Protein Family IF06831
Metagenome
Isolate
129
Members
60
Samples
107
Scaffolds
401.03
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_147052|Ga0466722_147052_34146_35522
- Length
- 458 aa
- Sequence
- MAERLPSLCSFPILTQPLNLLPWFIESFNLRRAPPLSNFALEKRAKTRYDEAIANQSRRCPMAKIPMKTPLVEMDGDEMTRILWAMIKETLLTPFIELKTEYYDLGLPYRDQTQDQVTHDAAEAIKKYGVGVKCATITPNAQRLEEYKLKKVWPSPNATIRAALDGTVFRAPIVIKGIDPYIKNWTAPITIARHAYGDIYKGSELLVKAPAKAEIRVEYEDGQTETTPVHDFKGPGIVQGIHNTDSSIRSFAKACFNYAIDTRQTLWFATKDTISKTYDHHFKDIFAELFESDYRAKFEALGIEYFYTLIDDAVARVVRSNGGFIWACKNYDGDVMSDMVATVFGSLSMMTSVLVSPEGNYEYEAAHGTITRHYYQHLQGKQTSSNPVATIMAWTGALAKRGELDGSPELTAFAQKLERVTIETIEGGVMTGDLASLFKGEAKTVSAQAFLIAIAAKL
Sample Types
Isolate
17.1%
Metagenome
83.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
23.3%
Termitidae
21.7%
Cryptocercidae
20.0%
Unclassified
15.0%
Termopsidae
5.0%
Rhinotermitidae
5.0%
Passalidae
3.3%
Blaberidae
3.3%
Hodotermitidae
1.7%
Pseudophyllodromiidae
1.7%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 24 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 25 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 26 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 32 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 33 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 34 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 42 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 43 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 44 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 54 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 55 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 56 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 57 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 58 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 59 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 60 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_033176 | 3300042616 | Bacteria | 30145 |
| 2 | Ga0466726_131768 | 3300042619 | Bacteria | 1634 |
| 3 | Ga0466690_099034 | 3300042590 | Unclassified | 23711 |
| 4 | Ga0466692_073077 | 3300042591 | Bacteria | 10297 |
| 5 | Ga0466692_105616 | 3300042591 | Bacteria | 2670 |
| 6 | Ga0123356_10125475 | 3300010049 | Bacteria | 2505 |
| 7 | Ga0123353_10001395 | 3300010167 | Bacteria | 29586 |
| 8 | Ga0466704_303086 | 3300042643 | Bacteria | 20056 |
| 9 | Ga0466704_414317 | 3300042643 | Bacteria | 1776 |
| 10 | Ga0466709_123265 | 3300042648 | Bacteria | 21857 |
| 11 | Ga0466707_386827 | 3300042601 | Bacteria | 2451 |
| 12 | Ga0466711_357567 | 3300042615 | Bacteria | 2292 |
| 13 | Ga0466729_012998 | 3300042621 | Bacteria | 18866 |
| 14 | Ga0466692_041675 | 3300042591 | Bacteria | 9981 |
| 15 | Ga0466696_200434 | 3300042596 | Bacteria | 8523 |
| 16 | Ga0466696_488333 | 3300042596 | Bacteria | 5475 |
| 17 | Ga0123353_10365035 | 3300010167 | Bacteria | 2168 |
| 18 | Ga0466734_019915 | 3300042623 | Bacteria | 2711 |
