Protein Family IF06827

Metagenome Isolate
143 Members
92 Samples
94 Scaffolds
405.18 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_138423|Ga0466722_138423_324_1769
Length
481 aa
Sequence
MSGVQAAGGQESATLFSLGGKKLTAVFRVCWLGAIDAMGKELAPFSSGRSRPRPEGWSRSSSRSFRAGFQTGVGFTMTTMALQGKTILLGVSGGIAAYKAAMLTRLLKGAGARVRVAMSEAAGQFVTPLTFQALSGEAVFSSLWEAGDVASGMAHITLSREADAMLVAPATADFMARAATGQADDLLSTLALARNCPLFLAPSMNRQMWRHPATQRNAATLAEDGVVIWGPTSGKQACGEDGEGRLLEPEQLLEALTAALARKTLAGKKVLLTAGPTFEAIDPVRGLTNRSSGKMGYALARAAFHAGATVTLVSGPVAIPFPYGVTGVPVISAAEMQQAVLTRAADADIFIAVAAVADYHVKTTLTAKHKKEHGVLPTLDLVENPDILASVAALHSPPFCVGFAAESEDLARYAEEKRRRKRLPLIVGNLVQEGLGGDSNHVVLFDDHGAHALPTADKHVLARQLIDHIAALMETAHARVN

📊 Sample Types

Isolate 34.3%
Metagenome 65.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 37.4%
Termitidae 19.8%
Kalotermitidae 9.9%
Elmidae 7.7%
Tenebrionidae 5.5%
Rhinotermitidae 4.4%
Nephropidae 2.2%
Armadillidiidae 2.2%
Blattidae 1.1%
Culicidae 1.1%
Cixiidae 1.1%
Termopsidae 1.1%
Drosophilidae 1.1%
Formicidae 1.1%
Passalidae 1.1%
Apidae 1.1%
Psyllidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
2 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
3 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
4 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
5 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
6 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
7 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
8 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
13 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
14 2617270844 Dyella sp. HyOG Isolate Cixiidae
15 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
16 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
17 2820101058 Unclassified Proteobacteria Emb289P4bin76 Isolate Unclassified
18 2820733257 Unclassified Chloroflexi Lab288P4bin59 Isolate Unclassified
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
22 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
23 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
24 2820155744 Unclassified Proteobacteria Cu122P5bin24 Isolate Unclassified
25 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
26 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
27 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
30 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
31 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
35 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
38 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
39 2864895409 Bacillus aerius S00152 Isolate Elmidae
40 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
41 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
42 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
43 2916858470 Heyndrickxia oleronia Isolate Unclassified
44 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
48 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
49 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
50 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
51 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
52 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
53 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
54 8064008355 Heyndrickxia oleronia Isolate Unclassified
55 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
56 2511231129 Vibrio sp. EJY3 Isolate Unclassified
57 2820046858 Unclassified Proteobacteria Th196P3bin84 Isolate Unclassified
58 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
59 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
60 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
61 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
