602 Bacteria 30691
16 Ga0466719_135358 3300042606 Bacteria 2541
17 Ga0466722_008975 3300042609 Bacteria 5444
18 Ga0466722_168463 3300042609 Unclassified 2725
19 Ga0123353_10184244 3300010167 Bacteria 3302
20 Ga0160445_101610 3300012847 Bacteria 6145
21 Ga0316159_11020 3300030930 Bacteria 9996
22 Ga0415639_020641 3300038395 Bacteria 6636
23 Ga0466730_040220 3300042625 Bacteria 15233
24 Ga0466704_188928 3300042643 Bacteria 4523
25 2227080766 2225789004 Bacteria 378528
26 SCG598L16_135910 3300000490 Bacteria 90714
27 JGI24702J35022_10011185 3300002462 Bacteria 4999
28 Ga0072941_1101622 3300005201 Bacteria 10776
29 Ga0466705_064741 3300042612 Bacteria 5009
30 Ga0562379_0005 3300056790 Bacteria 2649770
31 Ga0562377_0041 3300056842 Bacteria 609183
32 Ga0562376_0004 3300056857 Bacteria 3026470
33 Ga0562376_2518 3300056857 Bacteria 21580
34 Ga0466715_291897 3300042616 Bacteria 12223
35 Ga0466726_469545 3300042619 Bacteria 4772
36 Ga0466728_483276 3300042620 Bacteria 11461
37 Ga0466706_155123 3300042599 Bacteria 22471
38 Ga0466706_162695 3300042599 Bacteria 3289
39 Ga0466706_256711 3300042599 Bacteria 60836
40 Ga0466700_492821 3300042600 Bacteria 1433
41 Ga0466714_000898 3300042603 Bacteria 3551
42 Ga0466716_065457 3300042605 Bacteria 11284
43 Ga0123356_10019480 3300010049 Bacteria 6432
44 Ga0123353_10003276 3300010167 Bacteria 20423
45 Ga0123353_10048071 3300010167 Bacteria 6791
46 Ga0123353_10142866 3300010167 Bacteria 3832
47 Ga0123353_10145596 3300010167 Bacteria 3788
48 Ga0160464_100733 3300012805 Bacteria 18722
49 Ga0415639_035017 3300038395 Bacteria 6304
50 Ga0415639_054092 3300038395 Bacteria 8250
51 Ga0466702_103055 3300042635 Bacteria 5194
52 gam1t_NODE_477064_length=9976_GC=34_5_Contigs=2 2189573031 Bacteria 9986
53 2227590446 2225789004 Bacteria 2427
54 JGI24702J35022_10010430 3300002462 Bacteria 5192
55 Ga0063521_1000029 3300003973 Bacteria 122497
56 Ga0074278_119027 3300005721 Bacteria 2264
57 Ga0105003_1001603 3300007766 Bacteria 15183
58 Ga0466705_298798 3300042612 Bacteria 1923
59 Ga0466733_184370 3300042659 Bacteria 9974
60 Ga0562379_0249 3300056790 Bacteria 145772
61 Ga0562379_0340 3300056790 Unclassified 114300
62 Ga0562379_2098 3300056790 Bacteria 18218
63 Ga0562378_0221 3300056814 Unclassified 133873
64 Ga0562377_1655 3300056842 Unclassified 21244
65 Ga0466705_501698 3300042612 Bacteria 2435
66 Ga0466706_101037 3300042599 Bacteria 60617
67 Ga0466706_151109 3300042599 Bacteria 4600
68 Ga0466719_232345 3300042606 Bacteria 9311
69 Ga0466721_160537 3300042608 Bacteria 71411
70 Ga0123355_10066053 3300009826 Bacteria 5824
71 Ga0123356_10000376 3300010049 Bacteria 50874
72 Ga0123356_10014587 3300010049 Unclassified 7552
73 Ga0123356_10036952 3300010049 Bacteria 4558
74 Ga0123353_10036137 3300010167 Bacteria 7737
75 Ga0123353_10274283 3300010167 Bacteria 2596
76 Ga0265387_1001459 3300024582 Bacteria 3467
77 Ga0415639_001178 3300038395 Bacteria 47687
78 Ga0415639_004806 3300038395 Bacteria 37095
79 Ga0415639_004807 3300038395 Bacteria 11211
80 Ga0466696_060286 3300042596 Bacteria 3613
81 Ga0466704_078117 3300042643 Bacteria 17167
82 AglaG_contig16328 2084038013 Bacteria 2953
83 IMNBL1DRAFT_c0003319 3300000062 Bacteria 10448
84 HBC_ctgsDRAFT_1004500 3300000333 Bacteria 3233
85 Ga0562379_0009 3300056790 Bacteria 1927879
86 Ga0562375_0089 3300056856 Bacteria 285665
87 Ga0562376_0538 3300056857 Unclassified 67118
88 Ga0562374_0021 3300057007 Bacteria 1089448
89 Ga0562374_1076 3300057007 Bacteria 35494
90 Ga0466723_178323 3300042618 Bacteria 48138
91 Ga0466706_024450 3300042599 Bacteria 4086
92 Ga0466706_040556 3300042599 Bacteria 25217
93 Ga0466706_137579 3300042599 Bacteria 14478
94 Ga0466706_142220 3300042599 Bacteria 2493
95 Ga0466706_260041 3300042599 Bacteria 4219
96 Ga0466706_284061 3300042599 Bacteria 2650
97 Ga0466713_087161 3300042602 Bacteria 3886
98 Ga0466719_246062 3300042606 Bacteria 4556
99 Ga0123353_10004052 3300010167 Bacteria 18773
100 Ga0123353_10004976 3300010167 Bacteria 17312
101 Ga0123353_10007420 3300010167 Bacteria 14804
102 Ga0123353_10076834 3300010167 Bacteria 5365
103 Ga0160464_100120 3300012805 Bacteria 87811
104 Ga0466692_041886 3300042591 Bacteria 2838
105 Ga0466691_006485 3300042593 Bacteria 33041
106 Ga0466691_129586 3300042593 Bacteria 12504
107 Ga0466691_166097 3300042593 Bacteria 2777
108 Ga0466696_021329 3300042596 Bacteria 5395