| 19 | Ga0466704_131079 | 3300042643 | Bacteria | 3172 |
| 20 | Ga0466704_585182 | 3300042643 | Bacteria | 5595 |
| 21 | Ga0466708_369737 | 3300042652 | Bacteria | 12354 |
| 22 | Ga0466707_258747 | 3300042601 | Bacteria | 2344 |
| 23 | Ga0466714_115877 | 3300042603 | Bacteria | 37960 |
| 24 | Ga0466719_477750 | 3300042606 | Bacteria | 4217 |
| 25 | Ga0466726_009660 | 3300042619 | Bacteria | 122985 |
| 26 | Ga0466726_062186 | 3300042619 | Bacteria | 42153 |
| 27 | Ga0466726_363899 | 3300042619 | Bacteria | 1960 |
| 28 | Ga0415639_068793 | 3300038395 | Bacteria | 2742 |
| 29 | Ga0466691_136946 | 3300042593 | Bacteria | 8070 |
| 30 | Ga0123357_10027097 | 3300009784 | Bacteria | 7742 |
| 31 | Ga0123353_10023631 | 3300010167 | Bacteria | 9312 |
| 32 | Ga0466703_085209 | 3300042636 | Bacteria | 27314 |
| 33 | Ga0466709_234403 | 3300042648 | Bacteria | 9283 |
| 34 | Ga0466708_108357 | 3300042652 | Bacteria | 112687 |
| 35 | Ga0466719_187458 | 3300042606 | Bacteria | 8044 |
| 36 | Ga0466721_124028 | 3300042608 | Bacteria | 2700 |
| 37 | Ga0466712_207210 | 3300042614 | Bacteria | 1430 |
| 38 | Ga0466715_093166 | 3300042616 | Bacteria | 65432 |
| 39 | Ga0466726_311036 | 3300042619 | Bacteria | 5815 |
| 40 | Ga0466728_018896 | 3300042620 | Bacteria | 10766 |
| 41 | Ga0466729_173849 | 3300042621 | Bacteria | 8735 |
| 42 | Ga0123357_10033979 | 3300009784 | Bacteria | 6931 |
| 43 | Ga0123353_10570308 | 3300010167 | Bacteria | 1627 |
| 44 | Ga0466734_068039 | 3300042623 | Bacteria | 9474 |
| 45 | Ga0466708_147006 | 3300042652 | Unclassified | 8126 |
| 46 | Ga0466725_351828 | 3300042654 | Bacteria | 5138 |
| 47 | Ga0466727_244619 | 3300042655 | Bacteria | 3526 |
| 48 | Ga0466707_235700 | 3300042601 | Bacteria | 6685 |
| 49 | Ga0466707_420654 | 3300042601 | Bacteria | 29649 |
| 50 | Ga0466719_306042 | 3300042606 | Bacteria | 7496 |
| 51 | 2227510758 | 2225789004 | Bacteria | 18314 |
| 52 | IMNBL1DRAFT_c0004373 | 3300000062 | Bacteria | 8525 |
| 53 | JGI24702J35022_10001482 | 3300002462 | Bacteria | 14567 |
| 54 | Ga0466711_144020 | 3300042615 | Bacteria | 9759 |
| 55 | Ga0466715_268888 | 3300042616 | Bacteria | 5916 |
| 56 | Ga0466715_309594 | 3300042616 | Bacteria | 109113 |
| 57 | Ga0466723_250388 | 3300042618 | Bacteria | 22848 |
| 58 | Ga0466726_022047 | 3300042619 | Bacteria | 5983 |
| 59 | Ga0123353_10197280 | 3300010167 | Bacteria | 3171 |
| 60 | Ga0123353_10350449 | 3300010167 | Bacteria | 2225 |
| 61 | Ga0466708_239858 | 3300042652 | Bacteria | 26667 |
| 62 | Ga0466707_367735 | 3300042601 | Bacteria | 3751 |
| 63 | Ga0466713_026659 | 3300042602 | Bacteria | 12305 |
| 64 | Ga0466713_119761 | 3300042602 | Bacteria | 47658 |
| 65 | Ga0466733_211789 | 3300042659 | Bacteria | 2414 |
| 66 | Ga0466723_055979 | 3300042618 | Bacteria | 20741 |
| 67 | Ga0466728_325977 | 3300042620 | Bacteria | 1687 |
| 68 | Ga0466728_444564 | 3300042620 | Bacteria | 3404 |
