Protein Family IF06829

Metagenome Isolate
209 Members
64 Samples
191 Scaffolds
378.93 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_141283|Ga0466722_141283_2379_3692
Length
437 aa
Sequence
MRSPAFFNHCLHIQNTFVIDTAFLRIKVGNIIEREGRRGVNIDIFNTFAPEISRIIKAASRMKKVFVSGCYDMLHSGHVAFFEEAASHGELYVGIGSDRTICELKARKPVNTDAERLYMVKALRAVRDAWINRGGGVIDFLEEIHALKPDIFFVNSDGHSPVKEQLCRDLGIEYIVSKRIPHGALPVRSSTALREECRIPYRIDLAGGWLDQPFVSKHHAGAVLTVSIEPDYEFNDRSGMSTSSRKKAIELWHTDIPEGDREKQAKTLFCFENPPGTKYVSGSQDSLGIVYPGLNRLYYQGGYWPETIESVNDPELLQWIEKRLWLIPLFPRVATYDVLADTRVTPEEVARLSRAADDCWQAIRSKDVTAWGKAHSASFEAQIAMFPNMVSPEILRVLEKYKPNVLGWKLSGAGGGGYFVFVSEQPIARAIQIRIRR

📊 Sample Types

Isolate 8.6%
Metagenome 91.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.6%
Kalotermitidae 22.2%
Blattidae 15.9%
Unclassified 11.1%
Rhinotermitidae 6.3%
Termopsidae 6.3%
Passalidae 3.2%
Hydrophilidae 3.2%
Hodotermitidae 1.6%
Tenebrionidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 201
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
2 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
10 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
25 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
26 3004677695 Bacteroides sp. 214 Isolate Blattidae
27 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
30 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
31 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
32 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
33 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
34 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
35 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
36 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
37 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
38 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
39 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
40 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
41 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
42 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
43 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
44 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
45 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
49 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
50 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
56 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
57 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
58 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
59 3004672520 Bacteroides sp. 51 Isolate Blattidae
60 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
61 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
62 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
63 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
64 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_041174 3300042659 Bacteria 1672
2 Ga0466733_129506 3300042659 Bacteria 1981
3 Ga0466733_199302 3300042659 Bacteria 3738
4 JGI24702J35022_10001384 3300002462 Bacteria 15078
5 Ga0466711_084854 3300042615 Bacteria 10720
6 Ga0466711_495588 3300042615 Bacteria 3351