109 Ga0466704_148568 3300042643 Bacteria 3750
110 Ga0466704_255109 3300042643 Bacteria 3634
111 Ga0466724_15447 3300042649 Bacteria 123877
112 Ga0466727_264367 3300042655 Bacteria 2588
113 IMNBGM34_c000074 3300000036 Bacteria 27929
114 HBC_ctgsDRAFT_1000482 3300000333 Bacteria 8989
115 JGI24697J35500_11252134 3300002507 Bacteria 2569
116 Ga0466705_370902 3300042612 Bacteria 9129
117 Ga0562377_0231 3300056842 Bacteria 134767
118 Ga0562377_0241 3300056842 Bacteria 129113
119 Ga0562375_4261 3300056856 Bacteria 11181
120 Ga0562374_0015 3300057007 Bacteria 1219565
121 Ga0466711_118770 3300042615 Bacteria 5932
122 Ga0466715_095440 3300042616 Bacteria 7487
123 Ga0466715_202870 3300042616 Bacteria 11932
124 Ga0466715_317474 3300042616 Bacteria 28415
125 Ga0466706_058454 3300042599 Bacteria 2386
126 Ga0466706_082448 3300042599 Bacteria 44969
127 Ga0466700_117029 3300042600 Bacteria 6171
128 Ga0466707_138885 3300042601 Bacteria 24067
129 Ga0466714_092303 3300042603 Bacteria 10748
130 Ga0466717_104782 3300042604 Bacteria 5216
131 Ga0466719_333140 3300042606 Bacteria 5225
132 Ga0466722_023094 3300042609 Bacteria 3440
133 Ga0466722_055864 3300042609 Bacteria 14778
134 Ga0466722_165364 3300042609 Bacteria 6792
135 Ga0123355_10000107 3300009826 Bacteria 91810
136 Ga0123356_10011679 3300010049 Bacteria 8554
137 Ga0123353_10000148 3300010167 Bacteria 87348
138 Ga0123353_10003322 3300010167 Bacteria 20296
139 Ga0123353_10032877 3300010167 Bacteria 8064
140 Ga0123353_10165952 3300010167 Bacteria 3510
141 Ga0123354_10214380 3300010882 Bacteria 2068
142 Ga0466692_145300 3300042591 Bacteria 19445
143 Ga0466696_020824 3300042596 Bacteria 5183
144 Ga0466701_009529 3300042598 Bacteria 375690
145 Ga0466734_005875 3300042623 Bacteria 4159
146 Ga0466704_294219 3300042643 Bacteria 55450
147 Ga0466727_312825 3300042655 Bacteria 1893
148 Ga0562377_0085 3300056842 Unclassified 338239
149 Ga0562376_0519 3300056857 Bacteria 69115
150 Ga0466715_032121 3300042616 Bacteria 36016
151 Ga0466715_204496 3300042616 Bacteria 4386
152 Ga0466715_219681 3300042616 Bacteria 43032
153 Ga0466715_308005 3300042616 Bacteria 2192
154 Ga0466723_350569 3300042618 Bacteria 4188
155 Ga0466728_260281 3300042620 Bacteria 6738
156 Ga0466706_005338 3300042599 Bacteria 20328
157 Ga0466706_060437 3300042599 Bacteria 8251
158 Ga0466706_060661 3300042599 Bacteria 15441
159 Ga0466706_078936 3300042599 Bacteria 21989
160 Ga0466706_081679 3300042599 Bacteria 15818
161 Ga0466706_158562 3300042599 Bacteria 26434
162 Ga0466706_270850 3300042599 Bacteria 22715
163 Ga0466707_290265 3300042601 Bacteria 80468
164 Ga0466719_222600 3300042606 Bacteria 12601
165 Ga0123355_10262018 3300009826 Bacteria 2416
166 Ga0123356_10030680 3300010049 Bacteria 5031
167 Ga0123356_10124859 3300010049 Bacteria 2511
168 Ga0123356_10565758 3300010049 Bacteria 1299
169 Ga0123353_10000793 3300010167 Bacteria 38470
170 Ga0123353_10044442 3300010167 Bacteria 7041
171 Ga0123353_10276270 3300010167 Bacteria 2584
172 Ga0466696_450448 3300042596 Bacteria 1748
173 Ga0466704_090815 3300042643 Bacteria 2723
174 Ga0466704_109943 3300042643 Bacteria 4502
175 Ga0466708_082024 3300042652 Bacteria 17983
176 Ga0105003_1110279 3300007766 Unclassified 4402
177 Ga0466705_239374 3300042612 Bacteria 6175
178 Ga0466733_142961 3300042659 Bacteria 8282
179 Ga0562379_0080 3300056790 Bacteria 355260
180 Ga0562376_0061 3300056857 Bacteria 279319
181 Ga0562376_2505 3300056857 Unclassified 21655
182 Ga0466711_080006 3300042615 Bacteria 15829
183 Ga0466711_343023 3300042615 Bacteria 14665
184 Ga0466706_131506 3300042599 Bacteria 17038
185 Ga0466707_041950 3300042601 Bacteria 16644
186 Ga0466713_063713 3300042602 Bacteria 3816
187 Ga0466721_251483 3300042608 Bacteria 13592
188 Ga0123353_10037051 3300010167 Bacteria 7646
189 Ga0123353_10061252 3300010167 Bacteria 6034
190 Ga0160455_100036 3300012837 Bacteria 302007
191 Ga0466692_066493 3300042591 Bacteria 67113
192 Ga0466703_299081 3300042636 Bacteria 9073
193 Ga0466708_348418 3300042652 Bacteria 9517
194 Ga0466725_102954 3300042654 Bacteria 2406
195 JGI24702J35022_10006316 3300002462 Bacteria 6857
196 Ga0466705_296496 3300042612 Bacteria 7833
197 Ga0562379_1115 3300056790 Unclassified 35583
198 Ga0562375_1791 3300056856 Unclassified 26829
199 Ga0562376_0422 3300056857 Bacteria 79165