62 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
63 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
64 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
65 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
66 2512047046 Secondary Endosymbiont of Heteropsylla cubana Isolate Psyllidae
67 2820056190 Unclassified Proteobacteria Nt197P4bin9 Isolate Unclassified
68 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
69 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
70 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
71 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
72 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
73 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
74 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
75 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
76 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
77 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
78 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
79 2864801025 Bacillus aerius S00042 Isolate Elmidae
80 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
81 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
82 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
83 2562617066 Rickettsiella grylli AAQJ Isolate Armadillidiidae
84 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
85 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
86 2820439761 Unclassified Firmicutes Lab288P3bin203 Isolate Unclassified
87 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified
88 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
89 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
90 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
91 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
92 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10223930 3300009784 Bacteria 2080
2 Ga0123355_10003145 3300009826 Bacteria 23588
3 Ga0123355_10078842 3300009826 Bacteria 5261
4 Ga0123356_10000827 3300010049 Bacteria 34422
5 Ga0160470_100114 3300012813 Bacteria 87061
6 Ga0466726_095611 3300042619 Bacteria 13345
7 Ga0466657_093353 3300042582 Bacteria 11450
8 Ga0466692_175419 3300042591 Bacteria 3916
9 Ga0466716_257372 3300042605 Bacteria 5559
10 Ga0466722_144904 3300042609 Bacteria 627430
11 2212577974 2209111004 Bacteria 23753
12 Ga0466705_204571 3300042612 Bacteria 4582
13 Ga0466733_005264 3300042659 Bacteria 47783
14 Ga0562377_0065 3300056842 Bacteria 457525
15 Ga0123355_10003063 3300009826 Unclassified 23815
16 Ga0123356_10030609 3300010049 Bacteria 5037
17 Ga0123356_10033812 3300010049 Unclassified 4781
18 Ga0123353_10034897 3300010167 Bacteria 7861
19 Ga0123354_10059183 3300010882 Unclassified 5684
20 Ga0160455_100003 3300012837 Bacteria 1101044
21 Ga0466734_124233 3300042623 Bacteria 8234
22 Ga0466704_420893 3300042643 Bacteria 12772
23 Ga0466725_038656 3300042654 Bacteria 30865
24 Ga0466725_136466 3300042654 Bacteria 5260
25 Ga0466701_043277 3300042598 Bacteria 12338
26 Ga0466717_260520 3300042604 Bacteria 3462
27 HBC_ctgsDRAFT_1000075 3300000333 Bacteria 25451
28 JGI24705J35276_12236690 3300002504 Unclassified 8640
29 Ga0103264_1000081 3300007188 Bacteria 56731
30 Ga0530661_000075 3300056564 Unclassified 94291
31 Ga0123356_10001908 3300010049 Bacteria 22604
32 Ga0123356_10007509 3300010049 Unclassified 10869
33 Ga0466657_101788 3300042582 Unclassified 2071
34 Ga0466657_388233 3300042582 Bacteria 1531
35 Ga0466708_071550 3300042652 Bacteria 11633
36 Ga0466707_013970 3300042601 Bacteria 10343
37 Ga0466707_319311 3300042601 Bacteria 64740
38 Ga0466719_051112 3300042606 Bacteria 7773
