Protein Family IF06833

Metagenome Isolate
135 Members
44 Samples
129 Scaffolds
374 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_150664|Ga0466722_150664_8395_9597
Length
400 aa
Sequence
LTAAARYLLPAAKFKSTGNGRRIGGTALSRLILKNVYKRYDNTEKKLFAPKKARNDFAVKDLSFECPDNSFIGILGPSGCGKSTTLRMIAGLENITAGSIFIGDVRINDLLPKDRNIGLAFEDYALYPPLSVYDNLAFNLKAKKTRAEKIKEAIDRVAPLLKVDELLNMKPSALSGGQKQRVNIARAIVRQPGLLLLDEPLSHLDGKMRQTLRQEIKRMHREIRCTTIIVTHDQIEAMSLADIIIIMKDGELQQMGTPMEVYDGPVNEFVAGFIGEPPMNLLQSTIIRHENGFFFTFEGSDLQVKVPGRSEALVSDGKKVTLGVRPMDVFITDSDTSTPVPVAVYENFGDERRVSVRVGKEILNITTTENVSYKHGDIIHLNFNSEKTHLFDPYSGTVIT

📊 Sample Types

Isolate 4.4%
Metagenome 95.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 31.8%
Termitidae 22.7%
Unclassified 13.6%
Termopsidae 9.1%
Rhinotermitidae 9.1%
Blattidae 6.8%
Passalidae 4.5%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 1
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
10 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
20 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
21 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
22 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
23 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
24 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
33 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
39 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_283056 3300042636 Bacteria 16882
2 Ga0466709_347115 3300042648 Bacteria 2918
3 Ga0466709_363655 3300042648 Bacteria 2521
4 Ga0466727_028955 3300042655 Bacteria 2091
5 Ga0466715_397368 3300042616 Bacteria 27898
6 Ga0466715_408031 3300042616 Bacteria 30961
7 Ga0466723_178057 3300042618 Bacteria 4834
8 Ga0466723_332173 3300042618 Bacteria 9668
9 Ga0466707_257947 3300042601 Bacteria 3625
10 Ga0466719_481908 3300042606 Bacteria 5657
11 Ga0466722_127238 3300042609 Bacteria 5999
12 Ga0123355_10148125 3300009826 Bacteria 3573
13 Ga0123353_10153120 3300010167 Bacteria 3679
14 Ga0466692_053194 3300042591 Bacteria 17680
15 Ga0466692_105282 3300042591 Bacteria 2921
16 Ga0466696_132240 3300042596 Bacteria 2308
17 Ga0068305_10644101 3300005083 Bacteria 13040
18 Ga0466705_050869 3300042612 Bacteria 37849
19 Ga0466705_072578 3300042612 Bacteria 4205
20 Ga0466705_179180 3300042612 Bacteria 8831
21 Ga0466735_066970 3300042624 Bacteria 9715
22 Ga0466708_292853 3300042652 Bacteria 5533
23 Ga0466705_395264 3300042612 Bacteria 39488
24 Ga0466723_128030 3300042618 Bacteria 26554
25 Ga0466728_068215 3300042620 Bacteria 13627
26 Ga0466729_170483 3300042621 Bacteria 1219
27 Ga0466716_031886 3300042605 Bacteria 10379
28 Ga0466719_577859 3300042606 Bacteria 7845
29 Ga0466722_185101 3300042609 Bacteria 9350
30 Ga0466692_019273 3300042591 Bacteria 43255
31 Ga0466692_102785 3300042591 Bacteria 7959
32 Ga0466696_103941 3300042596 Bacteria 24049
33 Ga0466696_108151 3300042596 Bacteria 10882
34 Ga0466696_410969 3300042596 Bacteria 2764
35 Ga0068302_10082506 3300005071 Bacteria 1487
36 Ga0466703_029038 3300042636 Bacteria 9135
37 Ga0466704_396215 3300042643 Unclassified 2843
38 Ga0466715_128329 3300042616 Bacteria 4285
39 Ga0466715_603011 3300042616 Bacteria 118245
40 Ga0466723_016700 3300042618 Bacteria 1929
