Protein Family IF06820

Metagenome Isolate
137 Members
58 Samples
127 Scaffolds
194.34 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_129040|Ga0466722_129040_4406_5086
Length
226 aa
Sequence
VADSEKRPPALVCGIDEAGRGPLAGPVCAAAVILPAGFPLEPLNDSKKLSAARREEARRIICERSLAWGVGWVSHVEIDKINILRASLLAMRRAFEQLLMPPPEGGLSAAWPAGRISETPFGWPLSPAVPPLGLFAIIDGLYAPDIPVPCTPMVKADAKVPGVMAASILAKTARDELMDSYSRLYPEYGYERHKGYPTREHRETVLKHGPSPIQRMSFTVKGLGSP

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.3%
Unclassified 23.2%
Kalotermitidae 23.2%
Rhinotermitidae 5.4%
Termopsidae 5.4%
Passalidae 3.6%

🌳 Taxonomy

Archaea 0
Bacteria 129
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
2 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
3 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
4 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
10 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
15 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
16 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
17 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
18 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
19 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
27 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
28 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
36 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
37 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
38 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
39 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
43 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
47 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
48 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
49 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
50 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
51 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
54 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
55 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
58 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10123238 3300002449 Unclassified 1121
2 JGI24695J34938_10001812 3300002450 Bacteria 17459
3 Ga0466690_077021 3300042590 Bacteria 7632
4 Ga0466690_149481 3300042590 Bacteria 1271
5 Ga0466691_005473 3300042593 Bacteria 1252
6 Ga0466691_063715 3300042593 Bacteria 17528
7 Ga0466699_188332 3300042597 Bacteria 1766
8 Ga0466728_044377 3300042620 Bacteria 5117
9 Ga0466728_427359 3300042620 Bacteria 14227
10 Ga0466702_390788 3300042635 Unclassified 7667
11 Ga0466709_338486 3300042648 Bacteria 3868
12 Ga0466727_033805 3300042655 Bacteria 3432
13 Ga0466727_034725 3300042655 Bacteria 1949
14 Ga0123355_10519472 3300009826 Bacteria 1458
15 Ga0123356_12390275 3300010049 Bacteria 661
16 Ga0466707_034916 3300042601 Bacteria 1972
17 Ga0466707_295422 3300042601 Bacteria 1936
18 Ga0466714_093436 3300042603 Bacteria 3286
19 Ga0466722_129040 3300042609 Bacteria 5936
20 Ga0466705_083478 3300042612 Bacteria 9948
21 Ga0466733_007668 3300042659 Bacteria 1701
22 JGI24698J34947_10007193 3300002449 Bacteria 6116
23 JGI24698J34947_10027130 3300002449 Unclassified 3040
24 JGI24697J35500_11272998 3300002507 Bacteria 5299
25 Ga0466694_284525 3300042594 Bacteria 1440
26 Ga0466715_161310 3300042616 Bacteria 19000
27 Ga0466718_107714 3300042617 Bacteria 6354