| 69 | Ga0466690_172675 | 3300042590 | Bacteria | 17529 |
| 70 | Ga0123353_10064047 | 3300010167 | Unclassified | 5898 |
| 71 | Ga0466708_232584 | 3300042652 | Bacteria | 45121 |
| 72 | Ga0466727_060743 | 3300042655 | Bacteria | 1559 |
| 73 | Ga0466719_033626 | 3300042606 | Bacteria | 45932 |
| 74 | Ga0466719_362154 | 3300042606 | Bacteria | 1609 |
| 75 | Ga0466722_242039 | 3300042609 | Bacteria | 5291 |
| 76 | Ga0466698_285775 | 3300042610 | Bacteria | 10925 |
| 77 | Ga0068302_10069011 | 3300005071 | Bacteria | 18309 |
| 78 | Ga0466705_347037 | 3300042612 | Bacteria | 74854 |
| 79 | Ga0466705_364057 | 3300042612 | Bacteria | 12329 |
| 80 | Ga0466705_365945 | 3300042612 | Bacteria | 22355 |
| 81 | Ga0466729_085478 | 3300042621 | Bacteria | 2915 |
| 82 | Ga0466693_072780 | 3300042592 | Bacteria | 4868 |
| 83 | Ga0123353_10053599 | 3300010167 | Bacteria | 6447 |
| 84 | Ga0466729_280572 | 3300042621 | Bacteria | 9682 |
| 85 | Ga0466704_265265 | 3300042643 | Unclassified | 18937 |
| 86 | Ga0466704_501814 | 3300042643 | Bacteria | 6651 |
| 87 | Ga0466704_539016 | 3300042643 | Bacteria | 1725 |
| 88 | Ga0466708_003388 | 3300042652 | Bacteria | 6226 |
| 89 | Ga0466708_038762 | 3300042652 | Unclassified | 18421 |
| 90 | Ga0466707_021404 | 3300042601 | Bacteria | 18851 |
| 91 | Ga0466707_052972 | 3300042601 | Bacteria | 8312 |
| 92 | Ga0466707_202273 | 3300042601 | Bacteria | 7423 |
| 93 | Ga0466722_067862 | 3300042609 | Bacteria | 11579 |
| 94 | Ga0123357_10000075 | 3300009784 | Bacteria | 78678 |
| 95 | Ga0466705_207497 | 3300042612 | Bacteria | 5577 |
| 96 | Ga0466705_341200 | 3300042612 | Bacteria | 2151 |
| 97 | Ga0466726_081904 | 3300042619 | Bacteria | 8838 |
| 98 | Ga0466690_105585 | 3300042590 | Bacteria | 7136 |
| 99 | Ga0466692_086103 | 3300042591 | Bacteria | 3891 |
| 100 | Ga0466692_109901 | 3300042591 | Bacteria | 2555 |
| 101 | Ga0123356_10000812 | 3300010049 | Bacteria | 34713 |
| 102 | Ga0123356_10011598 | 3300010049 | Bacteria | 8586 |
| 103 | Ga0466706_201475 | 3300042599 | Bacteria | 26921 |
| 104 | Ga0466707_415801 | 3300042601 | Bacteria | 4798 |
| 105 | Ga0466714_089860 | 3300042603 | Bacteria | 8873 |
| 106 | Ga0466716_200610 | 3300042605 | Bacteria | 18818 |
| 107 | Ga0466722_147052 | 3300042609 | Bacteria | 82065 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042643 | Ga0466704_131079 | Ga0466704_131079_471_1676 | 376 |
| 2 | 3300042614 | Ga0466712_207210 | Ga0466712_207210_192_1385 | 378 |
| 3 | 3300042643 | Ga0466704_303086 | Ga0466704_303086_15274_16461 | 378 |
| 4 | 3300042599 | Ga0466706_201475 | Ga0466706_201475_21731_22930 | 380 |
| 5 | 3300010049 | Ga0123356_10000812 | Ga0123356_1000081217 | 382 |
| 6 | 3300010167 | Ga0123353_10023631 | Ga0123353_100236316 | 382 |
| 7 | 3300042602 | Ga0466713_026659 | Ga0466713_026659_8586_9791 | 382 |
| 8 | 3300042612 | Ga0466705_341200 | Ga0466705_341200_869_2065 | 382 |