41 Ga0466723_144426 3300042618 Bacteria 13101
42 Ga0466723_255927 3300042618 Bacteria 6282
43 Ga0466728_218837 3300042620 Bacteria 20224
44 Ga0466716_038253 3300042605 Bacteria 17602
45 Ga0466722_120768 3300042609 Bacteria 3922
46 Ga0466691_129356 3300042593 Bacteria 17044
47 Ga0466694_143629 3300042594 Bacteria 1627
48 Ga0466705_023111 3300042612 Bacteria 12054
49 Ga0466705_317216 3300042612 Bacteria 18450
50 Ga0466733_041992 3300042659 Bacteria 1463
51 Ga0466703_004099 3300042636 Bacteria 5306
52 Ga0466704_096871 3300042643 Bacteria 30593
53 Ga0466704_121453 3300042643 Bacteria 4489
54 Ga0466704_275455 3300042643 Bacteria 13689
55 Ga0466708_055671 3300042652 Bacteria 8987
56 Ga0466708_098691 3300042652 Bacteria 9980
57 Ga0466708_108887 3300042652 Bacteria 11003
58 Ga0466715_192313 3300042616 Bacteria 11718
59 Ga0466726_143032 3300042619 Bacteria 4401
60 Ga0466726_220555 3300042619 Bacteria 6910
61 Ga0466713_043059 3300042602 Bacteria 1869
62 Ga0466716_120231 3300042605 Bacteria 13609
63 Ga0123355_10003281 3300009826 Bacteria 23141
64 Ga0466690_025062 3300042590 Bacteria 5831
65 Ga0466691_016799 3300042593 Bacteria 2975
66 Ga0466691_023778 3300042593 Bacteria 29657
67 IMNBL1DRAFT_c0005006 3300000062 Bacteria 7736
68 JGI24702J35022_10014341 3300002462 Bacteria 4373
69 Ga0466704_027870 3300042643 Bacteria 7376
70 Ga0466704_174923 3300042643 Bacteria 11789
71 Ga0466709_378563 3300042648 Unclassified 4158
72 Ga0466711_354690 3300042615 Bacteria 7522
73 Ga0466715_587998 3300042616 Archaea 1830
74 Ga0466723_014766 3300042618 Bacteria 7042
75 Ga0466706_170397 3300042599 Bacteria 6967
76 Ga0466707_287126 3300042601 Bacteria 1282
77 Ga0466707_408472 3300042601 Bacteria 3381
78 Ga0466722_144849 3300042609 Bacteria 2900
79 Ga0123353_10181319 3300010167 Bacteria 3333
80 Ga0466690_416472 3300042590 Bacteria 2753
81 Ga0466693_341608 3300042592 Bacteria 20606
82 Ga0466691_224686 3300042593 Bacteria 13594
83 Ga0466696_336091 3300042596 Bacteria 3397
84 Ga0466699_224790 3300042597 Bacteria 2600
85 Ga0466705_087947 3300042612 Bacteria 2873
86 Ga0466733_070653 3300042659 Bacteria 4552
87 Ga0466703_105777 3300042636 Bacteria 7285
88 Ga0466703_111656 3300042636 Bacteria 10103
89 Ga0466704_216771 3300042643 Bacteria 20945
90 Ga0466708_262425 3300042652 Bacteria 5314
91 Ga0466727_346431 3300042655 Bacteria 10148
92 Ga0466715_219885 3300042616 Bacteria 7668
93 Ga0466715_432015 3300042616 Bacteria 9232
94 Ga0466728_114960 3300042620 Bacteria 20791
95 Ga0466722_012602 3300042609 Bacteria 22507
96 Ga0466690_124806 3300042590 Bacteria 4806
97 Ga0466692_037300 3300042591 Bacteria 11616
98 Ga0466705_383193 3300042612 Bacteria 1113
99 Ga0466703_123664 3300042636 Bacteria 3989
100 Ga0466703_193639 3300042636 Bacteria 2265
101 Ga0466727_027996 3300042655 Bacteria 6299
102 Ga0466715_019451 3300042616 Bacteria 11370
103 Ga0466723_066987 3300042618 Bacteria 43716
104 Ga0466723_372623 3300042618 Bacteria 20648
105 Ga0466706_021816 3300042599 Bacteria 1513
106 Ga0466700_285405 3300042600 Bacteria 1346
107 Ga0466722_025017 3300042609 Bacteria 6795
108 Ga0466722_125409 3300042609 Bacteria 2630
109 Ga0466722_150664 3300042609 Bacteria 25191