28 Ga0466729_058776 3300042621 Bacteria 1410
29 Ga0123356_12350706 3300010049 Bacteria 667
30 Ga0123353_11901839 3300010167 Bacteria 734
31 Ga0466707_113026 3300042601 Bacteria 29221
32 Ga0466733_113524 3300042659 Bacteria 13369
33 JGI24702J35022_10096888 3300002462 Bacteria 1611
34 Ga0072941_1007852 3300005201 Bacteria 1832
35 Ga0466692_160371 3300042591 Bacteria 61350
36 Ga0466696_439187 3300042596 Bacteria 1740
37 Ga0466712_119927 3300042614 Bacteria 12024
38 Ga0466723_183729 3300042618 Bacteria 1962
39 Ga0466726_319414 3300042619 Bacteria 1065
40 Ga0466726_325872 3300042619 Bacteria 2560
41 Ga0466704_114740 3300042643 Bacteria 5089
42 Ga0466709_029714 3300042648 Bacteria 15401
43 Ga0123356_11045363 3300010049 Bacteria 986
44 Ga0466707_197680 3300042601 Bacteria 2485
45 Ga0466722_067302 3300042609 Bacteria 6327
46 Ga0466722_097331 3300042609 Bacteria 79624
47 Ga0466733_196083 3300042659 Bacteria 1512
48 JGI24698J34947_10046057 3300002449 Bacteria 2221
49 JGI24695J34938_10003317 3300002450 Bacteria 11339
50 JGI24702J35022_10201260 3300002462 Bacteria 1140
51 Ga0072940_1132691 3300005200 Bacteria 6999
52 Ga0264413_126866 3300024493 Bacteria 4988
53 Ga0466690_044099 3300042590 Bacteria 8019
54 Ga0466694_387293 3300042594 Bacteria 3444
55 Ga0466699_034513 3300042597 Bacteria 1493
56 Ga0466705_401387 3300042612 Bacteria 29463
57 Ga0466712_063237 3300042614 Bacteria 17449
58 Ga0466712_076743 3300042614 Bacteria 9313
59 Ga0466731_009775 3300042622 Bacteria 2096
60 Ga0466709_076631 3300042648 Bacteria 2428
61 Ga0123357_10328315 3300009784 Unclassified 1499
62 Ga0123353_10193301 3300010167 Bacteria 3209
63 Ga0466716_195783 3300042605 Bacteria 5547
64 Ga0466722_012784 3300042609 Bacteria 4699
65 Ga0466733_141867 3300042659 Bacteria 123412
66 JGI24698J34947_10031478 3300002449 Bacteria 2792
67 JGI24695J34938_10034018 3300002450 Bacteria 2341
68 Ga0466692_140301 3300042591 Bacteria 1352
69 Ga0466694_398210 3300042594 Bacteria 3576
70 Ga0466696_174819 3300042596 Bacteria 3966
71 Ga0466715_096853 3300042616 Bacteria 12428
72 Ga0466718_091106 3300042617 Bacteria 9529
73 Ga0466718_168309 3300042617 Bacteria 2047
74 Ga0466726_073037 3300042619 Bacteria 3212
75 Ga0466708_435463 3300042652 Bacteria 1146
76 Ga0466727_345310 3300042655 Bacteria 2698
77 Ga0123355_10120975 3300009826 Bacteria 4061
78 Ga0123354_10404458 3300010882 Bacteria 1152
79 Ga0466701_096225 3300042598 Unclassified 3509
80 Ga0466700_293134 3300042600 Bacteria 1389
81 Ga0466716_045808 3300042605 Bacteria 4133
82 Ga0466716_343551 3300042605 Bacteria 2634
83 Ga0466733_010066 3300042659 Bacteria 2791
84 AustNasuHG_c1007295 3300000089 Bacteria 3937
85 Ga0466718_138075 3300042617 Bacteria 14483
86 Ga0466723_173115 3300042618 Bacteria 6392
87 Ga0466723_351412 3300042618 Bacteria 5695
88 Ga0466726_364796 3300042619 Bacteria 9302
89 Ga0466728_009027 3300042620 Bacteria 1953
90 Ga0466704_164197 3300042643 Bacteria 29146
91 Ga0123355_10300833 3300009826 Bacteria 2187
92 Ga0466722_211753 3300042609 Bacteria 11491
93 Ga0466733_106930 3300042659 Bacteria 27546
94 IMNBL1DRAFT_c0003243 3300000062 Bacteria 10612
95 JGI24698J34947_10056254 3300002449 Bacteria 1957
96 Ga0068305_10025776 3300005083 Bacteria 6647
97 Ga0466712_053789 3300042614 Bacteria 20018
98 Ga0466712_156476 3300042614 Bacteria 4832