| 9 | 3300042620 | Ga0466728_325977 | Ga0466728_325977_20_1216 | 382 |
| 10 | 3300042652 | Ga0466708_239858 | Ga0466708_239858_6020_7210 | 382 |
| 11 | 3300042619 | Ga0466726_009660 | Ga0466726_009660_36962_38167 | 383 |
| 12 | 3300042619 | Ga0466726_311036 | Ga0466726_311036_4429_5634 | 383 |
| 13 | 3300042648 | Ga0466709_123265 | Ga0466709_123265_11637_12833 | 383 |
| 14 | 3300042591 | Ga0466692_109901 | Ga0466692_109901_423_1625 | 384 |
| 15 | 3300042616 | Ga0466715_268888 | Ga0466715_268888_3477_4673 | 384 |
| 16 | 3300042591 | Ga0466692_105616 | Ga0466692_105616_67_1251 | 385 |
| 17 | 3300042606 | Ga0466719_187458 | Ga0466719_187458_572_1783 | 385 |
| 18 | 3300042616 | Ga0466715_033176 | Ga0466715_033176_28623_29819 | 385 |
| 19 | 3300042616 | Ga0466715_309594 | Ga0466715_309594_11871_13082 | 385 |
| 20 | 3300042619 | Ga0466726_062186 | Ga0466726_062186_23820_25019 | 385 |
| 21 | 3300009784 | Ga0123357_10033979 | Ga0123357_100339795 | 386 |
| 22 | 3300042601 | Ga0466707_052972 | Ga0466707_052972_5284_6489 | 387 |
| 23 | 3300042603 | Ga0466714_089860 | Ga0466714_089860_6865_8085 | 387 |
| 24 | 3300042608 | Ga0466721_124028 | Ga0466721_124028_1062_2279 | 387 |
| 25 | 3300042621 | Ga0466729_085478 | Ga0466729_085478_280_1500 | 387 |
| 26 | 3300002462 | JGI24702J35022_10001482 | JGI24702J35022_1000148213 | 388 |
| 27 | 3300038395 | Ga0415639_068793 | Ga0415639_068793_1480_2703 | 388 |
| 28 | 3300042601 | Ga0466707_420654 | Ga0466707_420654_1992_3206 | 388 |
| 29 | 3300042648 | Ga0466709_234403 | Ga0466709_234403_2259_3464 | 388 |
| 30 | 3300042603 | Ga0466714_115877 | Ga0466714_115877_35866_37074 | 389 |
| 31 | 3300042609 | Ga0466722_067862 | Ga0466722_067862_7328_8536 | 389 |
| 32 | 3300009784 | Ga0123357_10000075 | Ga0123357_1000007512 | 390 |
| 33 | 3300042592 | Ga0466693_072780 | Ga0466693_072780_2193_3401 | 390 |
| 34 | 3300042601 | Ga0466707_235700 | Ga0466707_235700_5327_6541 | 390 |
| 35 | 3300010167 | Ga0123353_10001395 | Ga0123353_100013959 | 392 |
| 36 | 3300010167 | Ga0123353_10365035 | Ga0123353_103650352 | 392 |
| 37 | 3300042636 | Ga0466703_085209 | Ga0466703_085209_6270_7490 | 392 |
| 38 | 3300042602 | Ga0466713_119761 | Ga0466713_119761_34237_35433 | 393 |
| 39 | 3300042619 | Ga0466726_131768 | Ga0466726_131768_60_1343 | 393 |
| 40 | 3300042590 | Ga0466690_105585 | Ga0466690_105585_2508_3731 | 394 |
| 41 | 3300042593 | Ga0466691_136946 | Ga0466691_136946_3329_4552 | 394 |
| 42 | 3300042618 | Ga0466723_055979 | Ga0466723_055979_7997_9220 | 394 |
| 43 | 3300010167 | Ga0123353_10197280 | Ga0123353_101972803 | 395 |
| 44 | 3300010167 | Ga0123353_10570308 | Ga0123353_105703082 | 395 |
| 45 | 3300042606 | Ga0466719_477750 | Ga0466719_477750_83_1495 | 395 |
| 46 | 3300010167 | Ga0123353_10053599 | Ga0123353_100535994 | 396 |
| 47 | 3300042601 | Ga0466707_202273 | Ga0466707_202273_1998_3206 | 396 |
| 48 | iso_pr_bacteria | 2820558799 | 2820559432 | 397 |
