Protein Family IF06831

Metagenome Isolate
129 Members
60 Samples
107 Scaffolds
401.03 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_147052|Ga0466722_147052_34146_35522
Length
458 aa
Sequence
MAERLPSLCSFPILTQPLNLLPWFIESFNLRRAPPLSNFALEKRAKTRYDEAIANQSRRCPMAKIPMKTPLVEMDGDEMTRILWAMIKETLLTPFIELKTEYYDLGLPYRDQTQDQVTHDAAEAIKKYGVGVKCATITPNAQRLEEYKLKKVWPSPNATIRAALDGTVFRAPIVIKGIDPYIKNWTAPITIARHAYGDIYKGSELLVKAPAKAEIRVEYEDGQTETTPVHDFKGPGIVQGIHNTDSSIRSFAKACFNYAIDTRQTLWFATKDTISKTYDHHFKDIFAELFESDYRAKFEALGIEYFYTLIDDAVARVVRSNGGFIWACKNYDGDVMSDMVATVFGSLSMMTSVLVSPEGNYEYEAAHGTITRHYYQHLQGKQTSSNPVATIMAWTGALAKRGELDGSPELTAFAQKLERVTIETIEGGVMTGDLASLFKGEAKTVSAQAFLIAIAAKL

📊 Sample Types

Isolate 17.1%
Metagenome 83.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 23.3%
Termitidae 21.7%
Cryptocercidae 20.0%
Unclassified 15.0%
Termopsidae 5.0%
Rhinotermitidae 5.0%
Passalidae 3.3%
Blaberidae 3.3%
Hodotermitidae 1.7%
Pseudophyllodromiidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 2833034481 Blattabacterium punctulatus CPUwf Isolate Cryptocercidae
5 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2833030225 Blattabacterium punctulatus CPUmp Isolate Cryptocercidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2833043393 Blattabacterium clevelandi CCLhc Isolate Cryptocercidae
24 2820558799 Unclassified Firmicutes Emb289P3bin74 Isolate Unclassified
25 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
26 3002025161 Blattabacterium cuenoti MEDIASdel Isolate Pseudophyllodromiidae
27 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 2833033236 Blattabacterium sp. CKYod Isolate Cryptocercidae
32 2833047020 Blattabacterium punctulatus CPUbt Isolate Cryptocercidae
33 2833050843 Blattabacterium punctulatus CPUmc Isolate Cryptocercidae
34 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 2833037493 Blattabacterium punctulatus CPUsv Isolate Cryptocercidae
42 2833042786 Blattabacterium punctulatus CPUsm Isolate Cryptocercidae
43 2833051446 Blattabacterium punctulatus CPUml Isolate Cryptocercidae
44 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2833033875 Blattabacterium punctulatus CPUpc Isolate Cryptocercidae
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
51 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
52 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
53 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
54 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
55 2833044002 Blattabacterium punctulatus CPUbr Isolate Cryptocercidae
56 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
57 2511231112 Blattabacterium punctulatus Cpu Isolate Cryptocercidae
58 3002030550 Blattabacterium cuenoti NEOLAXmac Isolate Blaberidae
59 3002007112 Blattabacterium cuenoti CYRTOsp Isolate Blaberidae
60 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_033176 3300042616 Bacteria 30145
2 Ga0466726_131768 3300042619 Bacteria 1634
3 Ga0466690_099034 3300042590 Unclassified 23711
4 Ga0466692_073077 3300042591 Bacteria 10297
5 Ga0466692_105616 3300042591 Bacteria 2670
6 Ga0123356_10125475 3300010049 Bacteria 2505