7 Ga0466723_086325 3300042618 Bacteria 5162
8 Ga0466728_425802 3300042620 Bacteria 19622
9 Ga0466691_064302 3300042593 Bacteria 3316
10 Ga0466696_361792 3300042596 Bacteria 9269
11 Ga0466701_015516 3300042598 Bacteria 5093
12 Ga0466703_039597 3300042636 Bacteria 3878
13 Ga0466708_146402 3300042652 Bacteria 13887
14 Ga0466725_106783 3300042654 Bacteria 2483
15 Ga0466725_119640 3300042654 Bacteria 6872
16 Ga0466727_034358 3300042655 Bacteria 33712
17 Ga0466727_107621 3300042655 Bacteria 9293
18 Ga0466707_070837 3300042601 Bacteria 19880
19 Ga0466713_099183 3300042602 Bacteria 118109
20 Ga0466716_355256 3300042605 Bacteria 6361
21 Ga0466719_210155 3300042606 Bacteria 9481
22 Ga0466722_141283 3300042609 Bacteria 13906
23 Ga0466698_447796 3300042610 Bacteria 4351
24 Ga0466697_090250 3300042611 Bacteria 2942
25 Ga0466705_017838 3300042612 Bacteria 7478
26 IMNBL1DRAFT_c0000136 3300000062 Bacteria 65757
27 JGI24702J35022_10014503 3300002462 Bacteria 4348
28 Ga0466710_037372 3300042613 Bacteria 2278
29 Ga0466710_170267 3300042613 Bacteria 14748
30 Ga0466711_006966 3300042615 Bacteria 5800
31 Ga0466715_514647 3300042616 Unclassified 2656
32 Ga0466726_414861 3300042619 Bacteria 1400
33 Ga0466728_371680 3300042620 Bacteria 8915
34 Ga0466690_040533 3300042590 Bacteria 11330
35 Ga0466696_302916 3300042596 Bacteria 25646
36 Ga0466703_420301 3300042636 Unclassified 3692
37 Ga0466704_236841 3300042643 Bacteria 15017
38 Ga0466709_242055 3300042648 Bacteria 39824
39 Ga0466708_302402 3300042652 Bacteria 34492
40 Ga0466727_047170 3300042655 Bacteria 83253
41 Ga0466706_216299 3300042599 Bacteria 2335
42 Ga0466700_357253 3300042600 Bacteria 5637
43 Ga0466707_165483 3300042601 Bacteria 32826
44 Ga0466713_008112 3300042602 Bacteria 16127
45 Ga0466713_104700 3300042602 Bacteria 45952
46 Ga0466716_349737 3300042605 Bacteria 18598
47 Ga0466719_052340 3300042606 Bacteria 15916
48 Ga0123357_10034719 3300009784 Bacteria 6856
49 Ga0123354_10000698 3300010882 Bacteria 35854
50 Ga0466705_326106 3300042612 Bacteria 40770
51 Ga0466733_099882 3300042659 Bacteria 1987
52 Ga0466733_120796 3300042659 Bacteria 6227
53 2227239116 2225789004 Bacteria 7264
54 2227450255 2225789004 Bacteria 5423
55 JGI24705J35276_12238234 3300002504 Bacteria 17623
56 Ga0068305_10031331 3300005083 Bacteria 12573
57 Ga0068305_10049092 3300005083 Bacteria 12491
58 Ga0466711_199160 3300042615 Bacteria 9042
59 Ga0466723_164268 3300042618 Bacteria 2857
60 Ga0466723_246960 3300042618 Bacteria 1546
61 Ga0466726_324529 3300042619 Unclassified 2857
62 Ga0466728_470260 3300042620 Bacteria 2372
63 Ga0466656_229341 3300042550 Bacteria 1753
64 Ga0466690_198924 3300042590 Bacteria 34985
65 Ga0466691_127886 3300042593 Bacteria 16442
66 Ga0466696_324704 3300042596 Bacteria 1796
67 Ga0466703_269553 3300042636 Bacteria 2597
68 Ga0466704_059052 3300042643 Bacteria 32672
69 Ga0466707_106179 3300042601 Bacteria 3900
70 Ga0466716_402076 3300042605 Bacteria 4154
71 Ga0466733_062296 3300042659 Bacteria 3658
72 Ga0562377_0004 3300056842 Bacteria 3525959
73 2227466589 2225789004 Bacteria 5121