200 Ga0562374_0007 3300057007 Bacteria 2074405
201 Ga0466715_027967 3300042616 Bacteria 5024
202 Ga0466728_181482 3300042620 Bacteria 3258
203 Ga0466706_130214 3300042599 Bacteria 48191
204 Ga0466706_283842 3300042599 Bacteria 2241
205 Ga0466714_041576 3300042603 Bacteria 1671
206 Ga0466719_289755 3300042606 Bacteria 12208
207 Ga0123355_10078187 3300009826 Bacteria 5286
208 Ga0123353_10017449 3300010167 Bacteria 10555
209 Ga0123353_10027958 3300010167 Bacteria 8653
210 Ga0123353_10086497 3300010167 Bacteria 5048
211 Ga0160467_100101 3300012829 Bacteria 125088
212 Ga0160472_100002 3300012839 Bacteria 878838
213 Ga0415639_044848 3300038395 Bacteria 11460
214 Ga0466692_051337 3300042591 Bacteria 2058
215 Ga0466734_172717 3300042623 Bacteria 10560
216 Ga0466730_097202 3300042625 Bacteria 63992
217 Ga0466703_155970 3300042636 Bacteria 14448
218 IMNBL1DRAFT_c0000018 3300000062 Bacteria 172634
219 AustNasuHG_c1000471 3300000089 Bacteria 14140
220 Ga0063521_1016853 3300003973 Bacteria 1766
221 Ga0074278_142887 3300005721 Unclassified 9986

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_298798 Ga0466705_298798_181_1386 401
2 3300010049 Ga0123356_10565758 Ga0123356_105657581 410
3 2084038013 AglaG_contig16328 AglaG_03252460 412
4 3300042603 Ga0466714_041576 Ga0466714_041576_19_1401 437
5 3300005721 Ga0074278_119027 Ga0074278_1190272 447
6 3300007766 Ga0105003_1110279 Ga0105003_11102793 453
7 3300000333 HBC_ctgsDRAFT_1000482 HBC_ctgsDRAFT_10004823 456
8 3300042600 Ga0466700_492821 Ga0466700_492821_21_1403 460
9 3300042619 Ga0466726_469545 Ga0466726_469545_2742_4139 465
10 3300010167 Ga0123353_10184244 Ga0123353_101842442 466
11 3300042599 Ga0466706_081679 Ga0466706_081679_14065_15489 466
12 3300042618 Ga0466723_014909 Ga0466723_014909_16118_17518 466
13 3300042618 Ga0466723_178323 Ga0466723_178323_25623_27023 466
14 3300042609 Ga0466722_008975 Ga0466722_008975_3383_4849 470
15 3300009826 Ga0123355_10000107 Ga0123355_100001072 471
16 3300042591 Ga0466692_041886 Ga0466692_041886_1017_2432 471
17 3300042599 Ga0466706_151109 Ga0466706_151109_2297_3712 471
18 3300042600 Ga0466700_117029 Ga0466700_117029_195_1610 471
19 3300042659 Ga0466733_090286 Ga0466733_090286_8247_9662 471
20 3300010167 Ga0123353_10004976 Ga0123353_100049765 472
21 3300042655 Ga0466727_264367 Ga0466727_264367_1117_2535 472
22 3300012805 Ga0160464_100120 Ga0160464_10012012 473
23 3300056790 Ga0562379_0082 Ga0562379_0082_16212_17633 473
24 3300056790 Ga0562379_0249 Ga0562379_0249_87704_89125 473
25 3300056790 Ga0562379_0340 Ga0562379_0340_43273_44694 473
26 3300056814 Ga0562378_0221 Ga0562378_0221_1467_2888 473
27 3300056814 Ga0562378_0682 Ga0562378_0682_40915_42336 473
28 3300056842 Ga0562377_0085 Ga0562377_0085_255031_256452 473
29 3300056842 Ga0562377_1655 Ga0562377_1655_10364_11785 473
30 3300056857 Ga0562376_0004 Ga0562376_0004_2878918_2880339 473
31 3300056857 Ga0562376_0061 Ga0562376_0061_227871_229292 473
32 3300056857 Ga0562376_2748 Ga0562376_2748_15352_16773 473
33 3300057007 Ga0562374_0021 Ga0562374_0021_618734_620155 473
34 3300057007 Ga0562374_0066 Ga0562374_0066_1507_2928 473
35 3300057007 Ga0562374_1076 Ga0562374_1076_28752_30173 473
36 iso_pr_bacteria 2864801025 2864803511 473
37 iso_pr_bacteria 2864895409 2864897893 473
38 iso_pr_bacteria 650716050 650844693 473
39 iso_pr_bacteria 8012942269 8012943378 473
40 iso_pr_bacteria 8043041867 8043042278 473
41 2225789004 2227590446 2228148478 474
42 3300042599 Ga0466706_260041 Ga0466706_260041_846_2270 474
43 3300042602 Ga0466713_104174 Ga0466713_104174_15273_16742 474
44 3300056790 Ga0562379_0005 Ga0562379_0005_2337285_2338709 474
45 3300056790 Ga0562379_0009 Ga0562379_0009_197132_198556 474
46 3300056790 Ga0562379_0080 Ga0562379_0080_211200_212624 474
47 3300056790 Ga0562379_0091 Ga0562379_0091_103988_105412 474
48 3300056790 Ga0562379_1115 Ga0562379_1115_8968_10392 474
49 3300056842 Ga0562377_0011 Ga0562377_0011_433416_434840 474
50 3300056842 Ga0562377_0231 Ga0562377_0231_10886_12310 474
51 3300056856 Ga0562375_0089 Ga0562375_0089_279958_281382 474
52 3300056856 Ga0562375_1791 Ga0562375_1791_4027_5451 474
53 3300056856 Ga0562375_4261 Ga0562375_4261_4016_5440 474
54 3300056857 Ga0562376_0422 Ga0562376_0422_24132_25556 474
55 3300056857 Ga0562376_0519 Ga0562376_0519_49549_50973 474
56 3300056857 Ga0562376_0538 Ga0562376_0538_37248_38672 474