7 Ga0123353_10001395 3300010167 Bacteria 29586
8 Ga0466704_303086 3300042643 Bacteria 20056
9 Ga0466704_414317 3300042643 Bacteria 1776
10 Ga0466709_123265 3300042648 Bacteria 21857
11 Ga0466707_386827 3300042601 Bacteria 2451
12 Ga0466711_357567 3300042615 Bacteria 2292
13 Ga0466729_012998 3300042621 Bacteria 18866
14 Ga0466692_041675 3300042591 Bacteria 9981
15 Ga0466696_200434 3300042596 Bacteria 8523
16 Ga0466696_488333 3300042596 Bacteria 5475
17 Ga0123353_10365035 3300010167 Bacteria 2168
18 Ga0466734_019915 3300042623 Bacteria 2711
19 Ga0466704_131079 3300042643 Bacteria 3172
20 Ga0466704_585182 3300042643 Bacteria 5595
21 Ga0466708_369737 3300042652 Bacteria 12354
22 Ga0466707_258747 3300042601 Bacteria 2344
23 Ga0466714_115877 3300042603 Bacteria 37960
24 Ga0466719_477750 3300042606 Bacteria 4217
25 Ga0466726_009660 3300042619 Bacteria 122985
26 Ga0466726_062186 3300042619 Bacteria 42153
27 Ga0466726_363899 3300042619 Bacteria 1960
28 Ga0415639_068793 3300038395 Bacteria 2742
29 Ga0466691_136946 3300042593 Bacteria 8070
30 Ga0123357_10027097 3300009784 Bacteria 7742
31 Ga0123353_10023631 3300010167 Bacteria 9312
32 Ga0466703_085209 3300042636 Bacteria 27314
33 Ga0466709_234403 3300042648 Bacteria 9283
34 Ga0466708_108357 3300042652 Bacteria 112687
35 Ga0466719_187458 3300042606 Bacteria 8044
36 Ga0466721_124028 3300042608 Bacteria 2700
37 Ga0466712_207210 3300042614 Bacteria 1430
38 Ga0466715_093166 3300042616 Bacteria 65432
39 Ga0466726_311036 3300042619 Bacteria 5815
40 Ga0466728_018896 3300042620 Bacteria 10766
41 Ga0466729_173849 3300042621 Bacteria 8735
42 Ga0123357_10033979 3300009784 Bacteria 6931
43 Ga0123353_10570308 3300010167 Bacteria 1627
44 Ga0466734_068039 3300042623 Bacteria 9474
45 Ga0466708_147006 3300042652 Unclassified 8126
46 Ga0466725_351828 3300042654 Bacteria 5138
47 Ga0466727_244619 3300042655 Bacteria 3526
48 Ga0466707_235700 3300042601 Bacteria 6685
49 Ga0466707_420654 3300042601 Bacteria 29649
50 Ga0466719_306042 3300042606 Bacteria 7496
51 2227510758 2225789004 Bacteria 18314
52 IMNBL1DRAFT_c0004373 3300000062 Bacteria 8525
53 JGI24702J35022_10001482 3300002462 Bacteria 14567
54 Ga0466711_144020 3300042615 Bacteria 9759
55 Ga0466715_268888 3300042616 Bacteria 5916
56 Ga0466715_309594 3300042616 Bacteria 109113
57 Ga0466723_250388 3300042618 Bacteria 22848
58 Ga0466726_022047 3300042619 Bacteria 5983
59 Ga0123353_10197280 3300010167 Bacteria 3171
60 Ga0123353_10350449 3300010167 Bacteria 2225
61 Ga0466708_239858 3300042652 Bacteria 26667
62 Ga0466707_367735 3300042601 Bacteria 3751
63 Ga0466713_026659 3300042602 Bacteria 12305
64 Ga0466713_119761 3300042602 Bacteria 47658
65 Ga0466733_211789 3300042659 Bacteria 2414
66 Ga0466723_055979 3300042618 Bacteria 20741
67 Ga0466728_325977 3300042620 Bacteria 1687
68 Ga0466728_444564 3300042620 Bacteria 3404
69 Ga0466690_172675 3300042590 Bacteria 17529
70 Ga0123353_10064047 3300010167 Unclassified 5898
71 Ga0466708_232584 3300042652 Bacteria 45121
72 Ga0466727_060743 3300042655 Bacteria 1559
73 Ga0466719_033626 3300042606 Bacteria 45932