74 JGI24702J35022_10000047 3300002462 Bacteria 51139
75 JGI24702J35022_10001125 3300002462 Bacteria 16621
76 Ga0068302_10163359 3300005071 Bacteria 1705
77 Ga0068305_10035166 3300005083 Bacteria 8771
78 Ga0466711_158297 3300042615 Bacteria 1847
79 Ga0466723_125880 3300042618 Bacteria 16503
80 Ga0466696_064871 3300042596 Bacteria 53075
81 Ga0466696_287535 3300042596 Bacteria 43348
82 Ga0466735_107120 3300042624 Bacteria 2279
83 Ga0466703_055116 3300042636 Bacteria 1914
84 Ga0466704_174598 3300042643 Bacteria 13596
85 Ga0466709_231727 3300042648 Bacteria 7628
86 Ga0466727_150110 3300042655 Bacteria 20444
87 Ga0466727_220175 3300042655 Bacteria 2783
88 Ga0466701_017652 3300042598 Bacteria 77230
89 Ga0466706_050745 3300042599 Bacteria 10034
90 Ga0466707_224813 3300042601 Bacteria 6037
91 Ga0466707_240421 3300042601 Bacteria 1563
92 Ga0466713_109231 3300042602 Bacteria 188899
93 Ga0466705_198378 3300042612 Bacteria 14888
94 JGI24696J40584_12961250 3300002834 Bacteria 12617
95 Ga0466715_432401 3300042616 Bacteria 5863
96 Ga0466715_642914 3300042616 Bacteria 17581
97 Ga0466723_193043 3300042618 Bacteria 34490
98 Ga0466726_098369 3300042619 Unclassified 3031
99 Ga0466704_189038 3300042643 Bacteria 10977
100 Ga0466727_113759 3300042655 Bacteria 15347
101 Ga0466727_220111 3300042655 Bacteria 43243
102 Ga0466707_348831 3300042601 Bacteria 2103
103 Ga0466713_080967 3300042602 Bacteria 10571
104 Ga0466713_099472 3300042602 Bacteria 53957
105 Ga0466722_151588 3300042609 Bacteria 7743
106 Ga0123356_10081513 3300010049 Bacteria 3061
107 Ga0123354_10259669 3300010882 Bacteria 1738
108 Ga0466697_139971 3300042611 Bacteria 122800
109 Ga0466705_175319 3300042612 Bacteria 4960
110 Ga0466705_318463 3300042612 Bacteria 3111
111 Ga0466733_061998 3300042659 Bacteria 12301
112 Ga0466715_190989 3300042616 Bacteria 5915
113 Ga0466715_250275 3300042616 Bacteria 7315
114 Ga0466715_360885 3300042616 Bacteria 59521
115 Ga0466715_591119 3300042616 Bacteria 3209
116 Ga0466726_069851 3300042619 Bacteria 5697
117 Ga0466726_166912 3300042619 Bacteria 31769
118 Ga0466728_253577 3300042620 Bacteria 3428
119 Ga0466691_082783 3300042593 Bacteria 28065
120 Ga0466696_196337 3300042596 Bacteria 6822
121 Ga0466735_046657 3300042624 Bacteria 6530
122 Ga0466735_123679 3300042624 Bacteria 2376
123 Ga0466735_152001 3300042624 Bacteria 3530
124 Ga0466703_140271 3300042636 Bacteria 55996
125 Ga0466704_084380 3300042643 Bacteria 14804
126 Ga0466709_080488 3300042648 Bacteria 7623
127 Ga0466709_276147 3300042648 Bacteria 8212
128 Ga0466706_048425 3300042599 Bacteria 4552
129 Ga0466707_005911 3300042601 Bacteria 16512
130 Ga0466707_077745 3300042601 Bacteria 6464
131 Ga0466707_139797 3300042601 Bacteria 27173
132 Ga0466713_129978 3300042602 Bacteria 70140
133 Ga0466713_152626 3300042602 Bacteria 36770
134 Ga0466716_239893 3300042605 Bacteria 7870
135 Ga0466705_305532 3300042612 Bacteria 10631
136 Ga0466733_024429 3300042659 Bacteria 8459
137 2227175255 2225789004 Bacteria 8139
138 JGI24702J35022_10019788 3300002462 Bacteria 3661