| 49 | 3300042591 | Ga0466692_041675 | Ga0466692_041675_5166_6362 | 398 |
| 50 | 3300042591 | Ga0466692_073077 | Ga0466692_073077_5984_7180 | 398 |
| 51 | 3300042619 | Ga0466726_363899 | Ga0466726_363899_426_1622 | 398 |
| 52 | 3300042643 | Ga0466704_414317 | Ga0466704_414317_125_1345 | 398 |
| 53 | iso_pr_bacteria | 2820639607 | 2820640677 | 398 |
| 54 | 2225789004 | 2227510758 | 2228004861 | 399 |
| 55 | 3300042616 | Ga0466715_093166 | Ga0466715_093166_4092_5291 | 399 |
| 56 | 3300042619 | Ga0466726_081904 | Ga0466726_081904_2380_3579 | 399 |
| 57 | 3300042596 | Ga0466696_200434 | Ga0466696_200434_3491_4717 | 400 |
| 58 | 3300042615 | Ga0466711_144020 | Ga0466711_144020_5192_6394 | 400 |
| 59 | 3300042615 | Ga0466711_357567 | Ga0466711_357567_442_1644 | 400 |
| 60 | 3300042621 | Ga0466729_280572 | Ga0466729_280572_6284_7486 | 400 |
| 61 | 3300042659 | Ga0466733_211789 | Ga0466733_211789_490_1692 | 400 |
| 62 | 3300000062 | IMNBL1DRAFT_c0004373 | IMNBL1DRAFT_00043736 | 401 |
| 63 | 3300042590 | Ga0466690_172675 | Ga0466690_172675_6110_7315 | 401 |
| 64 | 3300042601 | Ga0466707_258747 | Ga0466707_258747_327_1532 | 401 |
| 65 | 3300042612 | Ga0466705_364057 | Ga0466705_364057_3332_4537 | 401 |
| 66 | 3300042621 | Ga0466729_173849 | Ga0466729_173849_7036_8325 | 401 |
| 67 | 3300042643 | Ga0466704_265265 | Ga0466704_265265_546_1799 | 401 |
| 68 | 3300042652 | Ga0466708_369737 | Ga0466708_369737_8742_9947 | 401 |
| 69 | 3300042655 | Ga0466727_060743 | Ga0466727_060743_103_1308 | 401 |
| 70 | iso_pr_bacteria | 2820420508 | 2820421466 | 401 |
| 71 | iso_pr_bacteria | 2820573558 | 2820575934 | 401 |
| 72 | 3300009784 | Ga0123357_10027097 | Ga0123357_100270973 | 402 |
| 73 | 3300010049 | Ga0123356_10011598 | Ga0123356_100115986 | 402 |
| 74 | 3300010049 | Ga0123356_10125475 | Ga0123356_101254753 | 402 |
| 75 | 3300042590 | Ga0466690_099034 | Ga0466690_099034_21619_22827 | 402 |
| 76 | 3300042612 | Ga0466705_347037 | Ga0466705_347037_64029_65237 | 402 |
| 77 | 3300042652 | Ga0466708_108357 | Ga0466708_108357_9855_11063 | 402 |
| 78 | iso_pr_bacteria | 2820259584 | 2820260551 | 402 |
| 79 | 3300042601 | Ga0466707_386827 | Ga0466707_386827_309_1520 | 403 |
| 80 | 3300042601 | Ga0466707_415801 | Ga0466707_415801_3522_4733 | 403 |
| 81 | 3300042655 | Ga0466727_244619 | Ga0466727_244619_109_1320 | 403 |
| 82 | 3300042623 | Ga0466734_068039 | Ga0466734_068039_6351_7565 | 404 |
| 83 | 3300042652 | Ga0466708_147006 | Ga0466708_147006_4518_5750 | 404 |
| 84 | 3300042609 | Ga0466722_242039 | Ga0466722_242039_1727_2944 | 405 |
| 85 | 3300042619 | Ga0466726_022047 | Ga0466726_022047_1608_2825 | 405 |
| 86 | iso_pr_bacteria | 2820823448 | 2820824511 | 405 |
| 87 | 3300042601 | Ga0466707_367735 | Ga0466707_367735_1176_2396 | 406 |
| 88 | 3300042654 | Ga0466725_351828 | Ga0466725_351828_2726_3946 | 406 |
| 89 | 3300042606 | Ga0466719_306042 | Ga0466719_306042_3928_5151 | 407 |