57 3300056857 Ga0562376_2505 Ga0562376_2505_14023_15447 474
58 3300057007 Ga0562374_0007 Ga0562374_0007_1972179_1973603 474
59 iso_pr_bacteria 2551306396 2552920329 474
60 iso_pr_bacteria 2574180310 2576356798 474
61 iso_pr_bacteria 2576861670 2579165830 474
62 iso_pr_bacteria 2595698190 2596205370 474
63 iso_pr_bacteria 2595698193 2596210777 474
64 iso_pr_bacteria 2595698194 2596213856 474
65 iso_pr_bacteria 2595698195 2596214469 474
66 iso_pr_bacteria 2595698196 2596216281 474
67 iso_pr_bacteria 2595698197 2596218121 474
68 iso_pr_bacteria 2595698198 2596219948 474
69 iso_pr_bacteria 2595698199 2596221764 474
70 iso_pr_bacteria 2597490293 2598963444 474
71 iso_pr_bacteria 2627853628 2628280114 474
72 iso_pr_bacteria 2630968413 2631703049 474
73 iso_pr_bacteria 2684622913 2686077832 474
74 iso_pr_bacteria 2690315820 2691199472 474
75 iso_pr_bacteria 2718218475 2721609677 474
76 iso_pr_bacteria 2728369362 2730152551 474
77 iso_pr_bacteria 2758568505 2760252044 474
78 iso_pr_bacteria 2758568506 2760253781 474
79 iso_pr_bacteria 2758568507 2760255318 474
80 iso_pr_bacteria 2758568508 2760257017 474
81 iso_pr_bacteria 2758568509 2760258717 474
82 iso_pr_bacteria 2758568510 2760260486 474
83 iso_pr_bacteria 2758568513 2760266183 474
84 iso_pr_bacteria 2758568515 2760270027 474
85 iso_pr_bacteria 2758568557 2760422550 474
86 iso_pr_bacteria 2758568558 2760424266 474
87 iso_pr_bacteria 2758568559 2760425641 474
88 iso_pr_bacteria 2758568560 2760428131 474
89 iso_pr_bacteria 2758568561 2760429263 474
90 iso_pr_bacteria 2770939318 2771022324 474
91 iso_pr_bacteria 2775507073 2777016167 474
92 iso_pr_bacteria 2785510748 2785747836 474
93 iso_pr_bacteria 2799112220 2799192124 474
94 iso_pr_bacteria 2799112229 2799230075 474
95 iso_pr_bacteria 2799112230 2799232163 474
96 iso_pr_bacteria 2808606958 2811757318 474
97 iso_pr_bacteria 2834540479 2834540739 474
98 iso_pr_bacteria 2851412233 2851413947 474
99 iso_pr_bacteria 2864816158 2864816340 474
100 iso_pr_bacteria 2873632256 2873632919 474
101 iso_pr_bacteria 2882334426 2882335361 474
102 iso_pr_bacteria 2896402965 2896404171 474
103 iso_pr_bacteria 2896843662 2896846304 474
104 iso_pr_bacteria 2937236879 2937238509 474
105 iso_pr_bacteria 2940221333 2940221872 474
106 iso_pr_bacteria 2940380068 2940380884 474
107 iso_pr_bacteria 2940386776 2940387876 474
108 iso_pr_bacteria 2940393498 2940394315 474
109 iso_pr_bacteria 2940400224 2940401040 474
110 iso_pr_bacteria 2940406939 2940408155 474
111 iso_pr_bacteria 2940413413 2940413537 474
112 iso_pr_bacteria 2940419646 2940421679 474
113 iso_pr_bacteria 2940425923 2940427945 474
114 iso_pr_bacteria 2956926959 2956927336 474
115 iso_pr_bacteria 2956930723 2956931533 474
116 iso_pr_bacteria 2957623355 2957626711 474
117 iso_pr_bacteria 2958885890 2958886785 474
118 iso_pr_bacteria 2960772748 2960772985 474
119 iso_pr_bacteria 2961465228 2961466187 474
120 iso_pr_bacteria 2961515617 2961517000 474
121 iso_pr_bacteria 2964739456 2964739864 474
122 iso_pr_bacteria 2964749277 2964751869 474
123 iso_pr_bacteria 2964765680 2964767044 474
124 iso_pr_bacteria 2964775400 2964778021 474
125 iso_pr_bacteria 2964778705 2964781311 474
126 iso_pr_bacteria 2967802344 2967802378 474
127 iso_pr_bacteria 2967825073 2967828005 474
128 iso_pr_bacteria 2968368220 2968368337 474
129 iso_pr_bacteria 2970199020 2970199430 474
130 iso_pr_bacteria 2970225615 2970227858 474
131 iso_pr_bacteria 2970254690 2970255018 474
132 iso_pr_bacteria 2971062614 2971063187 474
133 iso_pr_bacteria 2977592972 2977595724 474
134 iso_pr_bacteria 2977596371 2977599213 474
135 iso_pr_bacteria 2977622177 2977624760 474
136 iso_pr_bacteria 2977628635 2977631786 474
137 iso_pr_bacteria 2977635137 2977637648 474
138 iso_pr_bacteria 2977653127 2977655324 474
139 iso_pr_bacteria 2983866074 2983869007 474
140 iso_pr_bacteria 8001918023 8001919106 474
141 iso_pr_bacteria 8004832522 8004833410 474
142 iso_pr_bacteria 8007211731 8007213998 474
143 iso_pr_bacteria 8007215774 8007216569 474
144 iso_pr_bacteria 8007220153 8007220835 474
145 iso_pr_bacteria 8017440191 8017440527 474
146 iso_pr_bacteria 8017462664 8017464271 474
147 iso_pr_bacteria 8017489919 8017490735 474
148 iso_pr_bacteria 8018794549 8018795155 474
149 iso_pr_bacteria 8038268975 8038269301 474
150 iso_pr_bacteria 8108568626 8108571760 474