99 Ga0466711_119451 3300042615 Bacteria 2034
100 Ga0466718_147733 3300042617 Bacteria 7564
101 Ga0466718_164571 3300042617 Bacteria 2767
102 Ga0466723_028374 3300042618 Bacteria 7945
103 Ga0466726_433135 3300042619 Bacteria 2006
104 Ga0466728_100256 3300042620 Bacteria 5365
105 Ga0466728_156223 3300042620 Bacteria 2161
106 Ga0466708_140935 3300042652 Bacteria 12492
107 Ga0123353_10744769 3300010167 Bacteria 1365
108 Ga0466713_129916 3300042602 Bacteria 2543
109 Ga0466716_506768 3300042605 Bacteria 2109
110 Ga0466719_101627 3300042606 Bacteria 62123
111 Ga0466733_104558 3300042659 Unclassified 1473
112 2227619060 2225789004 Bacteria 44860
113 JGI24698J34947_10025873 3300002449 Bacteria 3121
114 JGI24699J35502_10838876 3300002509 Bacteria 935
115 Ga0466692_085593 3300042591 Bacteria 1273
116 Ga0466694_050440 3300042594 Bacteria 148325
117 Ga0466712_321433 3300042614 Bacteria 1074
118 Ga0466718_074931 3300042617 Bacteria 2681
119 Ga0466728_115892 3300042620 Bacteria 1837
120 Ga0466735_160649 3300042624 Bacteria 2784
121 Ga0466727_011452 3300042655 Bacteria 2073
122 Ga0466727_062921 3300042655 Bacteria 1712
123 Ga0123357_10152141 3300009784 Bacteria 2803
124 Ga0123353_10283795 3300010167 Bacteria 2540
125 Ga0123353_10982247 3300010167 Unclassified 1137
126 Ga0466719_048042 3300042606 Bacteria 2763
127 Ga0466722_031915 3300042609 Unclassified 10057

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_183729 Ga0466723_183729_227_730 167
2 3300042652 Ga0466708_140935 Ga0466708_140935_2844_3347 167
3 3300042590 Ga0466690_149481 Ga0466690_149481_18_548 176
4 3300042601 Ga0466707_295422 Ga0466707_295422_731_1285 184
5 3300042617 Ga0466718_164571 Ga0466718_164571_872_1474 184
6 3300042620 Ga0466728_427359 Ga0466728_427359_4283_4837 184
7 3300010167 Ga0123353_10283795 Ga0123353_102837954 185
8 3300042601 Ga0466707_197680 Ga0466707_197680_1104_1661 185
9 3300042614 Ga0466712_156476 Ga0466712_156476_51_608 185
10 3300042659 Ga0466733_196083 Ga0466733_196083_465_1022 185
11 3300010049 Ga0123356_12350706 Ga0123356_123507061 186
12 3300042590 Ga0466690_077021 Ga0466690_077021_2706_3266 186
13 3300042609 Ga0466722_211753 Ga0466722_211753_4815_5375 186
14 3300042655 Ga0466727_062921 Ga0466727_062921_1054_1614 186
15 3300042655 Ga0466727_345310 Ga0466727_345310_1021_1581 186
16 3300005201 Ga0072941_1007852 Ga0072941_10078522 187
17 3300010049 Ga0123356_12390275 Ga0123356_123902751 187
18 3300042596 Ga0466696_174819 Ga0466696_174819_144_707 187
19 3300042612 Ga0466705_083478 Ga0466705_083478_4714_5277 187
20 3300042614 Ga0466712_063237 Ga0466712_063237_1059_1622 187
21 3300042614 Ga0466712_076743 Ga0466712_076743_6224_6787 187
22 3300042614 Ga0466712_119927 Ga0466712_119927_10115_10678 187
23 3300042618 Ga0466723_173115 Ga0466723_173115_3254_3817 187
24 3300042620 Ga0466728_100256 Ga0466728_100256_1474_2037 187
25 3300042648 Ga0466709_338486 Ga0466709_338486_2961_3524 187
26 iso_pr_bacteria 2781125632 2781269565 187
27 iso_pr_bacteria 2781125692 2781431153 187
28 3300002449 JGI24698J34947_10007193 JGI24698J34947_100071933 188
29 3300002449 JGI24698J34947_10025873 JGI24698J34947_100258734 188
30 3300002449 JGI24698J34947_10027130 JGI24698J34947_100271304 188
31 3300002449 JGI24698J34947_10031478 JGI24698J34947_100314782 188
32 3300002449 JGI24698J34947_10046057 JGI24698J34947_100460572 188