| 90 | 3300042601 | Ga0466707_021404 | Ga0466707_021404_4148_5374 | 408 |
| 91 | 3300042612 | Ga0466705_365945 | Ga0466705_365945_12871_14097 | 408 |
| 92 | 3300010167 | Ga0123353_10064047 | Ga0123353_100640474 | 409 |
| 93 | iso_pr_bacteria | 3002025161 | 3002025495 | 409 |
| 94 | 3300042618 | Ga0466723_250388 | Ga0466723_250388_5368_6600 | 410 |
| 95 | 3300042652 | Ga0466708_003388 | Ga0466708_003388_2687_3919 | 410 |
| 96 | 3300042606 | Ga0466719_362154 | Ga0466719_362154_90_1328 | 412 |
| 97 | iso_pr_bacteria | 3002030550 | 3002030918 | 412 |
| 98 | 3300042596 | Ga0466696_488333 | Ga0466696_488333_3792_5033 | 413 |
| 99 | 3300042620 | Ga0466728_444564 | Ga0466728_444564_653_1894 | 413 |
| 100 | 3300005071 | Ga0068302_10069011 | Ga0068302_100690118 | 414 |
| 101 | iso_pr_bacteria | 2820223845 | 2820225606 | 414 |
| 102 | iso_pr_bacteria | 2833030225 | 2833030490 | 414 |
| 103 | iso_pr_bacteria | 2833033875 | 2833034142 | 414 |
| 104 | iso_pr_bacteria | 2833037493 | 2833037758 | 414 |
| 105 | iso_pr_bacteria | 2833042786 | 2833043051 | 414 |
| 106 | iso_pr_bacteria | 2833047020 | 2833047284 | 414 |
| 107 | iso_pr_bacteria | 2833050843 | 2833051107 | 414 |
| 108 | iso_pr_bacteria | 3002007112 | 3002007476 | 414 |
| 109 | 3300010167 | Ga0123353_10350449 | Ga0123353_103504493 | 415 |
| 110 | 3300042643 | Ga0466704_539016 | Ga0466704_539016_92_1339 | 415 |
| 111 | iso_pr_bacteria | 2511231112 | 2511677447 | 415 |
| 112 | iso_pr_bacteria | 2833033236 | 2833033508 | 415 |
| 113 | iso_pr_bacteria | 2833034481 | 2833034745 | 415 |
| 114 | iso_pr_bacteria | 2833043393 | 2833043657 | 415 |
| 115 | iso_pr_bacteria | 2833044002 | 2833044266 | 415 |
| 116 | iso_pr_bacteria | 2833051446 | 2833051712 | 415 |
| 117 | 3300042620 | Ga0466728_018896 | Ga0466728_018896_7521_8771 | 416 |
| 118 | 3300042643 | Ga0466704_501814 | Ga0466704_501814_1822_3117 | 416 |
| 119 | 3300042652 | Ga0466708_038762 | Ga0466708_038762_2549_3805 | 418 |
| 120 | 3300042605 | Ga0466716_200610 | Ga0466716_200610_419_1720 | 419 |
| 121 | 3300042623 | Ga0466734_019915 | Ga0466734_019915_236_1618 | 419 |
| 122 | 3300042606 | Ga0466719_033626 | Ga0466719_033626_26340_27650 | 422 |
| 123 | 3300042621 | Ga0466729_012998 | Ga0466729_012998_367_1710 | 422 |
| 124 | 3300042612 | Ga0466705_207497 | Ga0466705_207497_2756_4027 | 423 |
| 125 | 3300042643 | Ga0466704_585182 | Ga0466704_585182_3924_5240 | 423 |
| 126 | 3300042610 | Ga0466698_285775 | Ga0466698_285775_2993_4267 | 424 |
| 127 | 3300042591 | Ga0466692_086103 | Ga0466692_086103_2144_3424 | 426 |
| 128 | 3300042652 | Ga0466708_232584 | Ga0466708_232584_31251_32564 | 437 |
| 129 | 3300042609 | Ga0466722_147052 | Ga0466722_147052_34146_35522 | 458 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00180 | Iso_dh | Isocitrate/isopropylmalate dehydrogenase | 71 | 444 | 0.87 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.