74 Ga0466719_362154 3300042606 Bacteria 1609
75 Ga0466722_242039 3300042609 Bacteria 5291
76 Ga0466698_285775 3300042610 Bacteria 10925
77 Ga0068302_10069011 3300005071 Bacteria 18309
78 Ga0466705_347037 3300042612 Bacteria 74854
79 Ga0466705_364057 3300042612 Bacteria 12329
80 Ga0466705_365945 3300042612 Bacteria 22355
81 Ga0466729_085478 3300042621 Bacteria 2915
82 Ga0466693_072780 3300042592 Bacteria 4868
83 Ga0123353_10053599 3300010167 Bacteria 6447
84 Ga0466729_280572 3300042621 Bacteria 9682
85 Ga0466704_265265 3300042643 Unclassified 18937
86 Ga0466704_501814 3300042643 Bacteria 6651
87 Ga0466704_539016 3300042643 Bacteria 1725
88 Ga0466708_003388 3300042652 Bacteria 6226
89 Ga0466708_038762 3300042652 Unclassified 18421
90 Ga0466707_021404 3300042601 Bacteria 18851
91 Ga0466707_052972 3300042601 Bacteria 8312
92 Ga0466707_202273 3300042601 Bacteria 7423
93 Ga0466722_067862 3300042609 Bacteria 11579
94 Ga0123357_10000075 3300009784 Bacteria 78678
95 Ga0466705_207497 3300042612 Bacteria 5577
96 Ga0466705_341200 3300042612 Bacteria 2151
97 Ga0466726_081904 3300042619 Bacteria 8838
98 Ga0466690_105585 3300042590 Bacteria 7136
99 Ga0466692_086103 3300042591 Bacteria 3891
100 Ga0466692_109901 3300042591 Bacteria 2555
101 Ga0123356_10000812 3300010049 Bacteria 34713
102 Ga0123356_10011598 3300010049 Bacteria 8586
103 Ga0466706_201475 3300042599 Bacteria 26921
104 Ga0466707_415801 3300042601 Bacteria 4798
105 Ga0466714_089860 3300042603 Bacteria 8873
106 Ga0466716_200610 3300042605 Bacteria 18818
107 Ga0466722_147052 3300042609 Bacteria 82065

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_131079 Ga0466704_131079_471_1676 376
2 3300042614 Ga0466712_207210 Ga0466712_207210_192_1385 378
3 3300042643 Ga0466704_303086 Ga0466704_303086_15274_16461 378
4 3300042599 Ga0466706_201475 Ga0466706_201475_21731_22930 380
5 3300010049 Ga0123356_10000812 Ga0123356_1000081217 382
6 3300010167 Ga0123353_10023631 Ga0123353_100236316 382
7 3300042602 Ga0466713_026659 Ga0466713_026659_8586_9791 382
8 3300042612 Ga0466705_341200 Ga0466705_341200_869_2065 382
9 3300042620 Ga0466728_325977 Ga0466728_325977_20_1216 382
10 3300042652 Ga0466708_239858 Ga0466708_239858_6020_7210 382
11 3300042619 Ga0466726_009660 Ga0466726_009660_36962_38167 383
12 3300042619 Ga0466726_311036 Ga0466726_311036_4429_5634 383
13 3300042648 Ga0466709_123265 Ga0466709_123265_11637_12833 383
14 3300042591 Ga0466692_109901 Ga0466692_109901_423_1625 384
15 3300042616 Ga0466715_268888 Ga0466715_268888_3477_4673 384
16 3300042591 Ga0466692_105616 Ga0466692_105616_67_1251 385
17 3300042606 Ga0466719_187458 Ga0466719_187458_572_1783 385
18 3300042616 Ga0466715_033176 Ga0466715_033176_28623_29819 385
19 3300042616 Ga0466715_309594 Ga0466715_309594_11871_13082 385
20 3300042619 Ga0466726_062186 Ga0466726_062186_23820_25019 385
21 3300009784 Ga0123357_10033979 Ga0123357_100339795 386
22 3300042601 Ga0466707_052972 Ga0466707_052972_5284_6489 387
23 3300042603 Ga0466714_089860 Ga0466714_089860_6865_8085 387
24 3300042608 Ga0466721_124028 Ga0466721_124028_1062_2279 387
25 3300042621 Ga0466729_085478 Ga0466729_085478_280_1500 387