110 Ga0466722_160761 3300042609 Bacteria 7018
111 Ga0466690_110269 3300042590 Bacteria 8088
112 Ga0466705_015903 3300042612 Bacteria 5781
113 Ga0466729_228354 3300042621 Bacteria 2080
114 Ga0466735_077280 3300042624 Bacteria 17098
115 Ga0466703_227062 3300042636 Bacteria 13903
116 Ga0466704_052514 3300042643 Bacteria 70505
117 Ga0466709_154733 3300042648 Bacteria 11314
118 Ga0466715_054483 3300042616 Bacteria 7730
119 Ga0466723_162548 3300042618 Bacteria 9814
120 Ga0466713_109089 3300042602 Bacteria 2748
121 Ga0123357_10114811 3300009784 Bacteria 3417
122 Ga0123356_10067511 3300010049 Bacteria 3349
123 Ga0456237_0000119 3300041968 Bacteria 11641
124 Ga0466690_010770 3300042590 Bacteria 11202
125 Ga0466690_218839 3300042590 Bacteria 9807
126 Ga0466693_388691 3300042592 Bacteria 1288
127 Ga0466691_058953 3300042593 Bacteria 19492
128 Ga0466696_031978 3300042596 Bacteria 12519
129 2227322457 2225789004 Unclassified 6399

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_354690 Ga0466711_354690_2977_3963 328
2 3300042612 Ga0466705_383193 Ga0466705_383193_19_1068 349
3 3300042621 Ga0466729_170483 Ga0466729_170483_76_1200 359
4 3300042609 Ga0466722_025017 Ga0466722_025017_1205_2326 361
5 iso_pr_bacteria 8046957834 8046966400 361
6 3300042593 Ga0466691_058953 Ga0466691_058953_10192_11289 365
7 3300042612 Ga0466705_317216 Ga0466705_317216_8603_9700 365
8 3300042620 Ga0466728_218837 Ga0466728_218837_11484_12581 365
9 3300042636 Ga0466703_227062 Ga0466703_227062_8261_9358 365
10 3300042655 Ga0466727_027996 Ga0466727_027996_928_2055 366
11 3300042596 Ga0466696_410969 Ga0466696_410969_724_1827 367
12 3300042600 Ga0466700_285405 Ga0466700_285405_230_1333 367
13 3300042616 Ga0466715_192313 Ga0466715_192313_8476_9579 367
14 3300042648 Ga0466709_378563 Ga0466709_378563_636_1739 367
15 3300041968 Ga0456237_0000119 Ga0456237_0000119_6222_7328 368
16 3300042590 Ga0466690_218839 Ga0466690_218839_4571_5677 368
17 3300042591 Ga0466692_102785 Ga0466692_102785_2531_3637 368
18 3300042593 Ga0466691_023778 Ga0466691_023778_17324_18430 368
19 3300042616 Ga0466715_587998 Ga0466715_587998_566_1672 368
20 3300042643 Ga0466704_027870 Ga0466704_027870_1299_2405 368
21 3300042609 Ga0466722_120768 Ga0466722_120768_1367_2476 369
22 3300042616 Ga0466715_603011 Ga0466715_603011_85994_87106 370
23 3300042643 Ga0466704_275455 Ga0466704_275455_2494_3606 370
24 3300042643 Ga0466704_396215 Ga0466704_396215_575_1687 370
25 3300042652 Ga0466708_262425 Ga0466708_262425_2796_3908 370
26 3300042591 Ga0466692_105282 Ga0466692_105282_1405_2520 371
27 3300042609 Ga0466722_160761 Ga0466722_160761_4422_5537 371
28 3300042619 Ga0466726_143032 Ga0466726_143032_1308_2423 371
29 3300042652 Ga0466708_055671 Ga0466708_055671_5404_6519 371
30 3300042591 Ga0466692_037300 Ga0466692_037300_5801_6919 372
31 3300042592 Ga0466693_341608 Ga0466693_341608_1725_2843 372
32 3300042601 Ga0466707_408472 Ga0466707_408472_1437_2555 372
33 3300042618 Ga0466723_016700 Ga0466723_016700_124_1242 372
34 3300042619 Ga0466726_220555 Ga0466726_220555_3492_4610 372
35 3300042590 Ga0466690_110269 Ga0466690_110269_4406_5527 373
36 3300042590 Ga0466690_124806 Ga0466690_124806_1338_2459 373