151 iso_pr_bacteria 8114544644 8114548125 474
152 iso_pr_bacteria 8114555646 8114558780 474
153 3300042615 Ga0466711_343023 Ga0466711_343023_11823_13322 475
154 3300057007 Ga0562374_0015 Ga0562374_0015_764564_765991 475
155 iso_pr_bacteria 8002299145 8002299995 475
156 iso_pr_bacteria 8007237282 8007239009 475
157 iso_pr_bacteria 8114541043 8114542141 475
158 3300002462 JGI24702J35022_10010430 JGI24702J35022_100104305 476
159 3300010049 Ga0123356_10019480 Ga0123356_100194802 476
160 3300042612 Ga0466705_239374 Ga0466705_239374_160_1590 476
161 3300042620 Ga0466728_483276 Ga0466728_483276_3029_4459 476
162 3300042643 Ga0466704_078117 Ga0466704_078117_12480_13910 476
163 3300010049 Ga0123356_10030680 Ga0123356_100306802 477
164 3300012847 Ga0160445_101610 Ga0160445_1016102 477
165 3300042593 Ga0466691_129586 Ga0466691_129586_5106_6539 477
166 iso_pr_bacteria 2873595552 2873597023 477
167 3300042599 Ga0466706_060661 Ga0466706_060661_10072_11556 478
168 3300042609 Ga0466722_023094 Ga0466722_023094_706_2145 479
169 3300042616 Ga0466715_204496 Ga0466715_204496_2130_3569 479
170 3300042643 Ga0466704_188928 Ga0466704_188928_2695_4134 479
171 3300038395 Ga0415639_020641 Ga0415639_020641_1179_2621 480
172 3300038395 Ga0415639_054092 Ga0415639_054092_1370_2812 480
173 iso_pr_bacteria 2820582954 2820583630 480
174 3300010049 Ga0123356_10036952 Ga0123356_100369525 481
175 3300038395 Ga0415639_001178 Ga0415639_001178_13605_15050 481
176 3300042599 Ga0466706_155123 Ga0466706_155123_14789_16255 482
177 3300042606 Ga0466719_232345 Ga0466719_232345_1722_3170 482
178 3300042608 Ga0466721_251483 Ga0466721_251483_6645_8093 482
179 3300042618 Ga0466723_350569 Ga0466723_350569_1624_3072 482
180 3300042643 Ga0466704_090815 Ga0466704_090815_1056_2504 482
181 3300042643 Ga0466704_294219 Ga0466704_294219_14009_15457 482
182 iso_pr_bacteria 2820474468 2820474788 482
183 3300009826 Ga0123355_10066053 Ga0123355_100660533 483
184 3300010049 Ga0123356_10014587 Ga0123356_100145873 483
185 3300038395 Ga0415639_035017 Ga0415639_035017_3431_4882 483
186 iso_pr_bacteria 2820453354 2820455433 483
187 iso_pr_bacteria 2820584674 2820585409 483
188 iso_pr_bacteria 2820705605 2820705938 483
189 3300010167 Ga0123353_10017449 Ga0123353_100174494 484
190 3300024582 Ga0265387_1001459 Ga0265387_10014592 484
191 3300042608 Ga0466721_160537 Ga0466721_160537_5264_6718 484
192 3300002507 JGI24697J35500_11252134 JGI24697J35500_112521342 485
193 3300009826 Ga0123355_10078187 Ga0123355_100781872 485
194 3300042616 Ga0466715_095440 Ga0466715_095440_2111_3592 485
195 3300000089 AustNasuHG_c1000471 AustNasuHG_10004716 486
196 3300010049 Ga0123356_10124859 Ga0123356_101248592 486
197 3300010167 Ga0123353_10007420 Ga0123353_100074206 486
198 3300042596 Ga0466696_020824 Ga0466696_020824_2784_4268 486
199 3300042596 Ga0466696_060286 Ga0466696_060286_1552_3012 486
200 3300042612 Ga0466705_296496 Ga0466705_296496_6083_7543 486
201 3300042612 Ga0466705_370902 Ga0466705_370902_1833_3293 486
202 iso_pr_bacteria 2820418027 2820418176 486
203 iso_pr_bacteria 2820420508 2820421541 486
204 iso_pr_bacteria 2820560510 2820561902 486
205 3300002462 JGI24702J35022_10006316 JGI24702J35022_100063162 487
206 3300010049 Ga0123356_10000376 Ga0123356_1000037622 487
207 3300010167 Ga0123353_10000148 Ga0123353_1000014851 487
208 3300010167 Ga0123353_10027958 Ga0123353_100279582 487
209 3300010167 Ga0123353_10165952 Ga0123353_101659522 487
210 3300010167 Ga0123353_10276270 Ga0123353_102762703 487
211 3300010167 Ga0123353_10000793 Ga0123353_1000079313 488
212 3300010167 Ga0123353_10003276 Ga0123353_1000327611 488
213 3300038395 Ga0415639_044848 Ga0415639_044848_2371_3837 488
214 3300042599 Ga0466706_078936 Ga0466706_078936_17757_19223 488
215 3300042599 Ga0466706_130214 Ga0466706_130214_23131_24597 488
216 3300042599 Ga0466706_283842 Ga0466706_283842_359_1825 488
217 3300042612 Ga0466705_064741 Ga0466705_064741_1192_2658 488
218 iso_pr_bacteria 2590828841 2593259492 488
219 iso_pr_bacteria 2878857142 2878858037 488
220 3300002462 JGI24702J35022_10011185 JGI24702J35022_100111853 489
221 3300042591 Ga0466692_051337 Ga0466692_051337_227_1696 489
222 3300042599 Ga0466706_005338 Ga0466706_005338_12713_14182 489
223 3300042599 Ga0466706_060437 Ga0466706_060437_1371_2840 489
224 3300042599 Ga0466706_082448 Ga0466706_082448_38019_39488 489