26 3300002462 JGI24702J35022_10001482 JGI24702J35022_1000148213 388
27 3300038395 Ga0415639_068793 Ga0415639_068793_1480_2703 388
28 3300042601 Ga0466707_420654 Ga0466707_420654_1992_3206 388
29 3300042648 Ga0466709_234403 Ga0466709_234403_2259_3464 388
30 3300042603 Ga0466714_115877 Ga0466714_115877_35866_37074 389
31 3300042609 Ga0466722_067862 Ga0466722_067862_7328_8536 389
32 3300009784 Ga0123357_10000075 Ga0123357_1000007512 390
33 3300042592 Ga0466693_072780 Ga0466693_072780_2193_3401 390
34 3300042601 Ga0466707_235700 Ga0466707_235700_5327_6541 390
35 3300010167 Ga0123353_10001395 Ga0123353_100013959 392
36 3300010167 Ga0123353_10365035 Ga0123353_103650352 392
37 3300042636 Ga0466703_085209 Ga0466703_085209_6270_7490 392
38 3300042602 Ga0466713_119761 Ga0466713_119761_34237_35433 393
39 3300042619 Ga0466726_131768 Ga0466726_131768_60_1343 393
40 3300042590 Ga0466690_105585 Ga0466690_105585_2508_3731 394
41 3300042593 Ga0466691_136946 Ga0466691_136946_3329_4552 394
42 3300042618 Ga0466723_055979 Ga0466723_055979_7997_9220 394
43 3300010167 Ga0123353_10197280 Ga0123353_101972803 395
44 3300010167 Ga0123353_10570308 Ga0123353_105703082 395
45 3300042606 Ga0466719_477750 Ga0466719_477750_83_1495 395
46 3300010167 Ga0123353_10053599 Ga0123353_100535994 396
47 3300042601 Ga0466707_202273 Ga0466707_202273_1998_3206 396
48 iso_pr_bacteria 2820558799 2820559432 397
49 3300042591 Ga0466692_041675 Ga0466692_041675_5166_6362 398
50 3300042591 Ga0466692_073077 Ga0466692_073077_5984_7180 398
51 3300042619 Ga0466726_363899 Ga0466726_363899_426_1622 398
52 3300042643 Ga0466704_414317 Ga0466704_414317_125_1345 398
53 iso_pr_bacteria 2820639607 2820640677 398
54 2225789004 2227510758 2228004861 399
55 3300042616 Ga0466715_093166 Ga0466715_093166_4092_5291 399
56 3300042619 Ga0466726_081904 Ga0466726_081904_2380_3579 399
57 3300042596 Ga0466696_200434 Ga0466696_200434_3491_4717 400
58 3300042615 Ga0466711_144020 Ga0466711_144020_5192_6394 400
59 3300042615 Ga0466711_357567 Ga0466711_357567_442_1644 400
60 3300042621 Ga0466729_280572 Ga0466729_280572_6284_7486 400
61 3300042659 Ga0466733_211789 Ga0466733_211789_490_1692 400
62 3300000062 IMNBL1DRAFT_c0004373 IMNBL1DRAFT_00043736 401
63 3300042590 Ga0466690_172675 Ga0466690_172675_6110_7315 401
64 3300042601 Ga0466707_258747 Ga0466707_258747_327_1532 401
65 3300042612 Ga0466705_364057 Ga0466705_364057_3332_4537 401
66 3300042621 Ga0466729_173849 Ga0466729_173849_7036_8325 401
67 3300042643 Ga0466704_265265 Ga0466704_265265_546_1799 401
68 3300042652 Ga0466708_369737 Ga0466708_369737_8742_9947 401
69 3300042655 Ga0466727_060743 Ga0466727_060743_103_1308 401
70 iso_pr_bacteria 2820420508 2820421466 401
71 iso_pr_bacteria 2820573558 2820575934 401
72 3300009784 Ga0123357_10027097 Ga0123357_100270973 402
73 3300010049 Ga0123356_10011598 Ga0123356_100115986 402
74 3300010049 Ga0123356_10125475 Ga0123356_101254753 402
75 3300042590 Ga0466690_099034 Ga0466690_099034_21619_22827 402
76 3300042612 Ga0466705_347037 Ga0466705_347037_64029_65237 402