139 Ga0068302_10062975 3300005071 Bacteria 6676
140 Ga0068305_10116172 3300005083 Bacteria 5767
141 Ga0466711_343215 3300042615 Bacteria 7862
142 Ga0466715_498121 3300042616 Bacteria 9304
143 Ga0466715_633167 3300042616 Unclassified 12647
144 Ga0466715_638566 3300042616 Bacteria 20374
145 Ga0466726_003518 3300042619 Bacteria 3683
146 Ga0466728_129664 3300042620 Archaea 6871
147 Ga0466728_144832 3300042620 Bacteria 8491
148 Ga0466690_023436 3300042590 Bacteria 9478
149 Ga0466690_123938 3300042590 Bacteria 17302
150 Ga0466693_038938 3300042592 Bacteria 3823
151 Ga0466731_171351 3300042622 Bacteria 2078
152 Ga0466703_071422 3300042636 Bacteria 20891
153 Ga0466703_076549 3300042636 Bacteria 30576
154 Ga0466703_175205 3300042636 Bacteria 25111
155 Ga0466709_146490 3300042648 Bacteria 11034
156 Ga0466727_087532 3300042655 Bacteria 2954
157 Ga0466707_265242 3300042601 Bacteria 2392
158 Ga0466713_058852 3300042602 Bacteria 3579
159 Ga0466713_100016 3300042602 Bacteria 46673
160 Ga0466716_320267 3300042605 Bacteria 4289
161 Ga0466722_010442 3300042609 Bacteria 16245
162 Ga0123357_10228317 3300009784 Bacteria 2047
163 Ga0123353_10000831 3300010167 Bacteria 37538
164 Ga0466733_024002 3300042659 Bacteria 39250
165 Ga0466733_084365 3300042659 Bacteria 13107
166 Ga0072940_1422941 3300005200 Bacteria 1687
167 Ga0072941_1071670 3300005201 Bacteria 2587
168 Ga0466705_499614 3300042612 Bacteria 6118
169 Ga0466711_263921 3300042615 Unclassified 8092
170 Ga0466715_049285 3300042616 Bacteria 2799
171 Ga0466723_082290 3300042618 Bacteria 16638
172 Ga0466726_345088 3300042619 Bacteria 7018
173 Ga0466729_151163 3300042621 Bacteria 3399
174 Ga0466656_237373 3300042550 Bacteria 15096
175 Ga0466735_069331 3300042624 Bacteria 3763
176 Ga0466735_098137 3300042624 Bacteria 3787
177 Ga0466735_216824 3300042624 Bacteria 1683
178 Ga0466704_031012 3300042643 Bacteria 5617
179 Ga0466704_258026 3300042643 Bacteria 4075
180 Ga0466704_469167 3300042643 Bacteria 9925
181 Ga0466727_081946 3300042655 Bacteria 4526
182 Ga0466701_070840 3300042598 Bacteria 15102
183 Ga0466706_194383 3300042599 Bacteria 20630
184 Ga0466707_100671 3300042601 Bacteria 1748
185 Ga0466713_075457 3300042602 Bacteria 24128
186 Ga0466713_079899 3300042602 Unclassified 2654
187 Ga0466713_137778 3300042602 Bacteria 1407
188 Ga0466719_010632 3300042606 Bacteria 12106
189 Ga0466719_072148 3300042606 Bacteria 13566
190 Ga0466719_362466 3300042606 Bacteria 2896
191 Ga0466722_121330 3300042609 Bacteria 42758

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_324704 Ga0466696_324704_88_1146 352
2 3300042590 Ga0466690_040533 Ga0466690_040533_36_1133 365
3 3300042624 Ga0466735_123679 Ga0466735_123679_1153_2250 365
4 3300042636 Ga0466703_039597 Ga0466703_039597_2444_3541 365
5 2225789004 2227450255 2227887347 367
6 3300042590 Ga0466690_123938 Ga0466690_123938_6717_7820 367
7 3300042606 Ga0466719_362466 Ga0466719_362466_522_1625 367
8 3300042615 Ga0466711_263921 Ga0466711_263921_4195_5298 367
9 3300042620 Ga0466728_144832 Ga0466728_144832_6038_7141 367
10 3300042648 Ga0466709_276147 Ga0466709_276147_6546_7655 369