39 Ga0562374_0725 3300057007 Bacteria 48750
40 Ga0123355_10056550 3300009826 Bacteria 6348
41 Ga0123355_10102583 3300009826 Bacteria 4499
42 Ga0123356_10138350 3300010049 Bacteria 2398
43 Ga0466710_448377 3300042613 Bacteria 17884
44 Ga0466711_283621 3300042615 Bacteria 1562
45 Ga0466715_575106 3300042616 Bacteria 42120
46 Ga0466694_039124 3300042594 Bacteria 11527
47 Ga0466703_047465 3300042636 Bacteria 7955
48 Ga0466719_045544 3300042606 Bacteria 3628
49 Ga0466719_163598 3300042606 Bacteria 1863
50 JGI24705J35276_12238715 3300002504 Bacteria 41934
51 Ga0562379_0028 3300056790 Bacteria 775176
52 Ga0562379_0481 3300056790 Bacteria 81076
53 Ga0123355_10447638 3300009826 Bacteria 1630
54 Ga0123356_10034060 3300010049 Unclassified 4763
55 Ga0466710_005173 3300042613 Bacteria 12522
56 Ga0466715_019395 3300042616 Bacteria 14760
57 Ga0466724_07593 3300042649 Bacteria 2799
58 Ga0466725_461929 3300042654 Bacteria 22391
59 Ga0466706_019852 3300042599 Bacteria 2689
60 Ga0466719_542886 3300042606 Bacteria 1890
61 2227408574 2225789004 Bacteria 5728
62 Ga0562377_0106 3300056842 Bacteria 268063
63 Ga0123356_10000653 3300010049 Bacteria 38246
64 Ga0123356_10014214 3300010049 Bacteria 7658
65 Ga0466705_529595 3300042612 Bacteria 4797
66 Ga0466729_047835 3300042621 Bacteria 11017
67 Ga0466725_149073 3300042654 Bacteria 3594
68 Ga0466701_033817 3300042598 Bacteria 21159
69 Ga0466713_038548 3300042602 Bacteria 2719
70 Ga0466719_513846 3300042606 Unclassified 3940
71 Ga0466722_173116 3300042609 Bacteria 181242
72 JGI24705J35276_12235357 3300002504 Unclassified 6448
73 Ga0466697_117188 3300042611 Bacteria 2636
74 Ga0123355_10013223 3300009826 Bacteria 12831
75 Ga0123354_10003014 3300010882 Bacteria 22929
76 Ga0466723_326243 3300042618 Bacteria 4823
77 Ga0466657_015947 3300042582 Bacteria 203876
78 Ga0466657_125491 3300042582 Bacteria 1914
79 Ga0466725_082831 3300042654 Bacteria 99829
80 Ga0466706_033530 3300042599 Bacteria 4680
81 Ga0466722_135096 3300042609 Bacteria 33731
82 Ga0466722_138423 3300042609 Bacteria 2730
83 JGI24705J35276_12222542 3300002504 Bacteria 2429
84 Ga0466733_108906 3300042659 Bacteria 34427
85 Ga0123354_10010507 3300010882 Bacteria 14266
86 Ga0466710_409417 3300042613 Bacteria 38150
87 Ga0466729_148217 3300042621 Bacteria 33223
88 Ga0466695_399591 3300042595 Bacteria 11961
89 Ga0466706_093890 3300042599 Bacteria 35349
90 Ga0466706_096658 3300042599 Bacteria 2237
91 Ga0466717_312584 3300042604 Bacteria 24276
92 Ga0466719_391651 3300042606 Bacteria 4007
93 Ga0105524_103199 3300007733 Bacteria 2017
94 Ga0123357_10000023 3300009784 Bacteria 136176

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820439761 2820440608 341
2 3300042616 Ga0466715_575106 Ga0466715_575106_18253_19482 379
3 3300042621 Ga0466729_148217 Ga0466729_148217_31725_32945 380
4 3300042606 Ga0466719_542886 Ga0466719_542886_368_1564 385
5 3300042616 Ga0466715_019395 Ga0466715_019395_10929_12125 385
6 iso_pr_bacteria 2940373808 2940375306 391
7 3300009784 Ga0123357_10000023 Ga0123357_1000002358 393
8 3300009784 Ga0123357_10223930 Ga0123357_102239302 393
9 3300042612 Ga0466705_529595 Ga0466705_529595_1012_2208 393
10 3300042652 Ga0466708_071550 Ga0466708_071550_793_2097 393
11 3300042654 Ga0466725_038656 Ga0466725_038656_24742_25947 393
12 3300042599 Ga0466706_019852 Ga0466706_019852_870_2054 394
13 iso_pr_bacteria 2820733257 2820733460 394
14 iso_pr_bacteria 2864859030 2864861602 394
15 iso_pr_bacteria 2864914039 2864916598 394
16 iso_pr_bacteria 2864988360 2864989605 394
17 3300010167 Ga0123353_10034897 Ga0123353_100348973 395
18 3300010882 Ga0123354_10010507 Ga0123354_100105076 395