77 3300042652 Ga0466708_108357 Ga0466708_108357_9855_11063 402
78 iso_pr_bacteria 2820259584 2820260551 402
79 3300042601 Ga0466707_386827 Ga0466707_386827_309_1520 403
80 3300042601 Ga0466707_415801 Ga0466707_415801_3522_4733 403
81 3300042655 Ga0466727_244619 Ga0466727_244619_109_1320 403
82 3300042623 Ga0466734_068039 Ga0466734_068039_6351_7565 404
83 3300042652 Ga0466708_147006 Ga0466708_147006_4518_5750 404
84 3300042609 Ga0466722_242039 Ga0466722_242039_1727_2944 405
85 3300042619 Ga0466726_022047 Ga0466726_022047_1608_2825 405
86 iso_pr_bacteria 2820823448 2820824511 405
87 3300042601 Ga0466707_367735 Ga0466707_367735_1176_2396 406
88 3300042654 Ga0466725_351828 Ga0466725_351828_2726_3946 406
89 3300042606 Ga0466719_306042 Ga0466719_306042_3928_5151 407
90 3300042601 Ga0466707_021404 Ga0466707_021404_4148_5374 408
91 3300042612 Ga0466705_365945 Ga0466705_365945_12871_14097 408
92 3300010167 Ga0123353_10064047 Ga0123353_100640474 409
93 iso_pr_bacteria 3002025161 3002025495 409
94 3300042618 Ga0466723_250388 Ga0466723_250388_5368_6600 410
95 3300042652 Ga0466708_003388 Ga0466708_003388_2687_3919 410
96 3300042606 Ga0466719_362154 Ga0466719_362154_90_1328 412
97 iso_pr_bacteria 3002030550 3002030918 412
98 3300042596 Ga0466696_488333 Ga0466696_488333_3792_5033 413
99 3300042620 Ga0466728_444564 Ga0466728_444564_653_1894 413
100 3300005071 Ga0068302_10069011 Ga0068302_100690118 414
101 iso_pr_bacteria 2820223845 2820225606 414
102 iso_pr_bacteria 2833030225 2833030490 414
103 iso_pr_bacteria 2833033875 2833034142 414
104 iso_pr_bacteria 2833037493 2833037758 414
105 iso_pr_bacteria 2833042786 2833043051 414
106 iso_pr_bacteria 2833047020 2833047284 414
107 iso_pr_bacteria 2833050843 2833051107 414
108 iso_pr_bacteria 3002007112 3002007476 414
109 3300010167 Ga0123353_10350449 Ga0123353_103504493 415
110 3300042643 Ga0466704_539016 Ga0466704_539016_92_1339 415
111 iso_pr_bacteria 2511231112 2511677447 415
112 iso_pr_bacteria 2833033236 2833033508 415
113 iso_pr_bacteria 2833034481 2833034745 415
114 iso_pr_bacteria 2833043393 2833043657 415
115 iso_pr_bacteria 2833044002 2833044266 415
116 iso_pr_bacteria 2833051446 2833051712 415
117 3300042620 Ga0466728_018896 Ga0466728_018896_7521_8771 416
118 3300042643 Ga0466704_501814 Ga0466704_501814_1822_3117 416
119 3300042652 Ga0466708_038762 Ga0466708_038762_2549_3805 418
120 3300042605 Ga0466716_200610 Ga0466716_200610_419_1720 419
121 3300042623 Ga0466734_019915 Ga0466734_019915_236_1618 419
122 3300042606 Ga0466719_033626 Ga0466719_033626_26340_27650 422
123 3300042621 Ga0466729_012998 Ga0466729_012998_367_1710 422
124 3300042612 Ga0466705_207497 Ga0466705_207497_2756_4027 423
125 3300042643 Ga0466704_585182 Ga0466704_585182_3924_5240 423
126 3300042610 Ga0466698_285775 Ga0466698_285775_2993_4267 424
127 3300042591 Ga0466692_086103 Ga0466692_086103_2144_3424 426
128 3300042652 Ga0466708_232584 Ga0466708_232584_31251_32564 437
129 3300042609 Ga0466722_147052 Ga0466722_147052_34146_35522 458

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 71 444 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.