11 3300042655 Ga0466727_150110 Ga0466727_150110_8745_9854 369
12 3300042602 Ga0466713_152626 Ga0466713_152626_25715_26869 370
13 3300042659 Ga0466733_099882 Ga0466733_099882_76_1215 372
14 2225789004 2227466589 2227906540 376
15 3300042550 Ga0466656_237373 Ga0466656_237373_7565_8695 376
16 3300042592 Ga0466693_038938 Ga0466693_038938_1725_2855 376
17 3300042596 Ga0466696_361792 Ga0466696_361792_2778_3908 376
18 3300042598 Ga0466701_015516 Ga0466701_015516_2815_3945 376
19 3300042600 Ga0466700_357253 Ga0466700_357253_311_1441 376
20 3300042601 Ga0466707_106179 Ga0466707_106179_191_1321 376
21 3300042602 Ga0466713_099472 Ga0466713_099472_47849_48979 376
22 3300042612 Ga0466705_017838 Ga0466705_017838_4491_5621 376
23 3300042616 Ga0466715_498121 Ga0466715_498121_7096_8226 376
24 3300042618 Ga0466723_164268 Ga0466723_164268_773_1903 376
25 3300042622 Ga0466731_171351 Ga0466731_171351_47_1177 376
26 3300042624 Ga0466735_152001 Ga0466735_152001_535_1665 376
27 3300042636 Ga0466703_175205 Ga0466703_175205_5159_6289 376
28 3300042648 Ga0466709_146490 Ga0466709_146490_5201_6331 376
29 3300042652 Ga0466708_146402 Ga0466708_146402_8503_9633 376
30 3300042655 Ga0466727_047170 Ga0466727_047170_49899_51029 376
31 3300042655 Ga0466727_107621 Ga0466727_107621_5955_7085 376
32 3300042655 Ga0466727_220175 Ga0466727_220175_1433_2563 376
33 3300042659 Ga0466733_120796 Ga0466733_120796_2495_3625 376
34 iso_pr_bacteria 2910930387 2910933011 376
35 2225789004 2227239116 2227677770 377
36 3300002462 JGI24702J35022_10000047 JGI24702J35022_1000004725 377
37 3300002462 JGI24702J35022_10019788 JGI24702J35022_100197882 377
38 3300002504 JGI24705J35276_12238234 JGI24705J35276_122382347 377
39 3300005083 Ga0068305_10116172 Ga0068305_101161723 377
40 3300005201 Ga0072941_1071670 Ga0072941_10716702 377
41 3300010049 Ga0123356_10081513 Ga0123356_100815132 377
42 3300010882 Ga0123354_10000698 Ga0123354_1000069814 377
43 3300042601 Ga0466707_165483 Ga0466707_165483_24149_25282 377
44 3300042602 Ga0466713_058852 Ga0466713_058852_1753_2886 377
45 3300042602 Ga0466713_075457 Ga0466713_075457_18539_19672 377
46 3300042602 Ga0466713_079899 Ga0466713_079899_496_1629 377
47 3300042611 Ga0466697_090250 Ga0466697_090250_870_2003 377
48 3300042615 Ga0466711_343215 Ga0466711_343215_3092_4225 377
49 3300042616 Ga0466715_514647 Ga0466715_514647_1412_2545 377
50 3300042618 Ga0466723_125880 Ga0466723_125880_5322_6455 377
51 3300042619 Ga0466726_166912 Ga0466726_166912_8250_9383 377
52 3300042643 Ga0466704_189038 Ga0466704_189038_7341_8474 377
53 3300042655 Ga0466727_113759 Ga0466727_113759_154_1287 377
54 3300042659 Ga0466733_062296 Ga0466733_062296_1488_2621 377
55 3300056842 Ga0562377_0004 Ga0562377_0004_1372582_1373715 377
56 iso_pr_bacteria 2695420317 2695484000 377
57 iso_pr_bacteria 2873600114 2873603472 377
58 iso_pr_bacteria 2873610414 2873613863 377
59 iso_pr_bacteria 2910949487 2910951693 377
60 iso_pr_bacteria 8100157865 8100161749 377
61 2225789004 2227175255 2227591004 378
62 3300005083 Ga0068305_10049092 Ga0068305_100490928 378