37 3300042593 Ga0466691_016799 Ga0466691_016799_1301_2422 373
38 3300042593 Ga0466691_129356 Ga0466691_129356_9422_10543 373
39 3300042596 Ga0466696_031978 Ga0466696_031978_2828_3949 373
40 3300042596 Ga0466696_108151 Ga0466696_108151_2342_3463 373
41 3300042596 Ga0466696_336091 Ga0466696_336091_1598_2719 373
42 3300042599 Ga0466706_021816 Ga0466706_021816_304_1425 373
43 3300042599 Ga0466706_170397 Ga0466706_170397_2016_3137 373
44 3300042602 Ga0466713_109089 Ga0466713_109089_647_1768 373
45 3300042605 Ga0466716_031886 Ga0466716_031886_9008_10129 373
46 3300042605 Ga0466716_038253 Ga0466716_038253_2261_3382 373
47 3300042605 Ga0466716_120231 Ga0466716_120231_10224_11345 373
48 3300042606 Ga0466719_481908 Ga0466719_481908_2844_3965 373
49 3300042606 Ga0466719_577859 Ga0466719_577859_5643_6764 373
50 3300042609 Ga0466722_144849 Ga0466722_144849_1326_2447 373
51 3300042612 Ga0466705_015903 Ga0466705_015903_4290_5411 373
52 3300042612 Ga0466705_050869 Ga0466705_050869_23855_24976 373
53 3300042612 Ga0466705_087947 Ga0466705_087947_522_1643 373
54 3300042612 Ga0466705_179180 Ga0466705_179180_5272_6393 373
55 3300042616 Ga0466715_054483 Ga0466715_054483_2065_3186 373
56 3300042616 Ga0466715_432015 Ga0466715_432015_2663_3784 373
57 3300042618 Ga0466723_014766 Ga0466723_014766_1486_2607 373
58 3300042618 Ga0466723_144426 Ga0466723_144426_3774_4895 373
59 3300042618 Ga0466723_178057 Ga0466723_178057_354_1475 373
60 3300042618 Ga0466723_255927 Ga0466723_255927_4805_5926 373
61 3300042618 Ga0466723_332173 Ga0466723_332173_4691_5812 373
62 3300042620 Ga0466728_068215 Ga0466728_068215_8291_9412 373
63 3300042620 Ga0466728_114960 Ga0466728_114960_6684_7805 373
64 3300042624 Ga0466735_066970 Ga0466735_066970_3642_4763 373
65 3300042636 Ga0466703_004099 Ga0466703_004099_2132_3253 373
66 3300042636 Ga0466703_029038 Ga0466703_029038_2634_3755 373
67 3300042636 Ga0466703_105777 Ga0466703_105777_4450_5571 373
68 3300042636 Ga0466703_111656 Ga0466703_111656_6813_7934 373
69 3300042636 Ga0466703_123664 Ga0466703_123664_54_1175 373
70 3300042636 Ga0466703_283056 Ga0466703_283056_10109_11230 373
71 3300042643 Ga0466704_052514 Ga0466704_052514_20475_21596 373
72 3300042643 Ga0466704_096871 Ga0466704_096871_13403_14524 373
73 3300042643 Ga0466704_121453 Ga0466704_121453_1110_2231 373
74 3300042643 Ga0466704_174923 Ga0466704_174923_5022_6143 373
75 3300042643 Ga0466704_216771 Ga0466704_216771_2533_3654 373
76 3300042648 Ga0466709_154733 Ga0466709_154733_4789_5910 373
77 3300042648 Ga0466709_363655 Ga0466709_363655_313_1434 373
78 3300042652 Ga0466708_098691 Ga0466708_098691_417_1538 373
79 3300042655 Ga0466727_028955 Ga0466727_028955_241_1362 373
80 iso_pr_bacteria 2820620956 2820622207 373
81 3300002462 JGI24702J35022_10014341 JGI24702J35022_100143414 374
82 3300005071 Ga0068302_10082506 Ga0068302_100825062 374
83 3300009784 Ga0123357_10114811 Ga0123357_101148112 374
84 3300009826 Ga0123355_10003281 Ga0123355_100032819 374
85 3300009826 Ga0123355_10148125 Ga0123355_101481254 374
86 3300042590 Ga0466690_010770 Ga0466690_010770_692_1816 374
87 3300042590 Ga0466690_025062 Ga0466690_025062_263_1387 374