19 3300042601 Ga0466707_319311 Ga0466707_319311_44512_45705 397
20 3300042615 Ga0466711_283621 Ga0466711_283621_208_1401 397
21 3300042618 Ga0466723_326243 Ga0466723_326243_1888_3081 397
22 iso_pr_bacteria 2820518089 2820519508 397
23 3300042601 Ga0466707_013970 Ga0466707_013970_4925_6121 398
24 3300042602 Ga0466713_038548 Ga0466713_038548_986_2182 398
25 iso_pr_bacteria 2571042003 2571062186 398
26 iso_pr_bacteria 2864808494 2864809494 398
27 iso_pr_bacteria 2864812326 2864813378 398
28 3300042595 Ga0466695_399591 Ga0466695_399591_7022_8221 399
29 3300042611 Ga0466697_117188 Ga0466697_117188_762_1961 399
30 3300042654 Ga0466725_149073 Ga0466725_149073_2164_3363 399
31 iso_pr_bacteria 2511231129 2511729626 399
32 iso_pr_bacteria 2820580397 2820581007 399
33 iso_pr_bacteria 2839785767 2839789246 399
34 iso_pr_bacteria 2877647439 2877650314 399
35 3300010049 Ga0123356_10033812 Ga0123356_100338122 400
36 3300042599 Ga0466706_096658 Ga0466706_096658_949_2151 400
37 3300042605 Ga0466716_257372 Ga0466716_257372_622_1824 400
38 3300042606 Ga0466719_045544 Ga0466719_045544_1206_2408 400
39 3300042606 Ga0466719_051112 Ga0466719_051112_3196_4398 400
40 3300042606 Ga0466719_163598 Ga0466719_163598_614_1816 400
41 3300042606 Ga0466719_391651 Ga0466719_391651_2189_3391 400
42 3300042606 Ga0466719_513846 Ga0466719_513846_547_1749 400
43 3300042612 Ga0466705_204571 Ga0466705_204571_2148_3350 400
44 3300042636 Ga0466703_047465 Ga0466703_047465_3802_5004 400
45 3300042643 Ga0466704_420893 Ga0466704_420893_4215_5417 400
46 3300056564 Ga0530661_000075 Ga0530661_000075_64999_66201 400
47 iso_pr_bacteria 2820046858 2820047656 400
48 iso_pr_bacteria 2820075487 2820076074 400
49 iso_pr_bacteria 2834951433 2834952632 400
50 iso_pr_bacteria 8012942269 8012942628 400
51 3300010049 Ga0123356_10138350 Ga0123356_101383502 401
52 3300042609 Ga0466722_135096 Ga0466722_135096_10764_11969 401
53 3300042623 Ga0466734_124233 Ga0466734_124233_3551_4756 401
54 iso_pr_bacteria 2617270844 2617734609 401
55 3300007733 Ga0105524_103199 Ga0105524_1031992 402
56 3300042582 Ga0466657_101788 Ga0466657_101788_478_1686 402
57 3300042594 Ga0466694_039124 Ga0466694_039124_4823_6031 402
58 3300042619 Ga0466726_095611 Ga0466726_095611_7799_9007 402
59 iso_pr_bacteria 2767802234 2769330115 402
60 iso_pr_bacteria 2820565217 2820566030 402
61 iso_pr_bacteria 2848339753 2848341326 402
62 3300010049 Ga0123356_10030609 Ga0123356_100306097 403
63 3300042582 Ga0466657_093353 Ga0466657_093353_6244_7455 403
64 3300042609 Ga0466722_144904 Ga0466722_144904_612014_613225 403
65 3300042654 Ga0466725_136466 Ga0466725_136466_2678_3889 403
66 3300042659 Ga0466733_005264 Ga0466733_005264_12670_13881 403
67 iso_pr_bacteria 2528768159 2529054749 403
68 iso_pr_bacteria 2820056190 2820057065 403
69 iso_pr_bacteria 2820080004 2820082142 403
70 iso_pr_bacteria 2820101058 2820102030 403
71 2225789004 2227408574 2227850846 404
72 3300000333 HBC_ctgsDRAFT_1000075 HBC_ctgsDRAFT_100007518 404
73 3300002504 JGI24705J35276_12222542 JGI24705J35276_122225424 404
74 3300002504 JGI24705J35276_12235357 JGI24705J35276_122353578 404
75 3300010882 Ga0123354_10059183 Ga0123354_100591833 404
76 3300042654 Ga0466725_461929 Ga0466725_461929_18276_19490 404
77 3300056790 Ga0562379_0028 Ga0562379_0028_469992_471206 404
78 3300056842 Ga0562377_0065 Ga0562377_0065_192580_193794 404
79 3300056842 Ga0562377_0106 Ga0562377_0106_66562_67776 404
80 3300057007 Ga0562374_0725 Ga0562374_0725_36369_37583 404
81 iso_pr_bacteria 2512047046 2512398622 404
82 iso_pr_bacteria 2562617066 2562865869 404
83 iso_pr_bacteria 2916858470 2916863262 404
84 iso_pr_bacteria 8064008355 8064011783 404