225 3300042599 Ga0466706_142220 Ga0466706_142220_973_2442 489
226 3300042599 Ga0466706_158562 Ga0466706_158562_20790_22259 489
227 3300042599 Ga0466706_270850 Ga0466706_270850_15847_17316 489
228 3300042603 Ga0466714_092303 Ga0466714_092303_3185_4654 489
229 3300042609 Ga0466722_055864 Ga0466722_055864_9756_11225 489
230 3300042615 Ga0466711_080006 Ga0466711_080006_4588_6057 489
231 3300042655 Ga0466727_312825 Ga0466727_312825_161_1630 489
232 3300056842 Ga0562377_0041 Ga0562377_0041_524880_526349 489
233 iso_pr_bacteria 2820275298 2820276464 489
234 iso_pr_bacteria 2820438595 2820438766 489
235 3300010167 Ga0123353_10037051 Ga0123353_100370512 490
236 3300010167 Ga0123353_10048071 Ga0123353_100480714 490
237 3300010167 Ga0123353_10076834 Ga0123353_100768342 490
238 3300042601 Ga0466707_138885 Ga0466707_138885_12185_13657 490
239 3300042601 Ga0466707_420286 Ga0466707_420286_1625_3097 490
240 3300042621 Ga0466729_017412 Ga0466729_017412_926_2398 490
241 3300042635 Ga0466702_103055 Ga0466702_103055_370_1842 490
242 3300042643 Ga0466704_255109 Ga0466704_255109_1334_2806 490
243 3300042652 Ga0466708_082024 Ga0466708_082024_12400_13947 490
244 3300042654 Ga0466725_102954 Ga0466725_102954_248_1720 490
245 iso_pr_bacteria 2820488713 2820489595 490
246 3300000062 IMNBL1DRAFT_c0003319 IMNBL1DRAFT_00033192 491
247 3300009826 Ga0123355_10262018 Ga0123355_102620182 491
248 3300010167 Ga0123353_10044442 Ga0123353_100444422 491
249 3300010167 Ga0123353_10061252 Ga0123353_100612524 491
250 3300010167 Ga0123353_10086497 Ga0123353_100864973 491
251 3300010167 Ga0123353_10274283 Ga0123353_102742832 491
252 3300012829 Ga0160467_100101 Ga0160467_100101125 491
253 3300038395 Ga0415639_004807 Ga0415639_004807_918_2393 491
254 3300042601 Ga0466707_041950 Ga0466707_041950_13056_14531 491
255 3300042601 Ga0466707_238278 Ga0466707_238278_344_1819 491
256 3300042601 Ga0466707_290265 Ga0466707_290265_31356_32831 491
257 3300038395 Ga0415639_004806 Ga0415639_004806_29436_30914 492
258 3300042606 Ga0466719_222600 Ga0466719_222600_1050_2528 492
259 3300042616 Ga0466715_032121 Ga0466715_032121_5064_6542 492
260 3300042616 Ga0466715_219681 Ga0466715_219681_2522_4000 492
261 3300042616 Ga0466715_291897 Ga0466715_291897_9623_11101 492
262 3300042636 Ga0466703_299081 Ga0466703_299081_4739_6217 492
263 3300056790 Ga0562379_0014 Ga0562379_0014_169063_170541 492
264 3300056790 Ga0562379_2098 Ga0562379_2098_1792_3270 492
265 3300056857 Ga0562376_2518 Ga0562376_2518_13793_15271 492
266 3300005201 Ga0072941_1101622 Ga0072941_11016221 493
267 3300010049 Ga0123356_10011679 Ga0123356_100116796 493
268 3300010167 Ga0123353_10036137 Ga0123353_100361375 493
269 3300010167 Ga0123353_10142866 Ga0123353_101428662 493
270 3300042616 Ga0466715_317474 Ga0466715_317474_17494_18975 493
271 3300042625 Ga0466730_040220 Ga0466730_040220_6497_7999 493
272 iso_pr_bacteria 2820424542 2820426218 493
273 iso_pr_bacteria 2940356891 2940357386 493
274 iso_pr_bacteria 8067071256 8067077008 493
275 2225789004 2227080766 2227449374 494
276 3300010167 Ga0123353_10004052 Ga0123353_1000405215 494
277 3300010882 Ga0123354_10214380 Ga0123354_102143802 494
278 3300042599 Ga0466706_024450 Ga0466706_024450_1001_2485 494
279 3300042599 Ga0466706_040556 Ga0466706_040556_13960_15444 494
280 3300042599 Ga0466706_162695 Ga0466706_162695_1198_2682 494
281 3300042599 Ga0466706_284061 Ga0466706_284061_562_2046 494
282 iso_pr_bacteria 2503904012 2503956615 494
283 iso_pr_bacteria 2788499854 2788758531 494
284 iso_pr_bacteria 2820460928 2820461198 494
285 iso_pr_bacteria 2940352027 2940352521 494
286 iso_pr_bacteria 2940354458 2940354952 494
287 iso_pr_bacteria 2940359323 2940359818 494
288 iso_pr_bacteria 2940361758 2940362333 494
289 iso_pr_bacteria 2940364193 2940364768 494
290 iso_pr_bacteria 2940366561 2940366864 494
291 iso_pr_bacteria 2940368928 2940369422 494
292 3300000333 HBC_ctgsDRAFT_1004500 HBC_ctgsDRAFT_10045002 495
293 3300010167 Ga0123353_10032877 Ga0123353_100328774 495
294 3300042596 Ga0466696_021329 Ga0466696_021329_2808_4295 495
295 3300042599 Ga0466706_264431 Ga0466706_264431_277_1764 495
296 3300042602 Ga0466713_087161 Ga0466713_087161_143_1630 495
297 3300042606 Ga0466719_333140 Ga0466719_333140_2166_3653 495
298 3300042616 Ga0466715_202870 Ga0466715_202870_7778_9265 495
299 3300030930 Ga0316159_11020 Ga0316159_110207 496