63 3300042593 Ga0466691_064302 Ga0466691_064302_190_1326 378
64 3300042596 Ga0466696_302916 Ga0466696_302916_4621_5757 378
65 3300042598 Ga0466701_017652 Ga0466701_017652_53366_54502 378
66 3300042599 Ga0466706_194383 Ga0466706_194383_7046_8182 378
67 3300042601 Ga0466707_005911 Ga0466707_005911_10345_11481 378
68 3300042601 Ga0466707_070837 Ga0466707_070837_16735_17871 378
69 3300042601 Ga0466707_077745 Ga0466707_077745_4275_5411 378
70 3300042601 Ga0466707_100671 Ga0466707_100671_462_1598 378
71 3300042601 Ga0466707_224813 Ga0466707_224813_4693_5829 378
72 3300042601 Ga0466707_265242 Ga0466707_265242_212_1348 378
73 3300042601 Ga0466707_348831 Ga0466707_348831_477_1613 378
74 3300042602 Ga0466713_080967 Ga0466713_080967_9217_10353 378
75 3300042602 Ga0466713_099183 Ga0466713_099183_17711_18847 378
76 3300042602 Ga0466713_104700 Ga0466713_104700_11105_12241 378
77 3300042602 Ga0466713_109231 Ga0466713_109231_104241_105377 378
78 3300042605 Ga0466716_239893 Ga0466716_239893_277_1413 378
79 3300042605 Ga0466716_320267 Ga0466716_320267_1332_2468 378
80 3300042606 Ga0466719_010632 Ga0466719_010632_8025_9161 378
81 3300042609 Ga0466722_121330 Ga0466722_121330_209_1345 378
82 3300042609 Ga0466722_151588 Ga0466722_151588_3120_4256 378
83 3300042612 Ga0466705_318463 Ga0466705_318463_23_1159 378
84 3300042612 Ga0466705_499614 Ga0466705_499614_1377_2513 378
85 3300042615 Ga0466711_006966 Ga0466711_006966_272_1408 378
86 3300042615 Ga0466711_495588 Ga0466711_495588_1817_2953 378
87 3300042616 Ga0466715_250275 Ga0466715_250275_5994_7130 378
88 3300042616 Ga0466715_591119 Ga0466715_591119_1723_2859 378
89 3300042616 Ga0466715_638566 Ga0466715_638566_14263_15399 378
90 3300042618 Ga0466723_086325 Ga0466723_086325_491_1627 378
91 3300042618 Ga0466723_246960 Ga0466723_246960_194_1330 378
92 3300042619 Ga0466726_003518 Ga0466726_003518_2379_3515 378
93 3300042619 Ga0466726_345088 Ga0466726_345088_4644_5780 378
94 3300042620 Ga0466728_129664 Ga0466728_129664_2653_3789 378
95 3300042620 Ga0466728_253577 Ga0466728_253577_749_1885 378
96 3300042620 Ga0466728_371680 Ga0466728_371680_5061_6197 378
97 3300042620 Ga0466728_470260 Ga0466728_470260_452_1588 378
98 3300042621 Ga0466729_151163 Ga0466729_151163_202_1338 378
99 3300042624 Ga0466735_046657 Ga0466735_046657_4097_5233 378
100 3300042624 Ga0466735_069331 Ga0466735_069331_1811_2947 378
101 3300042624 Ga0466735_098137 Ga0466735_098137_691_1827 378
102 3300042624 Ga0466735_107120 Ga0466735_107120_299_1435 378
103 3300042624 Ga0466735_216824 Ga0466735_216824_42_1178 378
104 3300042636 Ga0466703_269553 Ga0466703_269553_484_1620 378
105 3300042636 Ga0466703_420301 Ga0466703_420301_718_1854 378
106 3300042643 Ga0466704_059052 Ga0466704_059052_8609_9745 378
107 3300042643 Ga0466704_174598 Ga0466704_174598_2411_3547 378
108 3300042643 Ga0466704_469167 Ga0466704_469167_8656_9792 378
109 3300042648 Ga0466709_231727 Ga0466709_231727_4089_5225 378
110 3300042655 Ga0466727_081946 Ga0466727_081946_1636_2772 378
111 3300042655 Ga0466727_087532 Ga0466727_087532_656_1792 378