33 3300002449 JGI24698J34947_10056254 JGI24698J34947_100562542 188
34 3300002449 JGI24698J34947_10123238 JGI24698J34947_101232382 188
35 3300002450 JGI24695J34938_10003317 JGI24695J34938_100033174 188
36 3300002507 JGI24697J35500_11272998 JGI24697J35500_112729983 188
37 3300002509 JGI24699J35502_10838876 JGI24699J35502_108388762 188
38 3300042593 Ga0466691_005473 Ga0466691_005473_93_659 188
39 3300042594 Ga0466694_398210 Ga0466694_398210_2913_3518 188
40 3300042605 Ga0466716_045808 Ga0466716_045808_552_1118 188
41 3300042605 Ga0466716_343551 Ga0466716_343551_1958_2524 188
42 3300042606 Ga0466719_048042 Ga0466719_048042_1921_2487 188
43 3300042609 Ga0466722_067302 Ga0466722_067302_947_1564 188
44 3300042614 Ga0466712_321433 Ga0466712_321433_399_965 188
45 3300042615 Ga0466711_119451 Ga0466711_119451_474_1040 188
46 3300042616 Ga0466715_161310 Ga0466715_161310_990_1556 188
47 3300042618 Ga0466723_351412 Ga0466723_351412_2787_3353 188
48 3300042620 Ga0466728_115892 Ga0466728_115892_124_690 188
49 3300042620 Ga0466728_156223 Ga0466728_156223_1307_1873 188
50 3300042643 Ga0466704_114740 Ga0466704_114740_3321_3887 188
51 3300042648 Ga0466709_076631 Ga0466709_076631_1793_2359 188
52 3300042652 Ga0466708_435463 Ga0466708_435463_294_860 188
53 3300042655 Ga0466727_033805 Ga0466727_033805_225_791 188
54 iso_pr_bacteria 2781125636 2781279655 188
55 iso_pr_bacteria 2781125646 2781302004 188
56 3300002450 JGI24695J34938_10001812 JGI24695J34938_100018127 189
57 3300002450 JGI24695J34938_10034018 JGI24695J34938_100340183 189
58 3300009826 Ga0123355_10300833 Ga0123355_103008333 189
59 3300042609 Ga0466722_097331 Ga0466722_097331_51254_51823 189
60 3300042655 Ga0466727_011452 Ga0466727_011452_1197_1766 189
61 3300010167 Ga0123353_10193301 Ga0123353_101933013 190
62 3300042619 Ga0466726_325872 Ga0466726_325872_1360_1932 190
63 3300042624 Ga0466735_160649 Ga0466735_160649_714_1286 190
64 3300042659 Ga0466733_141867 Ga0466733_141867_96242_96814 190
65 iso_pr_bacteria 2781125644 2781296628 190
66 3300042609 Ga0466722_031915 Ga0466722_031915_306_881 191
67 3300042612 Ga0466705_401387 Ga0466705_401387_4065_4691 191
68 3300042643 Ga0466704_164197 Ga0466704_164197_3827_4453 191
69 3300042648 Ga0466709_029714 Ga0466709_029714_2828_3403 191
70 3300005083 Ga0068305_10025776 Ga0068305_100257763 192
71 3300010049 Ga0123356_11045363 Ga0123356_110453631 192
72 3300042594 Ga0466694_387293 Ga0466694_387293_1484_2062 192
73 3300042617 Ga0466718_074931 Ga0466718_074931_1102_1680 192
74 3300042617 Ga0466718_168309 Ga0466718_168309_568_1146 192
75 3300042620 Ga0466728_009027 Ga0466728_009027_516_1094 192
76 3300005200 Ga0072940_1132691 Ga0072940_11326911 193
77 3300009784 Ga0123357_10328315 Ga0123357_103283152 193
78 3300042619 Ga0466726_319414 Ga0466726_319414_359_940 193
79 3300042659 Ga0466733_007668 Ga0466733_007668_726_1307 193
80 3300042659 Ga0466733_010066 Ga0466733_010066_1709_2290 193
81 3300002462 JGI24702J35022_10201260 JGI24702J35022_102012601 194
82 3300010167 Ga0123353_10982247 Ga0123353_109822471 194
83 3300010882 Ga0123354_10404458 Ga0123354_104044581 194
84 3300042594 Ga0466694_050440 Ga0466694_050440_5982_6566 194
85 3300042597 Ga0466699_034513 Ga0466699_034513_812_1399 195
86 3300042603 Ga0466714_093436 Ga0466714_093436_1386_1973 195