300 3300042593 Ga0466691_006485 Ga0466691_006485_3602_5092 496
301 3300042599 Ga0466706_101037 Ga0466706_101037_42913_44403 496
302 3300042599 Ga0466706_137579 Ga0466706_137579_2367_3857 496
303 3300042603 Ga0466714_000898 Ga0466714_000898_1518_3008 496
304 3300042623 Ga0466734_172717 Ga0466734_172717_5873_7363 496
305 iso_pr_bacteria 2871760914 2871764156 496
306 iso_pr_bacteria 3006225627 3006226603 496
307 iso_pr_bacteria 8102982778 8102983654 496
308 3300010167 Ga0123353_10145596 Ga0123353_101455963 497
309 3300012837 Ga0160455_100036 Ga0160455_10003659 497
310 3300042602 Ga0466713_063713 Ga0466713_063713_1965_3458 497
311 3300042616 Ga0466715_026138 Ga0466715_026138_4847_6340 497
312 3300042636 Ga0466703_155970 Ga0466703_155970_8229_9722 497
313 iso_pr_bacteria 2551306507 2553346886 497
314 iso_pr_bacteria 2663763317 2666539894 497
315 iso_pr_bacteria 2693429575 2693740954 497
316 iso_pr_bacteria 2700989396 2702440922 497
317 iso_pr_bacteria 2864909992 2864912959 497
318 iso_pr_bacteria 8022096067 8022100038 497
319 3300000036 IMNBGM34_c000074 IMNBGM34_00007427 498
320 3300042598 Ga0466701_009529 Ga0466701_009529_169272_170768 498
321 3300042612 Ga0466705_501698 Ga0466705_501698_841_2337 498
322 3300042652 Ga0466708_348418 Ga0466708_348418_3245_4741 498
323 iso_pr_bacteria 2860776474 2860780897 498
324 iso_pr_bacteria 2864788197 2864788917 498
325 iso_pr_bacteria 2864923010 2864923729 498
326 iso_pr_bacteria 2864948220 2864948939 498
327 iso_pr_bacteria 2877647439 2877651180 498
328 iso_pr_bacteria 2880115952 2880121168 498
329 iso_pr_bacteria 2912570088 2912574922 498
330 iso_pr_bacteria 2940230426 2940230875 498
331 iso_pr_bacteria 2940233634 2940233718 498
332 iso_pr_bacteria 2940264388 2940265324 498
333 iso_pr_bacteria 2940267548 2940268483 498
334 iso_pr_bacteria 2940270707 2940271643 498
335 iso_pr_bacteria 2940273867 2940274809 498
336 iso_pr_bacteria 2940277027 2940279802 498
337 iso_pr_bacteria 2940280053 2940283267 498
338 iso_pr_bacteria 2940283334 2940283418 498
339 iso_pr_bacteria 2940286528 2940289271 498
340 iso_pr_bacteria 2940289514 2940290869 498
341 iso_pr_bacteria 2940292506 2940294132 498
342 iso_pr_bacteria 2940295490 2940296957 498
343 iso_pr_bacteria 2944625312 2944628246 498
344 iso_pr_bacteria 8022087107 8022088905 498
345 3300000062 IMNBL1DRAFT_c0000018 IMNBL1DRAFT_0000018108 499
346 3300012805 Ga0160464_100733 Ga0160464_10073310 499
347 3300042659 Ga0466733_142961 Ga0466733_142961_1666_3165 499
348 3300042659 Ga0466733_184370 Ga0466733_184370_1287_2786 499
349 iso_pr_bacteria 2574179716 2574242545 499
350 iso_pr_bacteria 2619619082 2620609939 499
351 iso_pr_bacteria 2630969010 2634123562 499
352 iso_pr_bacteria 2791355481 2794424909 499
353 iso_pr_bacteria 2864777284 2864781124 499
354 iso_pr_bacteria 2864796242 2864800166 499
355 iso_pr_bacteria 648276708 648769786 499
356 3300007766 Ga0105003_1001603 Ga0105003_10016036 500
357 3300042599 Ga0466706_058454 Ga0466706_058454_702_2204 500
358 3300042604 Ga0466717_104782 Ga0466717_104782_128_1630 500
359 3300042615 Ga0466711_118770 Ga0466711_118770_4145_5647 500
360 3300042623 Ga0466734_005875 Ga0466734_005875_676_2178 500
361 3300042625 Ga0466730_097202 Ga0466730_097202_39795_41297 500
362 3300042649 Ga0466724_15447 Ga0466724_15447_62354_63856 500
363 3300056842 Ga0562377_0241 Ga0562377_0241_859_2361 500
364 iso_pr_bacteria 2511231129 2511734331 500
365 iso_pr_bacteria 2588253791 2588727465 500
366 iso_pr_bacteria 2785510762 2785802520 500
367 iso_pr_bacteria 2824588292 2824591502 500
368 iso_pr_bacteria 2833053935 2833057675 500
369 iso_pr_bacteria 2875320051 2875324570 500
370 iso_pr_bacteria 2889908211 2889913066 500
371 iso_pr_bacteria 2997380424 2997384068 500
372 iso_pr_bacteria 8004118532 8004120765 500
373 iso_pr_bacteria 8103002986 8103007020 500
374 iso_pr_bacteria 8103008710 8103010066 500
375 3300003973 Ga0063521_1016853 Ga0063521_10168531 501
376 3300012839 Ga0160472_100002 Ga0160472_100002395 501
377 3300042591 Ga0466692_066493 Ga0466692_066493_6787_8292 501
378 3300042591 Ga0466692_145300 Ga0466692_145300_1154_2659 501
379 3300042606 Ga0466719_246062 Ga0466719_246062_2044_3564 501
380 iso_pr_bacteria 2645727860 2647287350 501
381 iso_pr_bacteria 2648501209 2648983988 501
382 iso_pr_bacteria 2820321184 2820322298 501
383 iso_pr_bacteria 2820857933 2820858537 501