112 3300042655 Ga0466727_220111 Ga0466727_220111_13407_14543 378
113 3300042659 Ga0466733_024002 Ga0466733_024002_15261_16397 378
114 3300042659 Ga0466733_041174 Ga0466733_041174_167_1303 378
115 3300042659 Ga0466733_084365 Ga0466733_084365_5702_6838 378
116 3300042659 Ga0466733_199302 Ga0466733_199302_1556_2692 378
117 iso_pr_bacteria 2695420314 2695471127 378
118 iso_pr_bacteria 2910942425 2910945615 378
119 iso_pr_bacteria 2910959314 2910960968 378
120 iso_pr_bacteria 2940244548 2940246648 378
121 iso_pr_bacteria 2940248789 2940250776 378
122 iso_pr_bacteria 2940253009 2940254851 378
123 iso_pr_bacteria 2940257232 2940258966 378
124 iso_pr_bacteria 2967483437 2967485388 378
125 iso_pr_bacteria 3004672520 3004676630 378
126 iso_pr_bacteria 3004677695 3004679245 378
127 3300002462 JGI24702J35022_10001384 JGI24702J35022_100013844 379
128 3300002834 JGI24696J40584_12961250 JGI24696J40584_129612502 379
129 3300005071 Ga0068302_10163359 Ga0068302_101633591 379
130 3300005083 Ga0068305_10031331 Ga0068305_100313312 379
131 3300009784 Ga0123357_10034719 Ga0123357_100347192 379
132 3300042596 Ga0466696_064871 Ga0466696_064871_37560_38699 379
133 3300042601 Ga0466707_240421 Ga0466707_240421_110_1249 379
134 3300042615 Ga0466711_158297 Ga0466711_158297_640_1779 379
135 3300042615 Ga0466711_199160 Ga0466711_199160_2298_3437 379
136 3300042616 Ga0466715_049285 Ga0466715_049285_1459_2598 379
137 3300042616 Ga0466715_642914 Ga0466715_642914_2850_3989 379
138 3300042619 Ga0466726_414861 Ga0466726_414861_184_1323 379
139 3300042636 Ga0466703_055116 Ga0466703_055116_679_1818 379
140 3300042636 Ga0466703_140271 Ga0466703_140271_24282_25421 379
141 3300042643 Ga0466704_031012 Ga0466704_031012_3033_4172 379
142 3300042659 Ga0466733_024429 Ga0466733_024429_122_1261 379
143 3300000062 IMNBL1DRAFT_c0000136 IMNBL1DRAFT_00001364 380
144 3300002462 JGI24702J35022_10001125 JGI24702J35022_100011254 380
145 3300042550 Ga0466656_229341 Ga0466656_229341_478_1620 380
146 3300042599 Ga0466706_216299 Ga0466706_216299_699_1841 380
147 3300042602 Ga0466713_100016 Ga0466713_100016_16531_17673 380
148 3300042602 Ga0466713_137778 Ga0466713_137778_250_1392 380
149 3300042605 Ga0466716_355256 Ga0466716_355256_3013_4155 380
150 3300042605 Ga0466716_402076 Ga0466716_402076_769_1911 380
151 3300042606 Ga0466719_072148 Ga0466719_072148_9653_10795 380
152 3300042606 Ga0466719_210155 Ga0466719_210155_3270_4412 380
153 3300042610 Ga0466698_447796 Ga0466698_447796_2006_3148 380
154 3300042612 Ga0466705_305532 Ga0466705_305532_2949_4091 380
155 3300042615 Ga0466711_084854 Ga0466711_084854_5702_6844 380
156 3300042616 Ga0466715_360885 Ga0466715_360885_8069_9211 380
157 3300042616 Ga0466715_633167 Ga0466715_633167_8988_10130 380
158 3300042619 Ga0466726_098369 Ga0466726_098369_437_1579 380
159 3300042636 Ga0466703_076549 Ga0466703_076549_24289_25431 380
160 3300042643 Ga0466704_236841 Ga0466704_236841_10956_12098 380
161 3300042648 Ga0466709_242055 Ga0466709_242055_16410_17552 380
162 3300042655 Ga0466727_034358 Ga0466727_034358_25140_26282 380