88 3300042591 Ga0466692_053194 Ga0466692_053194_5729_6853 374
89 3300042592 Ga0466693_388691 Ga0466693_388691_106_1230 374
90 3300042594 Ga0466694_143629 Ga0466694_143629_351_1475 374
91 3300042597 Ga0466699_224790 Ga0466699_224790_394_1518 374
92 3300042601 Ga0466707_287126 Ga0466707_287126_63_1187 374
93 3300042609 Ga0466722_185101 Ga0466722_185101_3783_4907 374
94 3300042618 Ga0466723_128030 Ga0466723_128030_6483_7607 374
95 2225789004 2227322457 2227770805 375
96 3300010167 Ga0123353_10153120 Ga0123353_101531203 375
97 3300042591 Ga0466692_019273 Ga0466692_019273_28244_29371 375
98 3300042602 Ga0466713_043059 Ga0466713_043059_648_1775 375
99 3300042612 Ga0466705_072578 Ga0466705_072578_2165_3292 375
100 3300042612 Ga0466705_395264 Ga0466705_395264_15997_17124 375
101 3300042616 Ga0466715_019451 Ga0466715_019451_10019_11146 375
102 3300042616 Ga0466715_397368 Ga0466715_397368_13952_15079 375
103 3300042621 Ga0466729_228354 Ga0466729_228354_818_1945 375
104 3300042648 Ga0466709_347115 Ga0466709_347115_845_1972 375
105 3300005083 Ga0068305_10644101 Ga0068305_106441018 376
106 3300042609 Ga0466722_012602 Ga0466722_012602_16058_17188 376
107 3300042618 Ga0466723_162548 Ga0466723_162548_18_1148 376
108 3300042652 Ga0466708_108887 Ga0466708_108887_3138_4268 376
109 3300010167 Ga0123353_10181319 Ga0123353_101813192 377
110 3300042596 Ga0466696_132240 Ga0466696_132240_318_1451 377
111 3300042616 Ga0466715_219885 Ga0466715_219885_2071_3204 377
112 3300042618 Ga0466723_066987 Ga0466723_066987_25002_26135 377
113 3300042652 Ga0466708_292853 Ga0466708_292853_4150_5283 377
114 iso_pr_bacteria 2820501819 2820502086 377
115 3300042593 Ga0466691_224686 Ga0466691_224686_7299_8435 378
116 3300042659 Ga0466733_070653 Ga0466733_070653_2665_3801 378
117 iso_pr_bacteria 2940264388 2940266875 378
118 iso_pr_bacteria 2940270707 2940273157 378
119 iso_pr_bacteria 2940273867 2940276358 378
120 3300042616 Ga0466715_128329 Ga0466715_128329_923_2062 379
121 3300010049 Ga0123356_10067511 Ga0123356_100675112 380
122 3300042609 Ga0466722_127238 Ga0466722_127238_3991_5133 380
123 3300042596 Ga0466696_103941 Ga0466696_103941_20534_21730 383
124 3300042601 Ga0466707_257947 Ga0466707_257947_1310_2461 383
125 3300042609 Ga0466722_125409 Ga0466722_125409_712_1863 383
126 3300000062 IMNBL1DRAFT_c0005006 IMNBL1DRAFT_00050064 386
127 3300042590 Ga0466690_416472 Ga0466690_416472_1255_2457 388
128 3300042655 Ga0466727_346431 Ga0466727_346431_8922_10100 392
129 3300042618 Ga0466723_372623 Ga0466723_372623_16311_17492 393
130 3300042624 Ga0466735_077280 Ga0466735_077280_7981_9162 393
131 3300042612 Ga0466705_023111 Ga0466705_023111_2305_3489 394
132 3300042609 Ga0466722_150664 Ga0466722_150664_8395_9597 400
133 3300042616 Ga0466715_408031 Ga0466715_408031_7960_9162 400
134 3300042659 Ga0466733_041992 Ga0466733_041992_88_1290 400
135 3300042636 Ga0466703_193639 Ga0466703_193639_1032_2243 403

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17912 OB_MalK MalK OB fold domain 275 326 0.93
PF00005 ABC_tran ABC transporter 59 201 0.93
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 130 233 0.75

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.