85 3300009826 Ga0123355_10078842 Ga0123355_100788422 405
86 3300042621 Ga0466729_047835 Ga0466729_047835_6122_7339 405
87 3300042659 Ga0466733_108906 Ga0466733_108906_28243_29460 405
88 iso_pr_bacteria 2574180310 2576356514 405
89 iso_pr_bacteria 2758568557 2760423091 405
90 iso_pr_bacteria 2758568559 2760426597 405
91 iso_pr_bacteria 2758568560 2760427931 405
92 iso_pr_bacteria 2758568561 2760429760 405
93 iso_pr_bacteria 2808606958 2811758895 405
94 iso_pr_bacteria 2820157249 2820158359 405
95 iso_pr_bacteria 2864801025 2864802756 405
96 iso_pr_bacteria 2864895409 2864896753 405
97 iso_pr_bacteria 8043041867 8043043144 405
98 2209111004 2212577974 2212422447 406
99 3300009826 Ga0123355_10056550 Ga0123355_100565501 406
100 3300010049 Ga0123356_10001908 Ga0123356_1000190812 406
101 3300010049 Ga0123356_10007509 Ga0123356_100075094 406
102 3300042591 Ga0466692_175419 Ga0466692_175419_1792_3012 406
103 3300042598 Ga0466701_033817 Ga0466701_033817_18796_20016 406
104 3300042609 Ga0466722_173116 Ga0466722_173116_15137_16357 406
105 iso_pr_bacteria 2820155744 2820156554 406
106 iso_pr_bacteria 2843904799 2843908863 406
107 3300009826 Ga0123355_10102583 Ga0123355_101025833 407
108 3300042599 Ga0466706_093890 Ga0466706_093890_4832_6055 407
109 3300009826 Ga0123355_10003063 Ga0123355_1000306312 408
110 3300010049 Ga0123356_10000827 Ga0123356_1000082723 408
111 3300012813 Ga0160470_100114 Ga0160470_10011460 408
112 3300042613 Ga0466710_005173 Ga0466710_005173_3860_5089 409
113 3300042613 Ga0466710_409417 Ga0466710_409417_13145_14374 409
114 3300042654 Ga0466725_082831 Ga0466725_082831_27376_28605 409
115 iso_pr_bacteria 2756170272 2756775293 409
116 3300056790 Ga0562379_0481 Ga0562379_0481_32417_33649 410
117 iso_pr_bacteria 2820077244 2820079198 410
118 3300009826 Ga0123355_10003145 Ga0123355_1000314512 411
119 3300009826 Ga0123355_10447638 Ga0123355_104476382 411
120 3300010049 Ga0123356_10000653 Ga0123356_1000065326 411
121 3300010049 Ga0123356_10034060 Ga0123356_100340603 411
122 3300042582 Ga0466657_125491 Ga0466657_125491_317_1552 411
123 3300042582 Ga0466657_388233 Ga0466657_388233_271_1506 411
124 3300042649 Ga0466724_07593 Ga0466724_07593_1276_2511 411
125 3300010049 Ga0123356_10014214 Ga0123356_100142144 412
126 3300012837 Ga0160455_100003 Ga0160455_100003168 413
127 3300042582 Ga0466657_015947 Ga0466657_015947_38698_39939 413
128 iso_pr_bacteria 2820161938 2820163167 414
129 iso_pr_bacteria 2820161938 2820163892 414
130 iso_pr_bacteria 2820164216 2820164804 414
131 iso_pr_bacteria 2889908211 2889912708 414
132 3300010882 Ga0123354_10003014 Ga0123354_1000301424 415
133 3300042613 Ga0466710_448377 Ga0466710_448377_3701_4954 417
134 3300009826 Ga0123355_10013223 Ga0123355_100132235 418
135 3300007188 Ga0103264_1000081 Ga0103264_100008129 422
136 3300042604 Ga0466717_312584 Ga0466717_312584_20158_21426 422
137 iso_pr_bacteria 2724678956 2724791477 422
138 3300042598 Ga0466701_043277 Ga0466701_043277_3319_4608 429
139 3300042599 Ga0466706_033530 Ga0466706_033530_19_1359 446
140 3300002504 JGI24705J35276_12236690 JGI24705J35276_122366906 475
141 3300042604 Ga0466717_260520 Ga0466717_260520_1268_2734 475
142 3300002504 JGI24705J35276_12238715 JGI24705J35276_122387157 477
143 3300042609 Ga0466722_138423 Ga0466722_138423_324_1769 481

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04127 DFP DNA / pantothenate metabolism flavoprotein 265 444 0.96
PF02441 Flavoprotein Flavoprotein 85 255 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02441 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.66 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.