163 3300042659 Ga0466733_129506 Ga0466733_129506_691_1833 380
164 iso_pr_bacteria 8100166142 8100170015 380
165 3300005071 Ga0068302_10062975 Ga0068302_100629756 381
166 3300005083 Ga0068305_10035166 Ga0068305_100351666 381
167 3300009784 Ga0123357_10228317 Ga0123357_102283172 381
168 3300010882 Ga0123354_10259669 Ga0123354_102596692 381
169 3300042590 Ga0466690_023436 Ga0466690_023436_5209_6354 381
170 3300042590 Ga0466690_198924 Ga0466690_198924_32728_33873 381
171 3300042593 Ga0466691_082783 Ga0466691_082783_11798_12943 381
172 3300042593 Ga0466691_127886 Ga0466691_127886_76_1221 381
173 3300042596 Ga0466696_196337 Ga0466696_196337_2744_3889 381
174 3300042596 Ga0466696_287535 Ga0466696_287535_9855_11000 381
175 3300042599 Ga0466706_050745 Ga0466706_050745_4264_5409 381
176 3300042601 Ga0466707_139797 Ga0466707_139797_17759_18904 381
177 3300042602 Ga0466713_129978 Ga0466713_129978_26698_27843 381
178 3300042606 Ga0466719_052340 Ga0466719_052340_14701_15846 381
179 3300042612 Ga0466705_198378 Ga0466705_198378_13416_14561 381
180 3300042612 Ga0466705_326106 Ga0466705_326106_197_1342 381
181 3300042618 Ga0466723_082290 Ga0466723_082290_3004_4149 381
182 3300042618 Ga0466723_193043 Ga0466723_193043_3055_4200 381
183 3300042620 Ga0466728_425802 Ga0466728_425802_11039_12184 381
184 3300042648 Ga0466709_080488 Ga0466709_080488_2610_3755 381
185 3300042659 Ga0466733_061998 Ga0466733_061998_6194_7339 381
186 3300002462 JGI24702J35022_10014503 JGI24702J35022_100145034 382
187 3300010167 Ga0123353_10000831 Ga0123353_1000083123 382
188 3300042602 Ga0466713_008112 Ga0466713_008112_7651_8799 382
189 3300042609 Ga0466722_010442 Ga0466722_010442_902_2050 382
190 3300042611 Ga0466697_139971 Ga0466697_139971_70512_71660 382
191 3300042612 Ga0466705_175319 Ga0466705_175319_564_1712 382
192 3300042613 Ga0466710_037372 Ga0466710_037372_1115_2263 382
193 3300042613 Ga0466710_170267 Ga0466710_170267_12488_13636 382
194 3300042616 Ga0466715_432401 Ga0466715_432401_1678_2826 382
195 3300042654 Ga0466725_119640 Ga0466725_119640_4427_5575 382
196 3300042598 Ga0466701_070840 Ga0466701_070840_8964_10115 383
197 3300005200 Ga0072940_1422941 Ga0072940_14229412 385
198 3300042619 Ga0466726_324529 Ga0466726_324529_1339_2496 385
199 3300042643 Ga0466704_084380 Ga0466704_084380_577_1737 386
200 3300042652 Ga0466708_302402 Ga0466708_302402_19251_20411 386
201 iso_pr_bacteria 2820240463 2820240957 386
202 3300042616 Ga0466715_190989 Ga0466715_190989_1169_2332 387
203 3300042636 Ga0466703_071422 Ga0466703_071422_12233_13399 388
204 3300042654 Ga0466725_106783 Ga0466725_106783_934_2118 394
205 3300042619 Ga0466726_069851 Ga0466726_069851_3058_4248 396
206 3300042599 Ga0466706_048425 Ga0466706_048425_70_1269 399
207 3300042643 Ga0466704_258026 Ga0466704_258026_2131_3369 412
208 3300042605 Ga0466716_349737 Ga0466716_349737_1861_3120 419
209 3300042609 Ga0466722_141283 Ga0466722_141283_2379_3692 437

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01467 CTP_transf_like Cytidylyltransferase-like 67 162 0.76

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.