384 iso_pr_bacteria 2820882373 2820884638 501
385 iso_pr_bacteria 2898991528 2898993396 501
386 iso_pr_bacteria 8099192374 8099194731 501
387 3300003973 Ga0063521_1000029 Ga0063521_100002970 502
388 3300010167 Ga0123353_10003322 Ga0123353_100033225 502
389 3300042606 Ga0466719_135358 Ga0466719_135358_269_1777 502
390 3300042606 Ga0466719_289755 Ga0466719_289755_6249_7757 502
391 3300042620 Ga0466728_260281 Ga0466728_260281_757_2265 502
392 3300042643 Ga0466704_109943 Ga0466704_109943_2710_4218 502
393 iso_pr_bacteria 2515154047 2515332388 502
394 iso_pr_bacteria 2515154104 2515587247 502
395 iso_pr_bacteria 2684622925 2686101874 502
396 iso_pr_bacteria 2756170265 2756751283 502
397 iso_pr_bacteria 2785510744 2785738731 502
398 iso_pr_bacteria 2785510745 2785741199 502
399 iso_pr_bacteria 2785510747 2785745892 502
400 iso_pr_bacteria 2837618715 2837618851 502
401 iso_pr_bacteria 2838840603 2838843019 502
402 iso_pr_bacteria 2840795165 2840797294 502
403 iso_pr_bacteria 2841195917 2841198172 502
404 iso_pr_bacteria 2843334863 2843337216 502
405 iso_pr_bacteria 2843337836 2843339815 502
406 iso_pr_bacteria 2846475167 2846477070 502
407 iso_pr_bacteria 2846485327 2846486558 502
408 iso_pr_bacteria 2846495668 2846497537 502
409 iso_pr_bacteria 2849452216 2849454376 502
410 iso_pr_bacteria 2849455045 2849457514 502
411 iso_pr_bacteria 2849463436 2849465851 502
412 iso_pr_bacteria 2849468476 2849470683 502
413 iso_pr_bacteria 2849471304 2849473630 502
414 iso_pr_bacteria 2854141978 2854144462 502
415 iso_pr_bacteria 2854144746 2854144917 502
416 iso_pr_bacteria 2854147632 2854148145 502
417 iso_pr_bacteria 2857870431 2857872957 502
418 iso_pr_bacteria 2857883421 2857885076 502
419 iso_pr_bacteria 2857888719 2857890586 502
420 iso_pr_bacteria 2864878056 2864878655 502
421 iso_pr_bacteria 2864886855 2864887659 502
422 iso_pr_bacteria 2868489326 2868490473 502
423 iso_pr_bacteria 2868499409 2868501367 502
424 iso_pr_bacteria 2868506828 2868507833 502
425 iso_pr_bacteria 2870897478 2870897551 502
426 iso_pr_bacteria 2870910722 2870912727 502
427 iso_pr_bacteria 2870920129 2870922373 502
428 iso_pr_bacteria 2873636219 2873637956 502
429 iso_pr_bacteria 2873638493 2873639573 502
430 iso_pr_bacteria 2873648542 2873650933 502
431 iso_pr_bacteria 2873656248 2873658055 502
432 iso_pr_bacteria 2876016455 2876018264 502
433 iso_pr_bacteria 2876022486 2876024742 502
434 iso_pr_bacteria 2876027665 2876028100 502
435 iso_pr_bacteria 2876033458 2876034546 502
436 iso_pr_bacteria 8088491222 8088492252 502
437 iso_pr_bacteria 8118075156 8118081794 502
438 2189573031 gam1t_NODE_477064_length=9976_GC=34_5_Contigs=2 gam1t_00131210 503
439 3300042593 Ga0466691_166097 Ga0466691_166097_56_1567 503
440 3300042596 Ga0466696_450448 Ga0466696_450448_96_1607 503
441 3300042605 Ga0466716_065457 Ga0466716_065457_2444_3955 503
442 3300042616 Ga0466715_308005 Ga0466715_308005_219_1730 503
443 3300042620 Ga0466728_181482 Ga0466728_181482_1722_3233 503
444 iso_pr_bacteria 2547132081 2547297136 503
445 iso_pr_bacteria 2684622926 2686103589 503
446 iso_pr_bacteria 2876019154 2876020116 503
447 iso_pr_bacteria 8077783556 8077786262 503
448 3300000490 SCG598L16_135910 SCG598L16_13591036 504
449 3300005721 Ga0074278_142887 Ga0074278_1428877 504
450 3300042599 Ga0466706_256711 Ga0466706_256711_5776_7290 504
451 3300042599 Ga0466706_131506 Ga0466706_131506_5770_7287 505
452 iso_pr_bacteria 8046957834 8046961302 505
453 3300042609 Ga0466722_168463 Ga0466722_168463_481_2001 506
454 3300042643 Ga0466704_148568 Ga0466704_148568_276_1796 506
455 iso_pr_bacteria 2706794701 2708048248 506
456 iso_pr_bacteria 2517572100 2517756650 508
457 iso_pr_bacteria 2639763185 2642345242 508
458 iso_pr_bacteria 2639763186 2642351025 508
459 iso_pr_bacteria 2857493320 2857495354 508
460 iso_pr_bacteria 2857498920 2857500884 508
461 iso_pr_bacteria 2648501158 2648747763 509
462 3300042616 Ga0466715_027967 Ga0466715_027967_1417_3015 532
463 3300042609 Ga0466722_165364 Ga0466722_165364_1863_3497 544

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain 378 519 0.99
PF02610 Arabinose_Isome L-arabinose isomerase 48 212 0.98
PF24856 217 369 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02610 GO:0008733 L-arabinose isomerase activity MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.