87 iso_pr_bacteria 2781125656 2781321773 195
88 3300000089 AustNasuHG_c1007295 AustNasuHG_10072953 196
89 3300009826 Ga0123355_10120975 Ga0123355_101209755 196
90 3300010167 Ga0123353_11901839 Ga0123353_119018391 196
91 3300042594 Ga0466694_284525 Ga0466694_284525_834_1424 196
92 3300042597 Ga0466699_188332 Ga0466699_188332_1137_1727 196
93 3300042655 Ga0466727_034725 Ga0466727_034725_491_1081 196
94 3300042659 Ga0466733_104558 Ga0466733_104558_595_1185 196
95 3300024493 Ga0264413_126866 Ga0264413_1268664 197
96 3300042600 Ga0466700_293134 Ga0466700_293134_613_1206 197
97 3300042619 Ga0466726_364796 Ga0466726_364796_6350_6943 197
98 3300042622 Ga0466731_009775 Ga0466731_009775_206_799 197
99 3300042617 Ga0466718_147733 Ga0466718_147733_6919_7515 198
100 3300042617 Ga0466718_138075 Ga0466718_138075_1716_2351 199
101 3300042659 Ga0466733_106930 Ga0466733_106930_21513_22112 199
102 iso_pr_bacteria 2781125691 2781430095 199
103 iso_pr_bacteria 2781125694 2781436319 199
104 3300009784 Ga0123357_10152141 Ga0123357_101521412 200
105 3300009826 Ga0123355_10519472 Ga0123355_105194723 200
106 3300010167 Ga0123353_10744769 Ga0123353_107447692 200
107 3300042621 Ga0466729_058776 Ga0466729_058776_485_1087 200
108 3300042617 Ga0466718_107714 Ga0466718_107714_3474_4124 201
109 3300042619 Ga0466726_073037 Ga0466726_073037_1946_2551 201
110 3300042591 Ga0466692_160371 Ga0466692_160371_34942_35553 203
111 3300042596 Ga0466696_439187 Ga0466696_439187_894_1505 203
112 3300042635 Ga0466702_390788 Ga0466702_390788_5903_6514 203
113 3300042606 Ga0466719_101627 Ga0466719_101627_15169_15783 204
114 3300042614 Ga0466712_053789 Ga0466712_053789_9298_9912 204
115 3300042591 Ga0466692_140301 Ga0466692_140301_32_649 205
116 3300042602 Ga0466713_129916 Ga0466713_129916_1438_2055 205
117 3300042590 Ga0466690_044099 Ga0466690_044099_2240_2860 206
118 3300042591 Ga0466692_085593 Ga0466692_085593_260_880 206
119 3300042593 Ga0466691_063715 Ga0466691_063715_14159_14779 206
120 3300042598 Ga0466701_096225 Ga0466701_096225_1359_2003 206
121 3300042616 Ga0466715_096853 Ga0466715_096853_6763_7383 206
122 3300042659 Ga0466733_113524 Ga0466733_113524_3500_4120 206
123 3300042601 Ga0466707_034916 Ga0466707_034916_997_1620 207
124 3300042618 Ga0466723_028374 Ga0466723_028374_4734_5357 207
125 3300002462 JGI24702J35022_10096888 JGI24702J35022_100968882 208
126 2225789004 2227619060 2228196385 210
127 3300042619 Ga0466726_433135 Ga0466726_433135_748_1380 210
128 3300042601 Ga0466707_113026 Ga0466707_113026_16545_17180 211
129 3300042605 Ga0466716_506768 Ga0466716_506768_1364_1999 211
130 3300042617 Ga0466718_091106 Ga0466718_091106_3754_4389 211
131 iso_pr_bacteria 2820053807 2820056111 214
132 3300000062 IMNBL1DRAFT_c0003243 IMNBL1DRAFT_00032437 220
133 3300042605 Ga0466716_195783 Ga0466716_195783_3713_4375 220
134 iso_pr_bacteria 2820166269 2820168229 220
135 3300042609 Ga0466722_012784 Ga0466722_012784_261_935 224
136 3300042609 Ga0466722_129040 Ga0466722_129040_4406_5086 226
137 3300042620 Ga0466728_044377 Ga0466728_044377_3068_3760 230

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01351 RNase_HII Ribonuclease HII 13 99 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01351 GO:0004523 RNA-DNA hybrid ribonuclease activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.